Diaphorina citri psyllid: psy7331


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MGAYLSQPITKKESTNHEGSNLTCGASSMQGWRIYQEDAHNVIIDFDENKSLFAVYDGHGGSEVAVYTSQHLPEFIKKTEQFKKGNYKQALIDAFMEFDESLIKDEVMAILKTLKKENEVMAILKTLKKEITVSYFTKK
ccccccccccEEEccccccccEEEEEEcccccccccccEEEEECcccccCEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEcccccc
MGAYLSQPITKKE*TNHEGSNLTCGASSMQGWRIYQEDAHNVIIDFDENKSLFAVYDGHGGSEVAVYTSQHLPEFIKKTEQFKKGNYKQALIDAFMEFDESLIKDEVMAILKTLKKENEVMAILKTLKKEITVSYFTKK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAYLSQPITKKESTNHEGSNLTCGASSMQGWRIYQEDAHNVIIDFDENKSLFAVYDGHGGSEVAVYTSQHLPEFIKKTEQFKKGNYKQALIDAFMEFDESLIKDEVMAILKTLKKENEVMAILKTLKKEITVSYFTKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable protein phosphatase CG10417 confidentQ7K4Q5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0035970 [BP]peptidyl-threonine dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004722 [MF]protein serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I0O, chain A
Confidence level:very confident
Coverage over the Query: 1-138
View the alignment between query and template
View the model in PyMOL