Diaphorina citri psyllid: psy7251


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MDPEGFLPVTLITSFSHYMPFEYYFSADNLVRDIFLRKKMDPEGFLPVTLIASFSRVRSLTTDINRVLLAIQKSDKLELVDNFKVNQIIVIADTNGKQRSDYLPNNNHLHSNNNKRLTSLRSRLTLLSPNGQRMMISLLLLALTTQTIGNR
cccccccccccccHHHHHcccccccccccccccHHHHHHccccccEEHHHHHccHHHHcccccHHHHHHHHHccccEEEEcccEEEEccccccccccccccccccccccccccccccccHHHHHHHHcccccEEEEEEEEccccccccccc
*****FLPVTLITSFSHYMPFEYYFSADNLVRDIFLRKKMDPEGFLPVTLIASFSRVRSLTTDINRVLLAIQKSDKLELVDNFKVNQIIVIADTNGKQRSDYLPNNNHLH***N******RSRLTLLSPNGQRMMISLLLLALTTQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPEGFLPVTLITSFSHYMPFEYYFSADNLVRDIFLRKKMDPEGFLPVTLIASFSRVRSLTTDINRVLLAIQKSDKLELVDNFKVNQIIVIADTNGKQRSDYLPNNNHLHSNNNKRLTSLRSRLTLLSPNGQRMMISLLLLALTTQTIGNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016239 [BP]positive regulation of macroautophagyprobableGO:0032106, GO:0032107, GO:0032104, GO:0032103, GO:0031329, GO:0032101, GO:0009896, GO:0048584, GO:0031323, GO:0009894, GO:0032109, GO:0010647, GO:0010646, GO:0050789, GO:0009893, GO:0019222, GO:0010508, GO:0065007, GO:0048518, GO:0010506, GO:0031325, GO:0016241, GO:0031331, GO:0048583, GO:0050794, GO:0008150, GO:0080134, GO:0080135, GO:0048522
GO:0008266 [MF]poly(U) RNA bindingprobableGO:0097159, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:0008187, GO:1901363, GO:0005488
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0034046 [MF]poly(G) RNA bindingprobableGO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S29, chain A
Confidence level:very confident
Coverage over the Query: 8-92
View the alignment between query and template
View the model in PyMOL