Diaphorina citri psyllid: psy7238


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MEIIWVMRAAIFVTGILSTVMALTIPSIYGLWSMCSDLVYCILFPQLLMVVHFKHHCNTYGSLAAYIMAFLVRVSGGEPQLGLSPFIYYPDYDYENSRQMFPFRTMAMLMSLSTLASVSWLSK
cEEEEEHHHHHHHHHHHHHHHHHHHcHHHHHHHccccHHEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccCECccHHHHHHHHHHHHHHHHHHccc
MEIIWVMRAAIFVTGILSTVMALTIPSIYGLWSMCSDLVYCILFPQLLMVVHFKHHCNTYGSLAAYIMAFLVRVSGGEPQLGLSPFIYYPDYDYENSRQMFPFRTMAMLMSLSTLASVSWLSK
xxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIIWVMRAAIFVTGILSTVMALTIPSIYGLWSMCSDLVYCILFPQLLMVVHFKHHCNTYGSLAAYIMAFLVRVSGGEPQLGLSPFIYYPDYDYENSRQMFPFRTMAMLMSLSTLASVSWLSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
High-affinity choline transporter 1 Imports choline from the extracellular space to the neuron with high affinity. Rate-limiting step in acetylcholine synthesis. Sodium ion and chloride ion dependent.confidentQ9VE46
High-affinity choline transporter 1 Imports choline from the extracellular space to the neuron with high affinity. Choline uptake is the rate-limiting step in acetylcholine synthesis. Sodium ion and chloride ion dependent.confidentO02228

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0003674 [MF]molecular_functionprobable
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XQ2, chain A
Confidence level:confident
Coverage over the Query: 1-123
View the alignment between query and template
View the model in PyMOL