Diaphorina citri psyllid: psy7229

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---

MLHDGLRLEQFLWTGSGDGEDFGPNAIHPTPPVVITTIFHTTTIHTTVFPPSVFTTSSAMLPGNAHWDWVETVGDKYMAVSGLPVSCQDHARCIARLAHILDPVRPHLDLTFDNILAHINTVYVLKTKPGIMQTGAEECYSTLRIKGQMLYVPESDLMIFLCYPSVVNLDDLTRRGLFISDIT

cccccEEEEEEEECccccccccccccccccccccEEccccccccccccccccCECcccccccccccccEEEEEEcccCEEEccccccccHHHHHHcccccEEccccccCECHHHHHHcccccEEEEEcccccccccccccccEEEEEEEEEEccccEEEEECccccccHHHHHHcccEEcccc

*LHDGLRLEQFLWTGSGDGEDFGPNAIHPTPPVVITTIFHTTTIHTTVFPPSVFTTSSAMLPGNAHWDWVETVGDKYMAVSGLPVSCQDHARCIARLAHILDPVRPHLDLTFDNILAHINTVYVLKTKPGIMQTGAEECYSTLRIKGQMLYVPESDLMIFLCYPSVVNLDDLTRRGLFISDIT

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLHDGLRLEQFLWTGSGDGEDFGPNAIHPTPPVVITTIFHTTTIHTTVFPPSVFTTSSAMLPGNAHWDWVETVGDKYMAVSGLPVSCQDHARCIARLAHILDPVRPHLDLTFDNILAHINTVYVLKTKPGIMQTGAEECYSTLRIKGQMLYVPESDLMIFLCYPSVVNLDDLTRRGLFISDIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Guanylate cyclase soluble subunit beta-1		confident	Q4ZHR9
Guanylate cyclase soluble subunit beta-1		confident	Q02153
Guanylate cyclase soluble subunit beta-1		confident	P16068

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008074 [CC]	guanylate cyclase complex, soluble	probable	GO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0051879 [MF]	Hsp90 protein binding	probable	GO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0046982 [MF]	protein heterodimerization activity	probable	GO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0020037 [MF]	heme binding	probable	GO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0006182 [BP]	cGMP biosynthetic process	probable	GO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0046068, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0009259, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0009987, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:0044281
GO:0043167 [MF]	ion binding	probable	GO:0003674, GO:0005488
GO:0007263 [BP]	nitric oxide mediated signal transduction	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0019932, GO:0007154, GO:0035556, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WZ1, chain A
Confidence level:very confident
Coverage over the Query: 26-105
View the alignment between query and template
View the model in PyMOL

Template: 2P08, chain A
Confidence level:confident
Coverage over the Query: 50-129,141-172
View the alignment between query and template
View the model in PyMOL