Diaphorina citri psyllid: psy7223

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MDHLGCFSGGMFGLAAHTRPNSELFNKYMDVAKGITNTCHEAYIQTATHIGFKVSSSPLRLVFLRAASLPCQQNFRRNTALEKHCRTEYGYTGIKNVYQENPQQDDVQQSFFLAETLKYLYLLFSDDSLLPLDQWVFNSEGHPLPVKGKNDFYREASSDVGAAPIS

ccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccEEEccccccccccccccccccccccccccccc

MDHLGCFSGGMFGLAAHTRPNSELFNKYMDVAKGITNTCHEAYIQTATHIGFKVSSSPLRLVFLRAASLPCQQNFRRNTALEKHCRTEYGYTGIKNVYQENPQQDDVQQSFFLAETLKYLYLLFSDDSLLPLDQWVFNSEGHPLPVKG******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDHLGCFSGGMFGLAAHTRPNSELFNKYMDVAKGITNTCHEAYIQTATHIGFKVSSSPLRLVFLRAASLPCQQNFRRNTALEKHCRTEYGYTGIKNVYQENPQQDDVQQSFFLAETLKYLYLLFSDDSLLPLDQWVFNSEGHPLPVKGKNDFYREASSDVGAAPIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mannosyl-oligosaccharide alpha-1,2-mannosidase isoform B	Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).	confident	P53625

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004559 [MF]	alpha-mannosidase activity	probable	GO:0016787, GO:0015923, GO:0016798, GO:0003824, GO:0003674, GO:0004553
GO:0000139 [CC]	Golgi membrane	probable	GO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005802 [CC]	trans-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NXC, chain A
Confidence level:very confident
Coverage over the Query: 1-148
View the alignment between query and template
View the model in PyMOL