Diaphorina citri psyllid: psy7227

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-----

MPFNVYGFVNYALELLVLKTFGEETWEKINIFSVRICQLRSGAPGPENVWRGDVGENQFLVRQIYEDEITYNLIGAAVGVLNIPANTILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQVLNLDALHDHLGTLYPGMRAPSFRCTETDDGALVLHYYSDRPGLEHIVIGIVKTVASKLHNTEVEVEILKTKEECDHVQFLITETSAPERVELPQIEEIETLSLEPKISPATFCRLFPFHIMFDRDKVEVEILKTKEECDHVQFLITETSAPERVELPQIEEIETLSLEPKISPATFCRLFPFHIMFDRDLVIEQVGTALSRVIPCLGEMSNCTLTHILDPVRPHLDLTFDNILAHINTVYVLKTKPGIMQTGAEECYSTLRIKGQMLYVPESDLMIFLCYPSVVNLDDLTRRGLFISDIPLHDATRDLVLMSEQFEADYKLTRNLEFLTDKLQQTYRELEGEKQKTDRLLCSPDNEDPQFQFEYRGPVTMKGKSEPMEVWFLSRGKEYITSLLSSVRLLYSVLPASVANELRHKRPVPPKRFDCVTLLFSGIVGFSDYCATHTDSKGAMKIVTMLNQLYTTYDDLTDPKKNPNVYKVETVGDKYMAVSGLPVSCQDHARCIARLALHPKNSRK

cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHcccccHHHHHcccccHHHHHHHHccccccccccEEEEEcccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEEEccccccEEEEEEEEccccccccccccHHHHccccccccccccccccccCEEEEcccHHHHHHHHcccccccccEEEECcccccccccccccccccccccccccccHHccccccEEEEccccEEEEEcccccccccccccccccccccEEccccccccccHHHHHHccccEEEEEccccccccccccccccEEEEEEEEEEccccEEEEEcccccccHHHHHHccccccccccccccccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccCEEEEEcccccHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHcc

MPFNVYGFVNYALELLVLKTFGEETWEKINIFSVRICQLRSGAPGPENVWRGDVGENQFLVRQIYEDEITYNLIGAAVGVLNIPANTILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQVLNLDALHDHLGTLYPGMRAPSFRCTETDDGALVLHYYSDRPGLEHIVIGIVKTVASKLHNTEVEVEILKTKEECDHVQFLITETSAPERVELPQIEEIETLSLEPKISPATFCRLFPFHIMFDRDKVEVEILKTKEECDHVQFLITETSAPERVELPQIEEIETLSLEPKISPATFCRLFPFHIMFDRDLVIEQVGTALSRVIPCLGEMSNCTLTHILDPVRPHLDLTFDNILAHINTVYVLKTKPGIMQTGAEECYSTLRIKGQMLYVPESDLMIFLCYPSVVNLDDLTRRGLFISDIPLHDATRDLVLMSEQFEADYKLTRNLEFLTDKLQQTY********KTDRLLCSPDNEDPQFQFEYRGPVTMKGKSEPMEVWFLSRGKEYITSLLSSVRLLYSVLPASVANELRHKRPVPPKRFDCVTLLFSGIVGFSDYCATHTDSKGAMKIVTMLNQLYTTYDDLTDPKKNPNVYKVETVGDKYMAVSGLPVSCQDHARCIARLALHPKNSR*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPFNVYGFVNYALELLVLKTFGEETWEKINIFSVRICQLRSGAPGPENVWRGDVGENQFLVRQIYEDEITYNLIGAAVGVLNIPANTILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQVLNLDALHDHLGTLYPGMRAPSFRCTETDDGALVLHYYSDRPGLEHIVIGIVKTVASKLHNTEVEVEILKTKEECDHVQFLITETSAPERVELPQIEEIETLSLEPKISPATFCRLFPFHIMFDRDKVEVEILKTKEECDHVQFLITETSAPERVELPQIEEIETLSLEPKISPATFCRLFPFHIMFDRDLVIEQVGTALSRVIPCLGEMSNCTLTHILDPVRPHLDLTFDNILAHINTVYVLKTKPGIMQTGAEECYSTLRIKGQMLYVPESDLMIFLCYPSVVNLDDLTRRGLFISDIPLHDATRDLVLMSEQFEADYKLTRNxxxxxxxxxxxxxxxxxxxxxxxxxLCSPDNEDPQFQFEYRGPVTMKGKSEPMEVWFLSRGKEYITSLLSSVRLLYSVLPASVANELRHKRPVPPKRFDCVTLLFSGIVGFSDYCATHTDSKGAMKIVTMLNQLYTTYDDLTDPKKNPNVYKVETVGDKYMAVSGLPVSCQDHARCIARLALHPKNSRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Guanylate cyclase soluble subunit beta-1		confident	Q4ZHR9
Guanylate cyclase soluble subunit beta-1		confident	Q02153
Guanylate cyclase soluble subunit beta-1		confident	P16068

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008074 [CC]	guanylate cyclase complex, soluble	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
4.-.-.-	Lyases.	probable
4.6.-.-	Phosphorus-oxygen lyases.	probable
4.6.1.-	Phosphorus-oxygen lyases.	probable
4.6.1.2	Guanylate cyclase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TFG, chain A
Confidence level:very confident
Coverage over the Query: 5-41,52-207
View the alignment between query and template
View the model in PyMOL

Template: 2P08, chain A
Confidence level:very confident
Coverage over the Query: 292-368,380-411
View the alignment between query and template
View the model in PyMOL

Template: 1Y10, chain A
Confidence level:very confident
Coverage over the Query: 509-634
View the alignment between query and template
View the model in PyMOL

Template: 2P08, chain A
Confidence level:very confident
Coverage over the Query: 229-292
View the alignment between query and template
View the model in PyMOL

Template: 2WZ1, chain A
Confidence level:very confident
Coverage over the Query: 441-510
View the alignment between query and template
View the model in PyMOL

Template: 3HLS, chain A
Confidence level:very confident
Coverage over the Query: 426-470,520-535
View the alignment between query and template
View the model in PyMOL