Query         psy7353
Match_columns 139
No_of_seqs    121 out of 2185
Neff          10.6
Searched_HMMs 46136
Date          Sat Aug 17 00:35:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7353.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7353hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 5.5E-29 1.2E-33  163.5   3.5  121    2-133   142-265 (279)
  2 KOG2462|consensus               99.9   9E-26   2E-30  148.4   4.7  114   15-136   127-240 (279)
  3 KOG3576|consensus               99.8 9.1E-20   2E-24  115.5   1.5  115   14-136   113-237 (267)
  4 KOG3623|consensus               99.7 2.2E-17 4.8E-22  121.0   3.7  110   18-134   210-332 (1007)
  5 KOG3608|consensus               99.7 8.6E-18 1.9E-22  114.4  -0.2  125    2-134   191-315 (467)
  6 KOG1074|consensus               99.6 3.4E-16 7.3E-21  116.3   2.5   84   55-139   606-696 (958)
  7 KOG3623|consensus               99.6 2.8E-16   6E-21  115.4   1.3   83   52-135   892-974 (1007)
  8 KOG1074|consensus               99.6 4.5E-16 9.7E-21  115.6   1.8   52   82-134   605-656 (958)
  9 KOG3576|consensus               99.5   4E-16 8.6E-21   99.1  -0.7   85   52-137   115-199 (267)
 10 KOG3608|consensus               99.5 5.7E-15 1.2E-19  100.8   3.2  110   18-135   263-376 (467)
 11 PHA00733 hypothetical protein   99.2 3.8E-12 8.3E-17   77.3   2.4   82   52-136    38-124 (128)
 12 PHA00733 hypothetical protein   99.2 7.5E-12 1.6E-16   76.0   3.2   97    2-107    24-124 (128)
 13 PLN03086 PRLI-interacting fact  99.2 4.8E-11   1E-15   87.6   6.9  110   12-137   447-566 (567)
 14 PHA02768 hypothetical protein;  99.1 9.1E-11   2E-15   59.9   2.6   44   82-128     5-48  (55)
 15 PHA02768 hypothetical protein;  98.9 9.4E-10   2E-14   56.2   1.8   44   54-99      5-48  (55)
 16 PF13465 zf-H2C2_2:  Zinc-finge  98.8 2.1E-09 4.5E-14   47.1   0.6   24   98-122     2-25  (26)
 17 PHA00732 hypothetical protein   98.7   2E-08 4.3E-13   55.9   3.2   37   83-122     2-38  (79)
 18 PLN03086 PRLI-interacting fact  98.7 9.1E-08   2E-12   70.7   7.0  103   19-133   408-536 (567)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.6 3.1E-08 6.6E-13   43.4   2.2   25   69-93      1-25  (26)
 20 KOG3993|consensus               98.6 2.8E-09 6.1E-14   74.9  -2.8   85   54-138   267-383 (500)
 21 PHA00616 hypothetical protein   98.4 1.1E-07 2.3E-12   46.4   1.0   35   82-117     1-35  (44)
 22 PF05605 zf-Di19:  Drought indu  98.4 2.8E-07 6.1E-12   47.6   2.6   51   82-135     2-53  (54)
 23 PHA00616 hypothetical protein   98.1 1.5E-06 3.2E-11   42.4   1.3   31   55-85      2-32  (44)
 24 PHA00732 hypothetical protein   98.1 3.5E-06 7.6E-11   46.9   2.9   37   19-65      2-38  (79)
 25 PF05605 zf-Di19:  Drought indu  98.1 1.4E-05 3.1E-10   41.2   4.6   48   19-75      3-50  (54)
 26 COG5189 SFP1 Putative transcri  98.0   4E-06 8.7E-11   57.5   2.1   56   80-135   347-422 (423)
 27 KOG3993|consensus               98.0 4.1E-06 8.9E-11   59.4   1.8   27  111-137   458-484 (500)
 28 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.9E-06   4E-11   37.9  -1.3   22   83-104     2-23  (27)
 29 PF00096 zf-C2H2:  Zinc finger,  97.8 1.3E-05 2.8E-10   33.7   1.1   22   83-104     1-22  (23)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.8   2E-06 4.4E-11   36.5  -1.5   23   83-105     1-23  (24)
 31 PF13894 zf-C2H2_4:  C2H2-type   97.7 2.5E-05 5.4E-10   33.0   1.6   22  113-134     2-23  (24)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.6 2.9E-05 6.2E-10   34.0   1.3   25  111-135     1-25  (27)
 33 PF00096 zf-C2H2:  Zinc finger,  97.5 8.5E-05 1.8E-09   31.1   2.1   22   19-45      1-22  (23)
 34 PF12756 zf-C2H2_2:  C2H2 type   97.5 1.3E-05 2.7E-10   46.5  -0.8   73   56-134     1-73  (100)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.3 0.00017 3.6E-09   41.7   2.4   74   20-106     1-74  (100)
 36 PF12171 zf-C2H2_jaz:  Zinc-fin  97.2 0.00011 2.4E-09   32.2   0.3   22  112-133     2-23  (27)
 37 COG5189 SFP1 Putative transcri  97.1 0.00013 2.9E-09   50.2   0.4   71   16-103   347-419 (423)
 38 PRK04860 hypothetical protein;  97.1 0.00028 6.1E-09   44.6   1.4   40   82-126   119-158 (160)
 39 smart00355 ZnF_C2H2 zinc finge  97.0 0.00017 3.7E-09   30.7  -0.1   21  112-132     1-21  (26)
 40 PF12874 zf-met:  Zinc-finger o  96.8 8.1E-05 1.7E-09   31.9  -1.8   20   84-103     2-21  (25)
 41 PF13909 zf-H2C2_5:  C2H2-type   96.8 0.00083 1.8E-08   28.4   1.2   23   83-106     1-23  (24)
 42 smart00355 ZnF_C2H2 zinc finge  96.7  0.0017 3.8E-08   27.4   2.0   22   83-104     1-22  (26)
 43 PF09237 GAGA:  GAGA factor;  I  96.7  0.0032 6.9E-08   31.6   3.0   30   52-81     22-51  (54)
 44 PF09237 GAGA:  GAGA factor;  I  96.7 0.00016 3.4E-09   36.2  -1.6   25   80-104    22-46  (54)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5  0.0022 4.8E-08   27.9   1.7   22   83-104     2-23  (27)
 46 PF13909 zf-H2C2_5:  C2H2-type   96.5 0.00022 4.7E-09   30.2  -1.7   24  112-136     1-24  (24)
 47 PRK04860 hypothetical protein;  96.2  0.0054 1.2E-07   38.9   2.9   39   53-95    118-156 (160)
 48 PF12874 zf-met:  Zinc-finger o  96.0  0.0036 7.8E-08   26.6   1.1   22  112-133     1-22  (25)
 49 cd00350 rubredoxin_like Rubred  95.2   0.016 3.5E-07   26.5   1.6   10  110-119    16-25  (33)
 50 KOG2231|consensus               95.1   0.043 9.4E-07   42.2   4.5   97   32-135   123-236 (669)
 51 smart00451 ZnF_U1 U1-like zinc  95.0  0.0056 1.2E-07   28.2  -0.2   23  111-133     3-25  (35)
 52 KOG2893|consensus               94.6   0.013 2.7E-07   39.2   0.6   35   52-91      9-43  (341)
 53 PF13913 zf-C2HC_2:  zinc-finge  94.4   0.036 7.8E-07   23.6   1.6   19   84-103     4-22  (25)
 54 COG5048 FOG: Zn-finger [Genera  93.8   0.043 9.4E-07   39.6   2.0   55   82-136   289-348 (467)
 55 KOG1146|consensus               93.8   0.013 2.9E-07   47.7  -0.7   25  109-133   516-540 (1406)
 56 PF09986 DUF2225:  Uncharacteri  93.1   0.035 7.7E-07   36.9   0.6   13  112-124    49-61  (214)
 57 COG5236 Uncharacterized conser  92.7   0.047   1E-06   38.6   0.8   16  120-135   290-305 (493)
 58 COG1592 Rubrerythrin [Energy p  92.7   0.092   2E-06   33.4   2.0   25   81-119   133-157 (166)
 59 KOG2893|consensus               92.7   0.048 1.1E-06   36.5   0.8   43   17-72     10-52  (341)
 60 PF06524 NOA36:  NOA36 protein;  92.4   0.089 1.9E-06   35.7   1.7   82   15-104   139-231 (314)
 61 COG2888 Predicted Zn-ribbon RN  91.8    0.13 2.8E-06   26.7   1.6    8  111-118    50-57  (61)
 62 KOG1146|consensus               91.1   0.076 1.6E-06   43.7   0.4   56   80-135   516-613 (1406)
 63 cd00729 rubredoxin_SM Rubredox  90.8    0.25 5.4E-06   22.7   1.8   25   82-119     2-26  (34)
 64 COG5048 FOG: Zn-finger [Genera  89.3    0.18 3.9E-06   36.4   1.0   60   54-114   289-354 (467)
 65 COG4049 Uncharacterized protei  89.2   0.051 1.1E-06   27.8  -1.3   29   78-106    13-41  (65)
 66 PHA00626 hypothetical protein   88.8    0.15 3.3E-06   26.1   0.3   14  110-123    22-35  (59)
 67 COG4049 Uncharacterized protei  88.5    0.38 8.2E-06   24.7   1.6   31   12-47     11-41  (65)
 68 PRK14890 putative Zn-ribbon RN  87.5    0.38 8.2E-06   25.0   1.3   10  110-119    47-56  (59)
 69 KOG2482|consensus               87.1    0.73 1.6E-05   32.8   2.9   51   83-133   280-356 (423)
 70 PRK00464 nrdR transcriptional   86.8    0.21 4.6E-06   31.5   0.1   15  112-126    29-43  (154)
 71 TIGR00373 conserved hypothetic  85.7     1.3 2.7E-05   28.1   3.2   17   81-97    108-124 (158)
 72 TIGR00622 ssl1 transcription f  84.2     1.9 4.2E-05   25.6   3.3   47   85-134    58-104 (112)
 73 PF09538 FYDLN_acid:  Protein o  84.0       1 2.2E-05   26.7   2.1   15   81-95     25-39  (108)
 74 KOG2186|consensus               83.3    0.89 1.9E-05   31.0   1.8   49   18-77      3-51  (276)
 75 PRK06266 transcription initiat  82.0     2.1 4.5E-05   27.8   3.1   14   82-95    117-130 (178)
 76 smart00834 CxxC_CXXC_SSSS Puta  80.6    0.88 1.9E-05   21.4   0.8   11   83-93      6-16  (41)
 77 PF09723 Zn-ribbon_8:  Zinc rib  80.4    0.72 1.6E-05   22.2   0.5   13   83-95      6-18  (42)
 78 PF13717 zinc_ribbon_4:  zinc-r  79.7     1.6 3.5E-05   20.2   1.5   10  112-121    26-35  (36)
 79 KOG2186|consensus               78.8     1.7 3.6E-05   29.7   1.9   47   54-103     3-49  (276)
 80 KOG4173|consensus               77.5     1.1 2.5E-05   29.5   0.9   70   32-107    90-171 (253)
 81 PF02892 zf-BED:  BED zinc fing  77.3     1.4   3E-05   21.3   0.9   20   83-102    17-40  (45)
 82 COG0068 HypF Hydrogenase matur  77.0    0.31 6.7E-06   37.9  -2.1   56   57-120   126-182 (750)
 83 PF13451 zf-trcl:  Probable zin  76.8     1.2 2.6E-05   22.3   0.6   17   81-97      3-19  (49)
 84 PF12013 DUF3505:  Protein of u  75.8    0.69 1.5E-05   27.3  -0.5   25  112-136    81-109 (109)
 85 KOG2482|consensus               75.7     6.5 0.00014   28.2   4.1   53   52-104   142-217 (423)
 86 TIGR02605 CxxC_CxxC_SSSS putat  75.4     1.1 2.3E-05   22.5   0.2   11   55-65      6-16  (52)
 87 smart00531 TFIIE Transcription  74.2     5.2 0.00011   25.0   3.2   36   80-120    97-132 (147)
 88 smart00734 ZnF_Rad18 Rad18-lik  74.0     1.2 2.6E-05   19.1   0.2   19  113-132     3-21  (26)
 89 PRK00398 rpoP DNA-directed RNA  72.4     1.7 3.7E-05   21.3   0.6   11   82-92      3-13  (46)
 90 PF10571 UPF0547:  Uncharacteri  72.4     2.5 5.3E-05   18.1   1.0   10  113-122    16-25  (26)
 91 KOG4173|consensus               71.5    0.54 1.2E-05   31.0  -1.7   76   53-131    78-166 (253)
 92 PF14353 CpXC:  CpXC protein     71.3     4.5 9.7E-05   24.5   2.4   12  112-123    39-50  (128)
 93 smart00614 ZnF_BED BED zinc fi  69.9     3.8 8.2E-05   20.4   1.5   20   84-103    20-44  (50)
 94 PRK09678 DNA-binding transcrip  69.5    0.91   2E-05   24.8  -0.9   14  111-124    27-42  (72)
 95 TIGR02300 FYDLN_acid conserved  69.5       5 0.00011   24.5   2.2   15   81-95     25-39  (129)
 96 COG1997 RPL43A Ribosomal prote  68.5     2.7 5.8E-05   23.8   0.8   31   54-94     35-65  (89)
 97 PF04959 ARS2:  Arsenite-resist  68.5     2.9 6.3E-05   28.0   1.2   27   81-107    76-102 (214)
 98 KOG2231|consensus               67.4     6.5 0.00014   30.9   2.9   78   37-119   163-246 (669)
 99 PF08274 PhnA_Zn_Ribbon:  PhnA   66.2     1.6 3.5E-05   19.5  -0.3    8   82-89     19-26  (30)
100 COG1198 PriA Primosomal protei  65.7     4.1 8.8E-05   32.4   1.6   12  109-120   473-484 (730)
101 PF12907 zf-met2:  Zinc-binding  64.9     2.9 6.4E-05   20.0   0.5   26   84-109     3-31  (40)
102 KOG1280|consensus               64.4     9.8 0.00021   27.4   3.1   40   16-61     77-116 (381)
103 KOG2785|consensus               63.9      14 0.00029   27.0   3.8   58   55-112   167-250 (390)
104 PF04959 ARS2:  Arsenite-resist  63.2      11 0.00024   25.3   3.1   29   15-48     74-102 (214)
105 PF13240 zinc_ribbon_2:  zinc-r  62.8     4.2 9.2E-05   16.8   0.7    6  114-119    16-21  (23)
106 KOG4124|consensus               62.4     3.6 7.8E-05   29.5   0.8   52   81-132   348-419 (442)
107 PF03604 DNA_RNApol_7kD:  DNA d  61.8      12 0.00026   16.9   2.2   10  111-120    17-26  (32)
108 PF07754 DUF1610:  Domain of un  61.0     5.3 0.00012   16.8   0.9   11   16-26     14-24  (24)
109 COG5236 Uncharacterized conser  60.6     3.1 6.8E-05   29.8   0.2   13   91-103   290-302 (493)
110 PF12013 DUF3505:  Protein of u  60.4     6.8 0.00015   23.0   1.6   24   83-106    81-108 (109)
111 PF04780 DUF629:  Protein of un  59.7     2.4 5.3E-05   31.7  -0.5   30   79-108    54-83  (466)
112 smart00661 RPOL9 RNA polymeras  59.6     8.1 0.00018   19.1   1.6   16  111-126    20-35  (52)
113 PRK04023 DNA polymerase II lar  57.7      18 0.00039   30.1   3.8   10  111-120   663-672 (1121)
114 PF05191 ADK_lid:  Adenylate ki  57.6     3.8 8.2E-05   19.0   0.1   11  111-121    21-31  (36)
115 PF07800 DUF1644:  Protein of u  56.6      19 0.00041   23.0   3.1   57   54-112    80-138 (162)
116 PRK03824 hypA hydrogenase nick  56.4     4.9 0.00011   24.8   0.5   11   54-64     70-80  (135)
117 PF12760 Zn_Tnp_IS1595:  Transp  56.2      16 0.00035   17.7   2.3   10  110-119    36-45  (46)
118 COG1655 Uncharacterized protei  55.7     2.9 6.3E-05   28.2  -0.5   16   53-68     18-33  (267)
119 COG4888 Uncharacterized Zn rib  55.2     1.5 3.3E-05   25.4  -1.6   11   52-62     20-30  (104)
120 TIGR00595 priA primosomal prot  54.4       8 0.00017   29.4   1.5   10  110-119   252-261 (505)
121 KOG2785|consensus               54.4      22 0.00047   26.0   3.5   56   16-76    164-242 (390)
122 PRK14714 DNA polymerase II lar  53.9      25 0.00054   30.1   4.1   10   82-91    692-701 (1337)
123 PF08790 zf-LYAR:  LYAR-type C2  52.2     2.1 4.5E-05   18.7  -1.1   20  112-132     1-20  (28)
124 smart00440 ZnF_C2C2 C2C2 Zinc   51.9       2 4.4E-05   20.4  -1.3   10  112-121    29-38  (40)
125 COG1779 C4-type Zn-finger prot  51.5     1.8 3.9E-05   28.4  -2.0   16  112-127    44-59  (201)
126 COG1996 RPC10 DNA-directed RNA  51.4      11 0.00025   18.9   1.3    6   20-25      8-13  (49)
127 PRK10220 hypothetical protein;  51.3      12 0.00026   22.2   1.5   10   83-92     21-30  (111)
128 PF07503 zf-HYPF:  HypF finger;  50.3     1.3 2.8E-05   20.5  -2.1   11  112-122    22-32  (35)
129 KOG3002|consensus               50.1      18  0.0004   25.6   2.6   82   52-139    78-167 (299)
130 PTZ00255 60S ribosomal protein  50.0     5.4 0.00012   22.8  -0.0   32   53-94     35-66  (90)
131 KOG3408|consensus               49.1       4 8.7E-05   24.6  -0.6   23   82-104    57-79  (129)
132 TIGR00686 phnA alkylphosphonat  48.3      12 0.00025   22.2   1.2   10  112-121    20-29  (109)
133 PF05290 Baculo_IE-1:  Baculovi  48.0      31 0.00067   21.3   3.0   57   52-126    78-136 (140)
134 KOG2907|consensus               47.3      12 0.00025   22.4   1.1   40   83-124    75-115 (116)
135 PRK14873 primosome assembly pr  46.6      14 0.00029   29.3   1.7   11  110-120   421-431 (665)
136 KOG2593|consensus               45.8      21 0.00045   26.6   2.4   38   78-119   124-161 (436)
137 PF07975 C1_4:  TFIIH C1-like d  45.7      14  0.0003   18.7   1.1   24   81-104    20-43  (51)
138 COG1675 TFA1 Transcription ini  45.5      41 0.00088   21.9   3.5    8  112-119   133-140 (176)
139 PF07282 OrfB_Zn_ribbon:  Putat  44.9      16 0.00035   19.3   1.4   11   81-91     45-55  (69)
140 PF05443 ROS_MUCR:  ROS/MUCR tr  44.8     4.1 8.8E-05   25.1  -1.1   20   83-105    73-92  (132)
141 PRK12380 hydrogenase nickel in  43.4      16 0.00035   21.7   1.4   10   83-92     71-80  (113)
142 COG1571 Predicted DNA-binding   43.1      22 0.00048   26.4   2.2   11   82-92    367-377 (421)
143 PRK00432 30S ribosomal protein  42.7      11 0.00023   19.0   0.4   10  111-120    37-46  (50)
144 KOG2593|consensus               41.4      21 0.00046   26.5   1.9   38   14-62    124-161 (436)
145 PF13453 zf-TFIIB:  Transcripti  40.8      13 0.00028   17.6   0.5   13   56-68     21-33  (41)
146 PF14311 DUF4379:  Domain of un  40.7      26 0.00057   17.6   1.7   13   83-95     29-41  (55)
147 PF01286 XPA_N:  XPA protein N-  40.4     9.6 0.00021   17.5   0.0   15  113-127     5-19  (34)
148 PF04780 DUF629:  Protein of un  39.8      29 0.00062   26.3   2.4   29   17-50     56-84  (466)
149 KOG0717|consensus               39.2     7.6 0.00016   29.1  -0.6   23  112-134   293-315 (508)
150 PRK05978 hypothetical protein;  38.8      21 0.00044   22.5   1.3   11  113-123    54-64  (148)
151 COG1998 RPS31 Ribosomal protei  38.3      19  0.0004   18.1   0.9   10  111-120    37-46  (51)
152 PF15269 zf-C2H2_7:  Zinc-finge  38.1      23 0.00049   17.4   1.1   22   83-104    21-42  (54)
153 PF01927 Mut7-C:  Mut7-C RNAse   38.0      11 0.00024   23.5   0.1   10  112-121   125-134 (147)
154 PF10013 DUF2256:  Uncharacteri  37.7      23  0.0005   17.1   1.1   16   84-99     10-25  (42)
155 PF13824 zf-Mss51:  Zinc-finger  37.7      41 0.00089   17.3   2.1   11   80-90     12-22  (55)
156 TIGR00143 hypF [NiFe] hydrogen  37.6     2.6 5.6E-05   33.4  -3.4   58   56-121    92-150 (711)
157 PF02176 zf-TRAF:  TRAF-type zi  37.5      15 0.00032   18.7   0.5   18   70-87     26-43  (60)
158 PRK05580 primosome assembly pr  36.2      30 0.00065   27.5   2.1   10  110-119   420-429 (679)
159 COG1326 Uncharacterized archae  35.4      28 0.00061   23.0   1.6   12   81-92     29-40  (201)
160 KOG4118|consensus               34.9      11 0.00023   20.1  -0.3   24  112-135    39-62  (74)
161 COG3357 Predicted transcriptio  34.8      20 0.00044   20.5   0.8   14  110-123    57-70  (97)
162 KOG2636|consensus               34.6      19 0.00042   26.9   0.8   27  106-132   396-423 (497)
163 PF01096 TFIIS_C:  Transcriptio  34.4    0.93   2E-05   21.5  -4.0   10  112-121    29-38  (39)
164 COG2331 Uncharacterized protei  34.3     8.9 0.00019   21.1  -0.7    9   54-62     12-20  (82)
165 PF11672 DUF3268:  Protein of u  33.9      24 0.00052   20.7   1.0    7  112-118    32-38  (102)
166 TIGR00100 hypA hydrogenase nic  33.8      24 0.00051   21.1   1.0   10   55-64     71-80  (115)
167 COG3364 Zn-ribbon containing p  33.8      31 0.00068   20.2   1.4    9   18-26      2-10  (112)
168 smart00154 ZnF_AN1 AN1-like Zi  33.4      21 0.00046   16.8   0.6   13  111-123    12-24  (39)
169 PF11494 Ta0938:  Ta0938;  Inte  33.2      40 0.00086   19.6   1.8   38   52-95     12-50  (105)
170 PF10083 DUF2321:  Uncharacteri  33.2      18  0.0004   22.9   0.5   19   79-97     65-83  (158)
171 TIGR00244 transcriptional regu  33.1      21 0.00045   22.5   0.7   19  110-128    27-45  (147)
172 TIGR03831 YgiT_finger YgiT-typ  33.0      22 0.00048   16.8   0.7   12  112-123    33-44  (46)
173 COG4957 Predicted transcriptio  32.9      15 0.00033   22.7   0.1   18   84-104    78-95  (148)
174 PRK00564 hypA hydrogenase nick  32.9      32  0.0007   20.6   1.5   10   83-92     72-81  (117)
175 KOG4167|consensus               31.9     6.9 0.00015   31.0  -1.8   25   81-105   791-815 (907)
176 COG4896 Uncharacterized protei  31.8      22 0.00048   18.7   0.6    9   53-61     30-38  (68)
177 PF12773 DZR:  Double zinc ribb  31.7      53  0.0011   16.0   2.0   10  111-120    29-38  (50)
178 COG1773 Rubredoxin [Energy pro  31.6      14 0.00031   19.0  -0.1   10  112-121     4-13  (55)
179 KOG1842|consensus               31.5      26 0.00056   26.3   1.1   29   17-50     14-42  (505)
180 cd00730 rubredoxin Rubredoxin;  31.4      20 0.00044   18.0   0.4   11  112-122     2-12  (50)
181 KOG2071|consensus               31.0      25 0.00055   27.2   1.0   28  108-135   415-442 (579)
182 KOG0978|consensus               30.6      40 0.00088   26.9   2.0   19  110-128   677-695 (698)
183 PHA02998 RNA polymerase subuni  30.6      12 0.00026   24.3  -0.7   36   83-122   144-182 (195)
184 KOG4167|consensus               30.6      13 0.00027   29.7  -0.6   25   16-45    790-814 (907)
185 COG1327 Predicted transcriptio  30.5      24 0.00051   22.3   0.6   17  111-127    28-44  (156)
186 PRK05452 anaerobic nitric oxid  30.5      24 0.00052   26.7   0.8   39   80-120   423-467 (479)
187 COG4306 Uncharacterized protei  30.5      31 0.00068   21.0   1.1   16   80-95     66-81  (160)
188 TIGR00627 tfb4 transcription f  30.4      64  0.0014   22.7   2.8   25   82-121   255-279 (279)
189 COG3091 SprT Zn-dependent meta  29.2      34 0.00074   21.7   1.2   34   81-120   116-149 (156)
190 PF07535 zf-DBF:  DBF zinc fing  28.8      34 0.00075   17.1   1.0   20  111-133     5-24  (49)
191 PF07295 DUF1451:  Protein of u  28.7      16 0.00034   23.0  -0.3    9   54-62    112-120 (146)
192 PF14787 zf-CCHC_5:  GAG-polypr  28.3      46 0.00099   15.5   1.2   15  113-127     4-18  (36)
193 PF06397 Desulfoferrod_N:  Desu  27.9      31 0.00067   16.1   0.6   10   17-26      5-14  (36)
194 PF13821 DUF4187:  Domain of un  27.4      34 0.00073   17.5   0.8   18   82-99     27-44  (55)
195 PTZ00448 hypothetical protein;  27.1      25 0.00054   25.7   0.4   23  111-133   314-336 (373)
196 PRK12496 hypothetical protein;  26.5      63  0.0014   20.7   2.1   11   83-93    128-138 (164)
197 smart00586 ZnF_DBF Zinc finger  26.4      22 0.00048   17.8   0.0   21  110-133     4-24  (49)
198 PF04423 Rad50_zn_hook:  Rad50   26.0      20 0.00044   18.0  -0.2   10  113-122    22-31  (54)
199 PRK06260 threonine synthase; V  25.7      54  0.0012   24.1   1.9   12   80-91     17-28  (397)
200 PF14803 Nudix_N_2:  Nudix N-te  25.6      19 0.00041   16.5  -0.3   11   52-62     20-30  (34)
201 KOG4727|consensus               25.6      34 0.00073   22.1   0.7   22   82-103    75-96  (193)
202 PF15135 UPF0515:  Uncharacteri  25.5      80  0.0017   21.9   2.5   10   52-61    110-119 (278)
203 PF14369 zf-RING_3:  zinc-finge  25.5      37 0.00079   15.6   0.7   10  113-122    23-32  (35)
204 PRK14811 formamidopyrimidine-D  25.2      45 0.00098   23.2   1.4   32   84-124   237-268 (269)
205 PF14446 Prok-RING_1:  Prokaryo  24.8      40 0.00086   17.3   0.8   14  113-126     7-20  (54)
206 smart00731 SprT SprT homologue  24.8      35 0.00076   21.2   0.7   32   82-121   112-143 (146)
207 PF10537 WAC_Acf1_DNA_bd:  ATP-  24.6 1.6E+02  0.0034   17.3   4.9   42   17-67      2-43  (102)
208 smart00064 FYVE Protein presen  24.4      62  0.0013   16.9   1.6   27   56-94     12-38  (68)
209 PRK03681 hypA hydrogenase nick  23.7      53  0.0012   19.6   1.3    9   83-91     71-79  (114)
210 KOG1842|consensus               23.6      41 0.00089   25.3   0.9   31   49-79     10-40  (505)
211 PF09845 DUF2072:  Zn-ribbon co  23.6      45 0.00098   20.6   1.0   15   82-96      1-15  (131)
212 COG4391 Uncharacterized protei  23.5      28  0.0006   18.4   0.1   46   73-123    15-60  (62)
213 COG3677 Transposase and inacti  23.4      46 0.00099   20.4   1.0   16  109-124    51-66  (129)
214 PF00301 Rubredoxin:  Rubredoxi  23.4      43 0.00092   16.6   0.7   10  111-120    34-43  (47)
215 PLN02294 cytochrome c oxidase   23.1      45 0.00098   21.6   0.9   11   16-26    139-149 (174)
216 PF09963 DUF2197:  Uncharacteri  23.0      19 0.00041   18.6  -0.6   36   56-91      4-40  (56)
217 PLN02748 tRNA dimethylallyltra  23.0      36 0.00077   25.8   0.6   25  110-134   417-442 (468)
218 KOG1994|consensus               22.7      40 0.00086   22.9   0.7   24   80-103   237-260 (268)
219 CHL00174 accD acetyl-CoA carbo  22.6      32 0.00069   24.4   0.2   32   55-95     39-70  (296)
220 cd00924 Cyt_c_Oxidase_Vb Cytoc  21.6      50  0.0011   19.2   0.9   10   17-26     78-87  (97)
221 PF03145 Sina:  Seven in absent  21.5      24 0.00052   23.1  -0.5   37   69-107    32-72  (198)
222 PF13878 zf-C2H2_3:  zinc-finge  21.4      43 0.00094   15.9   0.5   13  112-124    14-26  (41)
223 PRK14892 putative transcriptio  21.3      32 0.00069   20.1   0.0    9   53-61     20-28  (99)
224 COG5188 PRP9 Splicing factor 3  21.2      40 0.00087   24.6   0.5   27  106-132   369-396 (470)
225 PRK12860 transcriptional activ  21.1      84  0.0018   20.8   1.9   46   63-118   116-161 (189)
226 COG4338 Uncharacterized protei  20.9      36 0.00078   17.0   0.1   16   84-99     14-29  (54)
227 COG1594 RPB9 DNA-directed RNA   20.7      20 0.00042   21.4  -1.0   11  112-122   101-111 (113)
228 COG5151 SSL1 RNA polymerase II  20.7      41 0.00088   24.1   0.4   23  110-132   387-409 (421)
229 cd00065 FYVE FYVE domain; Zinc  20.4   1E+02  0.0023   15.2   1.9   12   83-94     19-30  (57)
230 TIGR00515 accD acetyl-CoA carb  20.2      38 0.00083   23.9   0.2   32   55-95     27-58  (285)
231 PF08271 TF_Zn_Ribbon:  TFIIB z  20.0      56  0.0012   15.5   0.7    9  112-120     1-9   (43)

No 1  
>KOG2462|consensus
Probab=99.95  E-value=5.5e-29  Score=163.50  Aligned_cols=121  Identities=26%  Similarity=0.529  Sum_probs=108.5

Q ss_pred             CcccCceeeeccCC---CcceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhc
Q psy7353           2 SVRGLNLFRYASVT---EGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGC   78 (139)
Q Consensus         2 s~~~l~~~~~~~~~---~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~   78 (139)
                      +..+|.+|++.|-.   .+-+.|+.|++     .|.+...|+-|+++ |.    -+..|.+||+.|...|.|+.|+++|+
T Consensus       142 T~snLsrHkQ~H~~~~s~ka~~C~~C~K-----~YvSmpALkMHirT-H~----l~c~C~iCGKaFSRPWLLQGHiRTHT  211 (279)
T KOG2462|consen  142 TSSNLSRHKQTHRSLDSKKAFSCKYCGK-----VYVSMPALKMHIRT-HT----LPCECGICGKAFSRPWLLQGHIRTHT  211 (279)
T ss_pred             cccccchhhcccccccccccccCCCCCc-----eeeehHHHhhHhhc-cC----CCcccccccccccchHHhhccccccc
Confidence            34567777776554   56688999999     89999999999887 63    47899999999999999999999999


Q ss_pred             CCCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhccccc
Q psy7353          79 QRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus        79 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      ||+||.|+.|+++|.++++|+.|++| |.+.++|+|..|++.|.....|.+|..+
T Consensus       212 GEKPF~C~hC~kAFADRSNLRAHmQT-HS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  212 GEKPFSCPHCGKAFADRSNLRAHMQT-HSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             CCCCccCCcccchhcchHHHHHHHHh-hcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            99999999999999999999999999 8999999999999999999999999754


No 2  
>KOG2462|consensus
Probab=99.92  E-value=9e-26  Score=148.43  Aligned_cols=114  Identities=27%  Similarity=0.512  Sum_probs=104.8

Q ss_pred             CCcceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCC
Q psy7353          15 TEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSR   94 (139)
Q Consensus        15 ~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   94 (139)
                      ....|.|++||+     .+.+.++|.+|.+.+-..++.+.+.|+.|++.|....+|..|+++|+  .+.+|..||+.|+.
T Consensus       127 ~~~r~~c~eCgk-----~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSR  199 (279)
T KOG2462|consen  127 KHPRYKCPECGK-----SYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSR  199 (279)
T ss_pred             cCCceecccccc-----ccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccc
Confidence            345699999999     99999999999887555556788999999999999999999999997  67899999999999


Q ss_pred             hhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhcccccccC
Q psy7353          95 PDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSVFN  136 (139)
Q Consensus        95 ~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~  136 (139)
                      ++-|+-|+++ |+|||||.|+.|++.|-++.+|+.|+++|-+
T Consensus       200 PWLLQGHiRT-HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  200 PWLLQGHIRT-HTGEKPFSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             hHHhhccccc-ccCCCCccCCcccchhcchHHHHHHHHhhcC
Confidence            9999999999 9999999999999999999999999999864


No 3  
>KOG3576|consensus
Probab=99.77  E-value=9.1e-20  Score=115.51  Aligned_cols=115  Identities=23%  Similarity=0.405  Sum_probs=103.4

Q ss_pred             CCCcceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCC
Q psy7353          14 VTEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFS   93 (139)
Q Consensus        14 ~~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   93 (139)
                      .+...|.|..|+|     .|.-.-.|.+|+.. |..  .+.+.|..||++|.+.-+|++|+++|+|.+||.|..|+++|.
T Consensus       113 sd~d~ftCrvCgK-----~F~lQRmlnrh~kc-h~~--vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaft  184 (267)
T KOG3576|consen  113 SDQDSFTCRVCGK-----KFGLQRMLNRHLKC-HSD--VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFT  184 (267)
T ss_pred             CCCCeeeeehhhh-----hhhHHHHHHHHhhh-ccH--HHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHH
Confidence            3456699999999     89999899999876 655  788999999999999999999999999999999999999999


Q ss_pred             ChhHHHhhhhhhcCC----------CCCCCCCCCCCCCCCCcchhcccccccC
Q psy7353          94 RPDKMKNHMKTVHDC----------FMPATTPQGQRGQRASPVIDFHKDSVFN  136 (139)
Q Consensus        94 ~~~~l~~H~~~~h~~----------~~~~~C~~C~~~f~~~~~l~~H~~~~~~  136 (139)
                      +..+|..|.+.+|..          ++.|.|++||+.-.....+..|++.+|.
T Consensus       185 qrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp  237 (267)
T KOG3576|consen  185 QRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHP  237 (267)
T ss_pred             hhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCC
Confidence            999999999877763          4558999999999999999999998874


No 4  
>KOG3623|consensus
Probab=99.68  E-value=2.2e-17  Score=121.05  Aligned_cols=110  Identities=25%  Similarity=0.468  Sum_probs=98.9

Q ss_pred             ceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhcCC-------------Cccc
Q psy7353          18 IYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQR-------------KVFP   84 (139)
Q Consensus        18 ~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~-------------~~~~   84 (139)
                      ...|++|..     ++.....|+.|+...|... +..|.|..|...|.....|.+|+..|...             +-|+
T Consensus       210 lltcpycdr-----gykrltslkeHikyrhekn-e~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFK  283 (1007)
T KOG3623|consen  210 LLTCPYCDR-----GYKRLTSLKEHIKYRHEKN-EPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFK  283 (1007)
T ss_pred             hhcchhHHH-----HHHHHHHHHHHHHHHHhhC-CCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhcccc
Confidence            367999998     9999999999998877653 45789999999999999999999987532             5699


Q ss_pred             CCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhcccccc
Q psy7353          85 CPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSV  134 (139)
Q Consensus        85 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  134 (139)
                      |.+||++|+.+-.|..|+++ |.|++||.|+.|+++|+..+.+..|+.++
T Consensus       284 CtECgKAFKfKHHLKEHlRI-HSGEKPfeCpnCkKRFSHSGSySSHmSSK  332 (1007)
T KOG3623|consen  284 CTECGKAFKFKHHLKEHLRI-HSGEKPFECPNCKKRFSHSGSYSSHMSSK  332 (1007)
T ss_pred             ccccchhhhhHHHHHhhhee-ecCCCCcCCcccccccccCCccccccccc
Confidence            99999999999999999999 99999999999999999999999998765


No 5  
>KOG3608|consensus
Probab=99.66  E-value=8.6e-18  Score=114.41  Aligned_cols=125  Identities=18%  Similarity=0.309  Sum_probs=97.1

Q ss_pred             CcccCceeeeccCCCcceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhcCCC
Q psy7353           2 SVRGLNLFRYASVTEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRK   81 (139)
Q Consensus         2 s~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~   81 (139)
                      ++..|..|+++|.+++...|+.||.     .|.....|-.|.+..... ...+|.|..|.+.|..+..|..|+..|-  .
T Consensus       191 ~k~~LreH~r~Hs~eKvvACp~Cg~-----~F~~~tkl~DH~rRqt~l-~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n  262 (467)
T KOG3608|consen  191 NKYRLREHIRTHSNEKVVACPHCGE-----LFRTKTKLFDHLRRQTEL-NTNSFQCAQCFKRFATEKLLKSHVVRHV--N  262 (467)
T ss_pred             cHHHHHHHHHhcCCCeEEecchHHH-----HhccccHHHHHHHhhhhh-cCCchHHHHHHHHHhHHHHHHHHHHHhh--h
Confidence            3456788899999999999999998     888888888887642222 2457778888888888888888877764  3


Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhcccccc
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSV  134 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  134 (139)
                      -|.|+.|+-....++.|..|++.-|..++||+|+.|++.|....+|.+|.+.|
T Consensus       263 ~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~H  315 (467)
T KOG3608|consen  263 CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVH  315 (467)
T ss_pred             cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhc
Confidence            57788888888888888888887777788888888888888888888887744


No 6  
>KOG1074|consensus
Probab=99.60  E-value=3.4e-16  Score=116.28  Aligned_cols=84  Identities=23%  Similarity=0.466  Sum_probs=71.1

Q ss_pred             eecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHHhhhhhhcCCC----CCCCCC---CCCCCCCCCcch
Q psy7353          55 FPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCF----MPATTP---QGQRGQRASPVI  127 (139)
Q Consensus        55 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~----~~~~C~---~C~~~f~~~~~l  127 (139)
                      -.|-+|.+.+.-.++|+.|++.|+|++||+|.+||++|..+.+|+.|+.. |...    -++.|+   +|...|+..-.|
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~v-Hka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSV-HKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccc-cccCccccccccCCchhhhcccccccccc
Confidence            44888999999999999999999999999999999999999999999887 4322    348899   899999999999


Q ss_pred             hcccccccCcCC
Q psy7353         128 DFHKDSVFNKDI  139 (139)
Q Consensus       128 ~~H~~~~~~~~~  139 (139)
                      .-|++.|...+|
T Consensus       685 pQhIriH~~~~~  696 (958)
T KOG1074|consen  685 PQHIRIHLGGQI  696 (958)
T ss_pred             cceEEeecCCCC
Confidence            999998886554


No 7  
>KOG3623|consensus
Probab=99.59  E-value=2.8e-16  Score=115.43  Aligned_cols=83  Identities=17%  Similarity=0.400  Sum_probs=74.5

Q ss_pred             CceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhccc
Q psy7353          52 RKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHK  131 (139)
Q Consensus        52 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  131 (139)
                      ...|.|+.|++.|.-.+.|.+|.--|+|.+||+|.+|.++|+.+-.|+.|++. |.|++||+|+.|+++|+..+.+..|+
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRL-HSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRL-HSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhh-ccCCCcchhhhhhhhcccccchHhhh
Confidence            56788999999999999999999999999999999999999999999999998 89999999999999999999998887


Q ss_pred             cccc
Q psy7353         132 DSVF  135 (139)
Q Consensus       132 ~~~~  135 (139)
                      .-.+
T Consensus       971 NHRY  974 (1007)
T KOG3623|consen  971 NHRY  974 (1007)
T ss_pred             ccch
Confidence            6443


No 8  
>KOG1074|consensus
Probab=99.58  E-value=4.5e-16  Score=115.62  Aligned_cols=52  Identities=19%  Similarity=0.244  Sum_probs=48.4

Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhcccccc
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSV  134 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  134 (139)
                      |-+|..|.+..+.++.|+.|.++ |+||+||+|.+|++.|+++.+|+.|+--|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrt-HtGERPFkCKiCgRAFtTkGNLkaH~~vH  656 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRT-HTGERPFKCKICGRAFTTKGNLKAHMSVH  656 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhc-ccCcCccccccccchhccccchhhccccc
Confidence            35699999999999999999999 99999999999999999999999997655


No 9  
>KOG3576|consensus
Probab=99.55  E-value=4e-16  Score=99.14  Aligned_cols=85  Identities=26%  Similarity=0.485  Sum_probs=79.6

Q ss_pred             CceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhccc
Q psy7353          52 RKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHK  131 (139)
Q Consensus        52 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  131 (139)
                      .-.|.|.+|++.|.-..-|.+|++-|...+.+-|..||+.|.+.-+|.+|+++ |+|.+||.|..|++.|+.+..|+.|.
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rt-htgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRT-HTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhcc-ccCccccchhhhhHHHHhhccHHHHH
Confidence            34688999999999999999999999999999999999999999999999999 99999999999999999999999999


Q ss_pred             ccccCc
Q psy7353         132 DSVFNK  137 (139)
Q Consensus       132 ~~~~~~  137 (139)
                      +..|+.
T Consensus       194 ~kvhgv  199 (267)
T KOG3576|consen  194 KKVHGV  199 (267)
T ss_pred             HHHcCc
Confidence            888753


No 10 
>KOG3608|consensus
Probab=99.52  E-value=5.7e-15  Score=100.83  Aligned_cols=110  Identities=21%  Similarity=0.336  Sum_probs=70.3

Q ss_pred             ceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCC--CCccCCCh
Q psy7353          18 IYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPV--CGKEFSRP   95 (139)
Q Consensus        18 ~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~--C~~~f~~~   95 (139)
                      -|.|+.|..     +....+.|..|++..|..  .+||+|..|+..+...+.|..|...|. +..|.|..  |.+++.+.
T Consensus       263 ~ykCplCdm-----tc~~~ssL~~H~r~rHs~--dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~  334 (467)
T KOG3608|consen  263 CYKCPLCDM-----TCSSASSLTTHIRYRHSK--DKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTY  334 (467)
T ss_pred             ccccccccc-----CCCChHHHHHHHHhhhcc--CCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHH
Confidence            456666665     566666666666665655  666666666666666666666666555 45566655  66666666


Q ss_pred             hHHHhhhhhhcCCCC--CCCCCCCCCCCCCCcchhccccccc
Q psy7353          96 DKMKNHMKTVHDCFM--PATTPQGQRGQRASPVIDFHKDSVF  135 (139)
Q Consensus        96 ~~l~~H~~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~~~  135 (139)
                      .++.+|.+.+|.|.+  +|.|-.|++.|++-.+|..|....|
T Consensus       335 ~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH  376 (467)
T KOG3608|consen  335 TQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKH  376 (467)
T ss_pred             HHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhh
Confidence            666666666565543  3677777777777777766655554


No 11 
>PHA00733 hypothetical protein
Probab=99.24  E-value=3.8e-12  Score=77.30  Aligned_cols=82  Identities=18%  Similarity=0.218  Sum_probs=66.4

Q ss_pred             CceeecCCCCCcCCChHHHHHH--H---HHhcCCCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcc
Q psy7353          52 RKVFPCPVCGKEFSRPDKMKNH--M---KTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPV  126 (139)
Q Consensus        52 ~~~~~c~~C~~~~~~~~~l~~h--~---~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~  126 (139)
                      .+++.|.+|...+.....|..+  +   ....+.++|.|..|++.|...+.|..|++. +  +.+|.|+.|++.|.....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~-h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRY-T--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhc-C--CcCccCCCCCCccCCHHH
Confidence            5678888888777766655554  1   133457899999999999999999999987 4  357999999999999999


Q ss_pred             hhcccccccC
Q psy7353         127 IDFHKDSVFN  136 (139)
Q Consensus       127 l~~H~~~~~~  136 (139)
                      |..|+...||
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            9999999886


No 12 
>PHA00733 hypothetical protein
Probab=99.23  E-value=7.5e-12  Score=76.00  Aligned_cols=97  Identities=22%  Similarity=0.417  Sum_probs=75.4

Q ss_pred             CcccCceeeeccCCCcceecCCCCCcchhcccCCHHHHHHHHH----HhccCCCCceeecCCCCCcCCChHHHHHHHHHh
Q psy7353           2 SVRGLNLFRYASVTEGIYKCMECAKVDVIKTFKNKYSFQRHAF----LYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTG   77 (139)
Q Consensus         2 s~~~l~~~~~~~~~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~----~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~   77 (139)
                      |+.+|..........+++.|..|.+     .|.....|..+..    ..+.+  .++|.|+.|++.|.....|..|++.+
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~l~~~~~l~~~~~~~~--~kPy~C~~Cgk~Fss~s~L~~H~r~h   96 (128)
T PHA00733         24 TLEELKRYHSLTPEQKRLIRAVVKT-----LIYNPQLLDESSYLYKLLTSKA--VSPYVCPLCLMPFSSSVSLKQHIRYT   96 (128)
T ss_pred             CHHHhhhhhcCChhhhhHHHHHHhh-----hccChhhhcchHHHHhhcccCC--CCCccCCCCCCcCCCHHHHHHHHhcC
Confidence            4455666655556678899999998     6777666555411    11223  67999999999999999999999875


Q ss_pred             cCCCcccCCCCCccCCChhHHHhhhhhhcC
Q psy7353          78 CQRKVFPCPVCGKEFSRPDKMKNHMKTVHD  107 (139)
Q Consensus        78 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~  107 (139)
                        ..++.|..|++.|.....|..|+...|+
T Consensus        97 --~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         97 --EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             --CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence              4579999999999999999999987665


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.20  E-value=4.8e-11  Score=87.56  Aligned_cols=110  Identities=21%  Similarity=0.467  Sum_probs=88.9

Q ss_pred             ccCCCcceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCcc
Q psy7353          12 ASVTEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKE   91 (139)
Q Consensus        12 ~~~~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   91 (139)
                      ....++.+.|+.|++     .|. ...|..|...+|     +++.|+ |+..+ ....|..|+..+...+++.|..|+..
T Consensus       447 r~el~~H~~C~~Cgk-----~f~-~s~LekH~~~~H-----kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~  513 (567)
T PLN03086        447 VEEAKNHVHCEKCGQ-----AFQ-QGEMEKHMKVFH-----EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDM  513 (567)
T ss_pred             ccccccCccCCCCCC-----ccc-hHHHHHHHHhcC-----CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCc
Confidence            334566789999998     785 577999988744     468899 99754 66899999999999999999999998


Q ss_pred             CCC----------hhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhcccccccCc
Q psy7353          92 FSR----------PDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSVFNK  137 (139)
Q Consensus        92 f~~----------~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~  137 (139)
                      +..          ...|..|...  .|.+++.|..|++.+..+ +|..|....|.+
T Consensus       514 v~~g~~~~d~~d~~s~Lt~HE~~--CG~rt~~C~~Cgk~Vrlr-dm~~H~~~~h~~  566 (567)
T PLN03086        514 VQAGGSAMDVRDRLRGMSEHESI--CGSRTAPCDSCGRSVMLK-EMDIHQIAVHQK  566 (567)
T ss_pred             cccCccccchhhhhhhHHHHHHh--cCCcceEccccCCeeeeh-hHHHHHHHhhcC
Confidence            852          3589999987  378999999999998887 466888777643


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.08  E-value=9.1e-11  Score=59.88  Aligned_cols=44  Identities=18%  Similarity=0.426  Sum_probs=35.0

Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchh
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVID  128 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~  128 (139)
                      -|.|+.||+.|...++|..|+++ |.  ++|.|..|++.|...+.|-
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~-H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRK-HN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHh-cC--CcccCCcccceecccceeE
Confidence            36788888888888888888888 44  5788888888888777764


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.88  E-value=9.4e-10  Score=56.19  Aligned_cols=44  Identities=18%  Similarity=0.472  Sum_probs=36.0

Q ss_pred             eeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHH
Q psy7353          54 VFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMK   99 (139)
Q Consensus        54 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~   99 (139)
                      .|.|+.||+.|...++|..|++.|+  +++.|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4788888888888888888888887  6788888888888776654


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.76  E-value=2.1e-09  Score=47.14  Aligned_cols=24  Identities=25%  Similarity=0.393  Sum_probs=14.2

Q ss_pred             HHhhhhhhcCCCCCCCCCCCCCCCC
Q psy7353          98 MKNHMKTVHDCFMPATTPQGQRGQR  122 (139)
Q Consensus        98 l~~H~~~~h~~~~~~~C~~C~~~f~  122 (139)
                      |.+|+++ |.+++||.|+.|++.|.
T Consensus         2 l~~H~~~-H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRT-HTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHH-HSSSSSEEESSSSEEES
T ss_pred             HHHHhhh-cCCCCCCCCCCCcCeeC
Confidence            5556665 55666666666666554


No 17 
>PHA00732 hypothetical protein
Probab=98.69  E-value=2e-08  Score=55.86  Aligned_cols=37  Identities=27%  Similarity=0.539  Sum_probs=17.6

Q ss_pred             ccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCC
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQR  122 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~  122 (139)
                      |.|..|++.|.....|..|++.+|.   ++.|+.|++.|.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~   38 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC
Confidence            4455555555555555555542232   234555555554


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.67  E-value=9.1e-08  Score=70.73  Aligned_cols=103  Identities=20%  Similarity=0.348  Sum_probs=76.1

Q ss_pred             eecCCCCCcchhcccCCHHHHHHHHHHhccC----------------CCCceeecCCCCCcCCChHHHHHHHHHhcCCCc
Q psy7353          19 YKCMECAKVDVIKTFKNKYSFQRHAFLYHEG----------------CQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKV   82 (139)
Q Consensus        19 ~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~----------------~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~   82 (139)
                      -.|+-|.+      ......|..|...+.-.                .....+.|+.|++.|. ...|..|+..++  .+
T Consensus       408 V~C~NC~~------~i~l~~l~lHe~~C~r~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kp  478 (567)
T PLN03086        408 VECRNCKH------YIPSRSIALHEAYCSRHNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EP  478 (567)
T ss_pred             EECCCCCC------ccchhHHHHHHhhCCCcceeCCcccccceeeccccccCccCCCCCCccc-hHHHHHHHHhcC--CC
Confidence            46888886      44445666776432111                0135678999999885 677999999875  78


Q ss_pred             ccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCC----------Ccchhccccc
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRA----------SPVIDFHKDS  133 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~----------~~~l~~H~~~  133 (139)
                      +.|+ |+..+ ....|..|+.+ |...+++.|+.|+..|..          ...|..|...
T Consensus       479 v~Cp-Cg~~~-~R~~L~~H~~t-hCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~  536 (567)
T PLN03086        479 LQCP-CGVVL-EKEQMVQHQAS-TCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESI  536 (567)
T ss_pred             ccCC-CCCCc-chhHHHhhhhc-cCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHh
Confidence            9999 99755 67899999987 788899999999999852          2367777654


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.62  E-value=3.1e-08  Score=43.37  Aligned_cols=25  Identities=44%  Similarity=0.988  Sum_probs=20.9

Q ss_pred             HHHHHHHHhcCCCcccCCCCCccCC
Q psy7353          69 KMKNHMKTGCQRKVFPCPVCGKEFS   93 (139)
Q Consensus        69 ~l~~h~~~~~~~~~~~C~~C~~~f~   93 (139)
                      +|..|++.|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            4678888888899999999988875


No 20 
>KOG3993|consensus
Probab=98.57  E-value=2.8e-09  Score=74.85  Aligned_cols=85  Identities=15%  Similarity=0.249  Sum_probs=64.0

Q ss_pred             eeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHHhhhhhhcC-------CC-----------------
Q psy7353          54 VFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHD-------CF-----------------  109 (139)
Q Consensus        54 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~-------~~-----------------  109 (139)
                      .|.|..|...|.+.-.|..|...-..-.-|.|++|+++|..+.+|..|.+=|-+       +.                 
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            467888887888888887777655555567888888888888888888764211       11                 


Q ss_pred             --------CCCCCCCCCCCCCCCcchhcccccccCcC
Q psy7353         110 --------MPATTPQGQRGQRASPVIDFHKDSVFNKD  138 (139)
Q Consensus       110 --------~~~~C~~C~~~f~~~~~l~~H~~~~~~~~  138 (139)
                              -.|.|..|++.|.....|++|..+|+..+
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                    13889999999999999999999888654


No 21 
>PHA00616 hypothetical protein
Probab=98.40  E-value=1.1e-07  Score=46.38  Aligned_cols=35  Identities=17%  Similarity=0.287  Sum_probs=24.7

Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCC
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQG  117 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C  117 (139)
                      ||+|+.||..|...++|..|++. |.+++++.|+.-
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~-~hg~~~~~~~~~   35 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLS-VHKQNKLTLEYF   35 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHH-hcCCCccceeEE
Confidence            56777777777777777777776 556677766543


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.39  E-value=2.8e-07  Score=47.64  Aligned_cols=51  Identities=22%  Similarity=0.286  Sum_probs=34.5

Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCC-CCCCCCCCCCCCCCCcchhccccccc
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCF-MPATTPQGQRGQRASPVIDFHKDSVF  135 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~-~~~~C~~C~~~f~~~~~l~~H~~~~~  135 (139)
                      .|.|+.|++ ..+...|..|....|..+ +.+.||.|...++  .+|..|+...|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            367777877 344567778877666654 5677888887644  36777777665


No 23 
>PHA00616 hypothetical protein
Probab=98.10  E-value=1.5e-06  Score=42.41  Aligned_cols=31  Identities=16%  Similarity=0.471  Sum_probs=16.8

Q ss_pred             eecCCCCCcCCChHHHHHHHHHhcCCCcccC
Q psy7353          55 FPCPVCGKEFSRPDKMKNHMKTGCQRKVFPC   85 (139)
Q Consensus        55 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C   85 (139)
                      |.|+.||..|...+.|..|++.++++.++.|
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            4555555555555555555555555555444


No 24 
>PHA00732 hypothetical protein
Probab=98.09  E-value=3.5e-06  Score=46.86  Aligned_cols=37  Identities=32%  Similarity=0.672  Sum_probs=17.9

Q ss_pred             eecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCC
Q psy7353          19 YKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFS   65 (139)
Q Consensus        19 ~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~   65 (139)
                      |.|..|++     .|.+...|+.|++..|.+     +.|+.|++.|.
T Consensus         2 y~C~~Cgk-----~F~s~s~Lk~H~r~~H~~-----~~C~~CgKsF~   38 (79)
T PHA00732          2 FKCPICGF-----TTVTLFALKQHARRNHTL-----TKCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCC-----ccCCHHHHHHHhhcccCC-----CccCCCCCEeC
Confidence            45555555     555555555554322321     24555555544


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.05  E-value=1.4e-05  Score=41.20  Aligned_cols=48  Identities=25%  Similarity=0.534  Sum_probs=22.4

Q ss_pred             eecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHH
Q psy7353          19 YKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMK   75 (139)
Q Consensus        19 ~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~   75 (139)
                      |.||.|++     . .+...|..|....|... .+.+.||+|...+.  ..|..|+.
T Consensus         3 f~CP~C~~-----~-~~~~~L~~H~~~~H~~~-~~~v~CPiC~~~~~--~~l~~Hl~   50 (54)
T PF05605_consen    3 FTCPYCGK-----G-FSESSLVEHCEDEHRSE-SKNVVCPICSSRVT--DNLIRHLN   50 (54)
T ss_pred             cCCCCCCC-----c-cCHHHHHHHHHhHCcCC-CCCccCCCchhhhh--hHHHHHHH
Confidence            45566665     3 22345555555544442 23455555554322  24444444


No 26 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.97  E-value=4e-06  Score=57.48  Aligned_cols=56  Identities=21%  Similarity=0.420  Sum_probs=38.8

Q ss_pred             CCcccCCC--CCccCCChhHHHhhhhhhc------------------CCCCCCCCCCCCCCCCCCcchhccccccc
Q psy7353          80 RKVFPCPV--CGKEFSRPDKMKNHMKTVH------------------DCFMPATTPQGQRGQRASPVIDFHKDSVF  135 (139)
Q Consensus        80 ~~~~~C~~--C~~~f~~~~~l~~H~~~~h------------------~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  135 (139)
                      ++||.|++  |.+.|+..--|.-|+.-.|                  ..++||.|+.|++++...+-|+-|+.-.|
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~Hsh  422 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKHSH  422 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccccC
Confidence            35555544  5555555555555544222                  24589999999999999999999987654


No 27 
>KOG3993|consensus
Probab=97.95  E-value=4.1e-06  Score=59.39  Aligned_cols=27  Identities=15%  Similarity=0.003  Sum_probs=22.2

Q ss_pred             CCCCCCCCCCCCCCcchhcccccccCc
Q psy7353         111 PATTPQGQRGQRASPVIDFHKDSVFNK  137 (139)
Q Consensus       111 ~~~C~~C~~~f~~~~~l~~H~~~~~~~  137 (139)
                      -|.|..|...|.+...|.+|+..-|..
T Consensus       458 ~f~~ky~~atfyss~~ltrhin~~Hps  484 (500)
T KOG3993|consen  458 GFTCKYCPATFYSSPGLTRHINKCHPS  484 (500)
T ss_pred             ccccccchHhhhcCcchHhHhhhcChH
Confidence            367888999999999999998877743


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.79  E-value=1.9e-06  Score=37.94  Aligned_cols=22  Identities=36%  Similarity=0.887  Sum_probs=12.2

Q ss_pred             ccCCCCCccCCChhHHHhhhhh
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      |.|..|+..|.....|..|++.
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~   23 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRS   23 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCT
T ss_pred             CCCCccCCccCChhHHHHHhHH
Confidence            4555555555555555555554


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.76  E-value=1.3e-05  Score=33.73  Aligned_cols=22  Identities=45%  Similarity=1.165  Sum_probs=11.7

Q ss_pred             ccCCCCCccCCChhHHHhhhhh
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3455555555555555555543


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.76  E-value=2e-06  Score=36.49  Aligned_cols=23  Identities=43%  Similarity=1.128  Sum_probs=12.7

Q ss_pred             ccCCCCCccCCChhHHHhhhhhh
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKTV  105 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~  105 (139)
                      |.|+.|+..|.....|..|+.++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45666666666666666666553


No 31 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.70  E-value=2.5e-05  Score=32.97  Aligned_cols=22  Identities=14%  Similarity=0.166  Sum_probs=10.7

Q ss_pred             CCCCCCCCCCCCcchhcccccc
Q psy7353         113 TTPQGQRGQRASPVIDFHKDSV  134 (139)
Q Consensus       113 ~C~~C~~~f~~~~~l~~H~~~~  134 (139)
                      .|+.|++.|.+...|..|+..+
T Consensus         2 ~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    2 QCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             E-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCcCCCCcCCcHHHHHHHHHhh
Confidence            4555555555555555555444


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.64  E-value=2.9e-05  Score=34.03  Aligned_cols=25  Identities=16%  Similarity=0.108  Sum_probs=15.6

Q ss_pred             CCCCCCCCCCCCCCcchhccccccc
Q psy7353         111 PATTPQGQRGQRASPVIDFHKDSVF  135 (139)
Q Consensus       111 ~~~C~~C~~~f~~~~~l~~H~~~~~  135 (139)
                      ||.|+.|+..|.+...|..|++.|+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            3566666666666666666666554


No 33 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.54  E-value=8.5e-05  Score=31.13  Aligned_cols=22  Identities=41%  Similarity=0.794  Sum_probs=14.1

Q ss_pred             eecCCCCCcchhcccCCHHHHHHHHHH
Q psy7353          19 YKCMECAKVDVIKTFKNKYSFQRHAFL   45 (139)
Q Consensus        19 ~~C~~c~~~~~~~~f~~~~~l~~h~~~   45 (139)
                      |.|+.|++     .|.+...|+.|++.
T Consensus         1 y~C~~C~~-----~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGK-----SFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTE-----EESSHHHHHHHHHH
T ss_pred             CCCCCCCC-----ccCCHHHHHHHHhH
Confidence            45666666     66666666666643


No 34 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.53  E-value=1.3e-05  Score=46.47  Aligned_cols=73  Identities=21%  Similarity=0.303  Sum_probs=18.2

Q ss_pred             ecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhcccccc
Q psy7353          56 PCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSV  134 (139)
Q Consensus        56 ~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  134 (139)
                      .|..|+..|.....+..|+...++-..-    ....+.....+..+++.  .....+.|..|+..|.+...|..|++++
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~--~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRK--KVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc----ccccccccccccccccc--ccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            3888999999999999998755542211    01112233333333332  1122577888888888888888887764


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.34  E-value=0.00017  Score=41.70  Aligned_cols=74  Identities=23%  Similarity=0.515  Sum_probs=22.0

Q ss_pred             ecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHH
Q psy7353          20 KCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMK   99 (139)
Q Consensus        20 ~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~   99 (139)
                      .|..|+.     .|.+...+..|+...|.-  ..+     ....+.....+....... ....+.|..|+..|.....|.
T Consensus         1 ~C~~C~~-----~f~~~~~l~~H~~~~H~~--~~~-----~~~~l~~~~~~~~~~~~~-~~~~~~C~~C~~~f~s~~~l~   67 (100)
T PF12756_consen    1 QCLFCDE-----SFSSVDDLLQHMKKKHGF--DIP-----DQKYLVDPNRLLNYLRKK-VKESFRCPYCNKTFRSREALQ   67 (100)
T ss_dssp             -------------------------------------------------------------SSEEBSSSS-EESSHHHHH
T ss_pred             Ccccccc-----cccccccccccccccccc--ccc-----cccccccccccccccccc-cCCCCCCCccCCCCcCHHHHH
Confidence            4888998     899999999999776653  111     111122333333333322 223689999999999999999


Q ss_pred             hhhhhhc
Q psy7353         100 NHMKTVH  106 (139)
Q Consensus       100 ~H~~~~h  106 (139)
                      .|++.++
T Consensus        68 ~Hm~~~~   74 (100)
T PF12756_consen   68 EHMRSKH   74 (100)
T ss_dssp             HHHHHTT
T ss_pred             HHHcCcc
Confidence            9999743


No 36 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.18  E-value=0.00011  Score=32.18  Aligned_cols=22  Identities=9%  Similarity=-0.056  Sum_probs=14.2

Q ss_pred             CCCCCCCCCCCCCcchhccccc
Q psy7353         112 ATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566666666666666666654


No 37 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.12  E-value=0.00013  Score=50.22  Aligned_cols=71  Identities=27%  Similarity=0.514  Sum_probs=44.3

Q ss_pred             CcceecCC--CCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCC
Q psy7353          16 EGIYKCME--CAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFS   93 (139)
Q Consensus        16 ~~~~~C~~--c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~   93 (139)
                      ++||.|+.  |.|     .|+....|+-|+..-|..  .+...-+          +-..+.......+||.|++|++.|+
T Consensus       347 ~KpykCpV~gC~K-----~YknqnGLKYH~lhGH~~--~~~~~~p----------~p~~~~~F~~~~KPYrCevC~KRYK  409 (423)
T COG5189         347 GKPYKCPVEGCNK-----KYKNQNGLKYHMLHGHQN--QKLHENP----------SPEKMNIFSAKDKPYRCEVCDKRYK  409 (423)
T ss_pred             CceecCCCCCchh-----hhccccchhhhhhccccC--cccCCCC----------CccccccccccCCceeccccchhhc
Confidence            58899876  666     888888898886432322  1111111          0011122244568999999999888


Q ss_pred             ChhHHHhhhh
Q psy7353          94 RPDKMKNHMK  103 (139)
Q Consensus        94 ~~~~l~~H~~  103 (139)
                      ..--|.-|+.
T Consensus       410 NlNGLKYHr~  419 (423)
T COG5189         410 NLNGLKYHRK  419 (423)
T ss_pred             cCccceeccc
Confidence            8888877765


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=97.06  E-value=0.00028  Score=44.58  Aligned_cols=40  Identities=8%  Similarity=0.057  Sum_probs=33.5

Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcc
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPV  126 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~  126 (139)
                      +|.|. |+.   ....+.+|.++ +.++++|.|..|+..|....+
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri-~~g~~~YrC~~C~~~l~~~~~  158 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRV-VRGEAVYRCRRCGETLVFKGE  158 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHH-hcCCccEECCCCCceeEEecc
Confidence            68897 986   67788899998 899999999999998876543


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.97  E-value=0.00017  Score=30.75  Aligned_cols=21  Identities=10%  Similarity=0.134  Sum_probs=12.3

Q ss_pred             CCCCCCCCCCCCCcchhcccc
Q psy7353         112 ATTPQGQRGQRASPVIDFHKD  132 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~H~~  132 (139)
                      |.|+.|++.|.....|..|++
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH
Confidence            345566666666666666655


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.83  E-value=8.1e-05  Score=31.90  Aligned_cols=20  Identities=30%  Similarity=0.909  Sum_probs=9.9

Q ss_pred             cCCCCCccCCChhHHHhhhh
Q psy7353          84 PCPVCGKEFSRPDKMKNHMK  103 (139)
Q Consensus        84 ~C~~C~~~f~~~~~l~~H~~  103 (139)
                      .|..|+..|.....|..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            34455555555555555443


No 41 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.77  E-value=0.00083  Score=28.38  Aligned_cols=23  Identities=35%  Similarity=0.788  Sum_probs=11.7

Q ss_pred             ccCCCCCccCCChhHHHhhhhhhc
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKTVH  106 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~h  106 (139)
                      |.|+.|++... ...|.+|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            34556665555 556666665543


No 42 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.68  E-value=0.0017  Score=27.41  Aligned_cols=22  Identities=45%  Similarity=1.053  Sum_probs=15.1

Q ss_pred             ccCCCCCccCCChhHHHhhhhh
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      |.|..|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHH
Confidence            3566777777777777777664


No 43 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.67  E-value=0.0032  Score=31.58  Aligned_cols=30  Identities=20%  Similarity=0.615  Sum_probs=14.6

Q ss_pred             CceeecCCCCCcCCChHHHHHHHHHhcCCC
Q psy7353          52 RKVFPCPVCGKEFSRPDKMKNHMKTGCQRK   81 (139)
Q Consensus        52 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~   81 (139)
                      +.|..|++|+..+.+..+|.+|+...++.+
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            445566666666666666666665555444


No 44 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.65  E-value=0.00016  Score=36.19  Aligned_cols=25  Identities=20%  Similarity=0.724  Sum_probs=11.1

Q ss_pred             CCcccCCCCCccCCChhHHHhhhhh
Q psy7353          80 RKVFPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      +.|-.|++|+..+.+..+|.+|+.+
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~   46 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEI   46 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHH
T ss_pred             CCCCCCCcchhhccchhhHHHHHHH
Confidence            3455555555555555555555544


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.50  E-value=0.0022  Score=27.92  Aligned_cols=22  Identities=45%  Similarity=0.920  Sum_probs=18.9

Q ss_pred             ccCCCCCccCCChhHHHhhhhh
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6788999999999999988875


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.45  E-value=0.00022  Score=30.24  Aligned_cols=24  Identities=8%  Similarity=0.036  Sum_probs=19.3

Q ss_pred             CCCCCCCCCCCCCcchhcccccccC
Q psy7353         112 ATTPQGQRGQRASPVIDFHKDSVFN  136 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~H~~~~~~  136 (139)
                      |.|+.|++... ...|.+|.+.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999999998 8899999998874


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=96.20  E-value=0.0054  Score=38.85  Aligned_cols=39  Identities=18%  Similarity=0.474  Sum_probs=33.1

Q ss_pred             ceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCCh
Q psy7353          53 KVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRP   95 (139)
Q Consensus        53 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   95 (139)
                      -+|.|. |+.   ....+..|.++++++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            468998 986   667788999999999999999999887654


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.03  E-value=0.0036  Score=26.56  Aligned_cols=22  Identities=9%  Similarity=-0.046  Sum_probs=13.2

Q ss_pred             CCCCCCCCCCCCCcchhccccc
Q psy7353         112 ATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      |.|+.|++.|.+...|..|.++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3466666666666666666554


No 49 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.19  E-value=0.016  Score=26.49  Aligned_cols=10  Identities=20%  Similarity=0.179  Sum_probs=6.8

Q ss_pred             CCCCCCCCCC
Q psy7353         110 MPATTPQGQR  119 (139)
Q Consensus       110 ~~~~C~~C~~  119 (139)
                      .++.|+.|+.
T Consensus        16 ~~~~CP~Cg~   25 (33)
T cd00350          16 APWVCPVCGA   25 (33)
T ss_pred             CCCcCcCCCC
Confidence            4677777765


No 50 
>KOG2231|consensus
Probab=95.10  E-value=0.043  Score=42.15  Aligned_cols=97  Identities=15%  Similarity=0.223  Sum_probs=62.5

Q ss_pred             ccCCHHHHHHHHHHhccCCCCceeecCCCC---------CcCCChHHHHHHHHHhcC-CC----cccCCCCCccCCChhH
Q psy7353          32 TFKNKYSFQRHAFLYHEGCQRKVFPCPVCG---------KEFSRPDKMKNHMKTGCQ-RK----VFPCPVCGKEFSRPDK   97 (139)
Q Consensus        32 ~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~---------~~~~~~~~l~~h~~~~~~-~~----~~~C~~C~~~f~~~~~   97 (139)
                      .|.+...|+.|+...|..     +.|..|.         ........|..|+..... +.    .-.|..|...|.....
T Consensus       123 ~~~s~~~Lk~H~~~~H~~-----~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~e  197 (669)
T KOG2231|consen  123 EFKSVENLKNHMRDQHKL-----HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDE  197 (669)
T ss_pred             chhHHHHHHHHHHHhhhh-----hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHH
Confidence            455778899998766653     3344432         223445566777664332 21    2468889889999999


Q ss_pred             HHhhhhhhcCCCCCCCC---CCCCCCCCCCcchhccccccc
Q psy7353          98 MKNHMKTVHDCFMPATT---PQGQRGQRASPVIDFHKDSVF  135 (139)
Q Consensus        98 l~~H~~~~h~~~~~~~C---~~C~~~f~~~~~l~~H~~~~~  135 (139)
                      |.+|++..|..  -..|   +.+..-|....+|..|.+..|
T Consensus       198 l~rH~~~~h~~--chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  198 LYRHLRFDHEF--CHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             HHHhhccceeh--eeecCcccccchhcccchHHHHHhhhcC
Confidence            99999875542  1234   234567788888888877766


No 51 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.99  E-value=0.0056  Score=28.21  Aligned_cols=23  Identities=4%  Similarity=-0.158  Sum_probs=13.5

Q ss_pred             CCCCCCCCCCCCCCcchhccccc
Q psy7353         111 PATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus       111 ~~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      +|.|+.|+..|.+...+..|+++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            35566666666666666666543


No 52 
>KOG2893|consensus
Probab=94.60  E-value=0.013  Score=39.24  Aligned_cols=35  Identities=34%  Similarity=0.743  Sum_probs=20.6

Q ss_pred             CceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCcc
Q psy7353          52 RKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKE   91 (139)
Q Consensus        52 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~   91 (139)
                      .++| |..|++.|.++.-|+.|++    .+.|+|-.|.+.
T Consensus         9 ~kpw-cwycnrefddekiliqhqk----akhfkchichkk   43 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQK----AKHFKCHICHKK   43 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhh----hccceeeeehhh
Confidence            3454 5566666666666666654    345666666543


No 53 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.37  E-value=0.036  Score=23.63  Aligned_cols=19  Identities=53%  Similarity=1.508  Sum_probs=10.1

Q ss_pred             cCCCCCccCCChhHHHhhhh
Q psy7353          84 PCPVCGKEFSRPDKMKNHMK  103 (139)
Q Consensus        84 ~C~~C~~~f~~~~~l~~H~~  103 (139)
                      +|+.||+.| ....|.+|++
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            455566555 4444555544


No 54 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.80  E-value=0.043  Score=39.56  Aligned_cols=55  Identities=16%  Similarity=0.202  Sum_probs=44.0

Q ss_pred             cccCCCCCccCCChhHHHhhhhh-hcCCC--CCCCCC--CCCCCCCCCcchhcccccccC
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKT-VHDCF--MPATTP--QGQRGQRASPVIDFHKDSVFN  136 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~-~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~  136 (139)
                      ++.|..|...|.....|..|.+. .|.++  +++.|+  .|++.|.....+..|...+.+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  348 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTS  348 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccC
Confidence            57778888888888888888883 37777  888888  688888888888888777664


No 55 
>KOG1146|consensus
Probab=93.79  E-value=0.013  Score=47.74  Aligned_cols=25  Identities=12%  Similarity=0.048  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCCCCCCCcchhccccc
Q psy7353         109 FMPATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus       109 ~~~~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      -.+|.|..|.+.++...+|..|.++
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHH
Confidence            3578999999999999999999765


No 56 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=93.07  E-value=0.035  Score=36.93  Aligned_cols=13  Identities=8%  Similarity=-0.069  Sum_probs=10.0

Q ss_pred             CCCCCCCCCCCCC
Q psy7353         112 ATTPQGQRGQRAS  124 (139)
Q Consensus       112 ~~C~~C~~~f~~~  124 (139)
                      +.||.||+.|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5799999877654


No 57 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=92.73  E-value=0.047  Score=38.60  Aligned_cols=16  Identities=6%  Similarity=-0.255  Sum_probs=8.3

Q ss_pred             CCCCCcchhccccccc
Q psy7353         120 GQRASPVIDFHKDSVF  135 (139)
Q Consensus       120 ~f~~~~~l~~H~~~~~  135 (139)
                      .|.+...|..|+...|
T Consensus       290 vf~~~~el~~h~~~~h  305 (493)
T COG5236         290 VFPYHTELLEHLTRFH  305 (493)
T ss_pred             EeccHHHHHHHHHHHh
Confidence            4555555555554444


No 58 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=92.71  E-value=0.092  Score=33.45  Aligned_cols=25  Identities=40%  Similarity=0.775  Sum_probs=19.7

Q ss_pred             CcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCC
Q psy7353          81 KVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQR  119 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~  119 (139)
                      +.|.|++||..              +.|+.|..||.|+.
T Consensus       133 ~~~vC~vCGy~--------------~~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYT--------------HEGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCc--------------ccCCCCCcCCCCCC
Confidence            46999999864              45578899999984


No 59 
>KOG2893|consensus
Probab=92.68  E-value=0.048  Score=36.55  Aligned_cols=43  Identities=21%  Similarity=0.491  Sum_probs=25.2

Q ss_pred             cceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHH
Q psy7353          17 GIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKN   72 (139)
Q Consensus        17 ~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~   72 (139)
                      ++| |.+|+.     .|-+..-|.+|+..       +.|+|-+|.+.+.....|..
T Consensus        10 kpw-cwycnr-----efddekiliqhqka-------khfkchichkkl~sgpglsi   52 (341)
T KOG2893|consen   10 KPW-CWYCNR-----EFDDEKILIQHQKA-------KHFKCHICHKKLFSGPGLSI   52 (341)
T ss_pred             Cce-eeeccc-----ccchhhhhhhhhhh-------ccceeeeehhhhccCCCcee
Confidence            444 666776     77777766666532       44677777665444444433


No 60 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=92.37  E-value=0.089  Score=35.73  Aligned_cols=82  Identities=21%  Similarity=0.408  Sum_probs=49.1

Q ss_pred             CCcceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHH-------HHHH----HhcCCCcc
Q psy7353          15 TEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMK-------NHMK----TGCQRKVF   83 (139)
Q Consensus        15 ~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~-------~h~~----~~~~~~~~   83 (139)
                      +.+.|.|..|..      |...-.--.|+.+....+ ...|+|.-|++.-.. +-|.       .|.+    .....+++
T Consensus       139 GGrif~CsfC~~------flCEDDQFEHQAsCQvLe-~E~~KC~SCNrlGq~-sCLRCK~cfCddHvrrKg~ky~k~k~~  210 (314)
T PF06524_consen  139 GGRIFKCSFCDN------FLCEDDQFEHQASCQVLE-SETFKCQSCNRLGQY-SCLRCKICFCDDHVRRKGFKYEKGKPI  210 (314)
T ss_pred             CCeEEEeecCCC------eeeccchhhhhhhhhhhh-cccccccccccccch-hhhheeeeehhhhhhhcccccccCCCC
Confidence            677899999996      665544444544433322 345777777653221 1111       2222    12234688


Q ss_pred             cCCCCCccCCChhHHHhhhhh
Q psy7353          84 PCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        84 ~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      +|+.|+........|..-.++
T Consensus       211 PCPKCg~et~eTkdLSmStR~  231 (314)
T PF06524_consen  211 PCPKCGYETQETKDLSMSTRS  231 (314)
T ss_pred             CCCCCCCcccccccceeeeec
Confidence            999999888887777777666


No 61 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=91.80  E-value=0.13  Score=26.70  Aligned_cols=8  Identities=25%  Similarity=0.451  Sum_probs=4.3

Q ss_pred             CCCCCCCC
Q psy7353         111 PATTPQGQ  118 (139)
Q Consensus       111 ~~~C~~C~  118 (139)
                      +|.|+.||
T Consensus        50 ~Y~Cp~CG   57 (61)
T COG2888          50 PYRCPKCG   57 (61)
T ss_pred             ceECCCcC
Confidence            45555554


No 62 
>KOG1146|consensus
Probab=91.06  E-value=0.076  Score=43.66  Aligned_cols=56  Identities=11%  Similarity=0.153  Sum_probs=42.9

Q ss_pred             CCcccCCCCCccCCChhHHHhhhhhhcC------------------------------------C-----C-CCCCCCCC
Q psy7353          80 RKVFPCPVCGKEFSRPDKMKNHMKTVHD------------------------------------C-----F-MPATTPQG  117 (139)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~------------------------------------~-----~-~~~~C~~C  117 (139)
                      .++|.|..|...++...+|..|++....                                    +     . -.|.|..|
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS~~h~~~lee~~~~~g~~v~~~~~~v~s~~P~~ag~~~~ags~~pktkP~~~C~vc  595 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQSDLHRNELEEAEENAGEQVRLLPASVTSAVPEEAGLGPSAGSSGPKTKPSWRCEVC  595 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHHHhhHHHHHHHHhccccchhhhhhhhcccCcccccCCCCCCCCCCCCCCCcchhhh
Confidence            4689999999999999999999764210                                    1     1 13899999


Q ss_pred             CCCCCCCcchhccccccc
Q psy7353         118 QRGQRASPVIDFHKDSVF  135 (139)
Q Consensus       118 ~~~f~~~~~l~~H~~~~~  135 (139)
                      ++.-+-..+|.-|+.+-+
T Consensus       596 ~yetniarnlrihmtss~  613 (1406)
T KOG1146|consen  596 SYETNIARNLRIHMTASP  613 (1406)
T ss_pred             cchhhhhhccccccccCC
Confidence            999888888988876543


No 63 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=90.76  E-value=0.25  Score=22.70  Aligned_cols=25  Identities=32%  Similarity=0.591  Sum_probs=14.4

Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCC
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQR  119 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~  119 (139)
                      .|.|..||..+...             +.|..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~-------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE-------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC-------------cCCCcCcCCCC
Confidence            36677777543211             23567777775


No 64 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.27  E-value=0.18  Score=36.38  Aligned_cols=60  Identities=35%  Similarity=0.704  Sum_probs=44.4

Q ss_pred             eeecCCCCCcCCChHHHHHHHH--HhcCC--CcccCC--CCCccCCChhHHHhhhhhhcCCCCCCCC
Q psy7353          54 VFPCPVCGKEFSRPDKMKNHMK--TGCQR--KVFPCP--VCGKEFSRPDKMKNHMKTVHDCFMPATT  114 (139)
Q Consensus        54 ~~~c~~C~~~~~~~~~l~~h~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~h~~~~~~~C  114 (139)
                      ++.|..|...+.....+..|..  .|.++  +++.|+  .|++.|.+...+..|..+ |.+..+..+
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~  354 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILL-HTSISPAKE  354 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCccc-ccCCCcccc
Confidence            5667777777888888888877  67777  788887  688888888888888776 555555444


No 65 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=89.17  E-value=0.051  Score=27.79  Aligned_cols=29  Identities=28%  Similarity=0.629  Sum_probs=19.2

Q ss_pred             cCCCcccCCCCCccCCChhHHHhhhhhhc
Q psy7353          78 CQRKVFPCPVCGKEFSRPDKMKNHMKTVH  106 (139)
Q Consensus        78 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h  106 (139)
                      .|+..+.|+.|+..|.+.-+..+|...-|
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            45556677777777777777777766534


No 66 
>PHA00626 hypothetical protein
Probab=88.75  E-value=0.15  Score=26.09  Aligned_cols=14  Identities=0%  Similarity=-0.299  Sum_probs=7.9

Q ss_pred             CCCCCCCCCCCCCC
Q psy7353         110 MPATTPQGQRGQRA  123 (139)
Q Consensus       110 ~~~~C~~C~~~f~~  123 (139)
                      ..|.|+.|++.|+.
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            34666666665554


No 67 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.55  E-value=0.38  Score=24.65  Aligned_cols=31  Identities=23%  Similarity=0.493  Sum_probs=22.5

Q ss_pred             ccCCCcceecCCCCCcchhcccCCHHHHHHHHHHhc
Q psy7353          12 ASVTEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYH   47 (139)
Q Consensus        12 ~~~~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~   47 (139)
                      .-+++..+.|+-|+.     .|.....+.+|....|
T Consensus        11 ~RDGE~~lrCPRC~~-----~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          11 DRDGEEFLRCPRCGM-----VFRRRKDYIRHVNKAH   41 (65)
T ss_pred             ccCCceeeeCCchhH-----HHHHhHHHHHHhhHHh
Confidence            456677788888888     7888777777765434


No 68 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.54  E-value=0.38  Score=25.03  Aligned_cols=10  Identities=30%  Similarity=0.272  Sum_probs=5.5

Q ss_pred             CCCCCCCCCC
Q psy7353         110 MPATTPQGQR  119 (139)
Q Consensus       110 ~~~~C~~C~~  119 (139)
                      .+|.|+.||.
T Consensus        47 ~~Y~CP~CGF   56 (59)
T PRK14890         47 NPYTCPKCGF   56 (59)
T ss_pred             CceECCCCCC
Confidence            3556666653


No 69 
>KOG2482|consensus
Probab=87.13  E-value=0.73  Score=32.78  Aligned_cols=51  Identities=20%  Similarity=0.265  Sum_probs=40.0

Q ss_pred             ccCCCCCccCCChhHHHhhhhhhcCCC----------C----------------CCCCCCCCCCCCCCcchhccccc
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKTVHDCF----------M----------------PATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~h~~~----------~----------------~~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      ..|..|......+..|..|+++.|.-+          +                .-.|..|+..|-....|..|+..
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            478889888888999999998876511          0                12588999999999999999654


No 70 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=86.77  E-value=0.21  Score=31.48  Aligned_cols=15  Identities=0%  Similarity=-0.274  Sum_probs=8.9

Q ss_pred             CCCCCCCCCCCCCcc
Q psy7353         112 ATTPQGQRGQRASPV  126 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~  126 (139)
                      ++|+.|+.+|.+.-.
T Consensus        29 ~~c~~c~~~f~~~e~   43 (154)
T PRK00464         29 RECLACGKRFTTFER   43 (154)
T ss_pred             eeccccCCcceEeEe
Confidence            566666666665443


No 71 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.66  E-value=1.3  Score=28.15  Aligned_cols=17  Identities=24%  Similarity=0.442  Sum_probs=7.9

Q ss_pred             CcccCCCCCccCCChhH
Q psy7353          81 KVFPCPVCGKEFSRPDK   97 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~~~   97 (139)
                      .-|.|+.|+..|+....
T Consensus       108 ~~Y~Cp~c~~r~tf~eA  124 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEA  124 (158)
T ss_pred             CeEECCCCCcEeeHHHH
Confidence            34455555544444433


No 72 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=84.22  E-value=1.9  Score=25.65  Aligned_cols=47  Identities=11%  Similarity=-0.005  Sum_probs=26.4

Q ss_pred             CCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcchhcccccc
Q psy7353          85 CPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRASPVIDFHKDSV  134 (139)
Q Consensus        85 C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~  134 (139)
                      |..|...|........  .. -.....|.|+.|...|=..-++.-|..-|
T Consensus        58 C~~C~~~f~~~~~~~~--~~-~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        58 CFGCQGPFPKPPVSPF--DE-LKDSHRYVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             ccCcCCCCCCcccccc--cc-cccccceeCCCCCCccccccchhhhhhcc
Confidence            6677776655431110  00 11233577888888877777766665444


No 73 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.99  E-value=1  Score=26.70  Aligned_cols=15  Identities=40%  Similarity=0.957  Sum_probs=8.0

Q ss_pred             CcccCCCCCccCCCh
Q psy7353          81 KVFPCPVCGKEFSRP   95 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~   95 (139)
                      .|..|+.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            455566666555444


No 74 
>KOG2186|consensus
Probab=83.27  E-value=0.89  Score=30.95  Aligned_cols=49  Identities=31%  Similarity=0.553  Sum_probs=35.7

Q ss_pred             ceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHh
Q psy7353          18 IYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTG   77 (139)
Q Consensus        18 ~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~   77 (139)
                      .|.|..||.      -.-+-.+.+|+..++    ...|.|-.|+..|.. ..+..|..--
T Consensus         3 ~FtCnvCgE------svKKp~vekH~srCr----n~~fSCIDC~k~F~~-~sYknH~kCI   51 (276)
T KOG2186|consen    3 FFTCNVCGE------SVKKPQVEKHMSRCR----NAYFSCIDCGKTFER-VSYKNHTKCI   51 (276)
T ss_pred             EEehhhhhh------hccccchHHHHHhcc----CCeeEEeeccccccc-chhhhhhhhc
Confidence            478999996      333446777876656    357899999999988 6678886633


No 75 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=82.05  E-value=2.1  Score=27.79  Aligned_cols=14  Identities=36%  Similarity=0.790  Sum_probs=6.5

Q ss_pred             cccCCCCCccCCCh
Q psy7353          82 VFPCPVCGKEFSRP   95 (139)
Q Consensus        82 ~~~C~~C~~~f~~~   95 (139)
                      .|.|+.|+..|+..
T Consensus       117 ~Y~Cp~C~~rytf~  130 (178)
T PRK06266        117 FFFCPNCHIRFTFD  130 (178)
T ss_pred             EEECCCCCcEEeHH
Confidence            34555555444433


No 76 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.65  E-value=0.88  Score=21.43  Aligned_cols=11  Identities=36%  Similarity=1.153  Sum_probs=6.1

Q ss_pred             ccCCCCCccCC
Q psy7353          83 FPCPVCGKEFS   93 (139)
Q Consensus        83 ~~C~~C~~~f~   93 (139)
                      |.|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            45666665553


No 77 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=80.40  E-value=0.72  Score=22.21  Aligned_cols=13  Identities=38%  Similarity=0.986  Sum_probs=7.2

Q ss_pred             ccCCCCCccCCCh
Q psy7353          83 FPCPVCGKEFSRP   95 (139)
Q Consensus        83 ~~C~~C~~~f~~~   95 (139)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            5566666555433


No 78 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=79.69  E-value=1.6  Score=20.23  Aligned_cols=10  Identities=0%  Similarity=-0.230  Sum_probs=4.7

Q ss_pred             CCCCCCCCCC
Q psy7353         112 ATTPQGQRGQ  121 (139)
Q Consensus       112 ~~C~~C~~~f  121 (139)
                      .+|+.|+..|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            3455555443


No 79 
>KOG2186|consensus
Probab=78.82  E-value=1.7  Score=29.71  Aligned_cols=47  Identities=40%  Similarity=0.851  Sum_probs=33.6

Q ss_pred             eeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHHhhhh
Q psy7353          54 VFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMK  103 (139)
Q Consensus        54 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  103 (139)
                      -|.|..||....-.. +..|+....+ ..|.|.-|+..|.. .+...|.+
T Consensus         3 ~FtCnvCgEsvKKp~-vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKKPQ-VEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhccccc-hHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            367888887665544 4557777766 56888889888877 56667765


No 80 
>KOG4173|consensus
Probab=77.50  E-value=1.1  Score=29.51  Aligned_cols=70  Identities=20%  Similarity=0.510  Sum_probs=48.6

Q ss_pred             ccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCChHHHHHHHHHhc----------CCCcccC--CCCCccCCChhHHH
Q psy7353          32 TFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRPDKMKNHMKTGC----------QRKVFPC--PVCGKEFSRPDKMK   99 (139)
Q Consensus        32 ~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~----------~~~~~~C--~~C~~~f~~~~~l~   99 (139)
                      .|.....+..|-.+.|.+      .|.+|.+.|+....|-.|+...+          |.-.|+|  ..|+..|.......
T Consensus        90 ~~d~lD~~E~hY~~~h~~------sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~Rk  163 (253)
T KOG4173|consen   90 VFDALDDYEHHYHTLHGN------SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRK  163 (253)
T ss_pred             HHhhhhhHHHhhhhcccc------hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhh
Confidence            566655566665444432      69999999999888888875332          3346788  44888898888888


Q ss_pred             hhhhhhcC
Q psy7353         100 NHMKTVHD  107 (139)
Q Consensus       100 ~H~~~~h~  107 (139)
                      .|+...|.
T Consensus       164 dH~I~~Hk  171 (253)
T KOG4173|consen  164 DHMIRMHK  171 (253)
T ss_pred             hHHHHhcc
Confidence            88765454


No 81 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=77.29  E-value=1.4  Score=21.30  Aligned_cols=20  Identities=30%  Similarity=0.702  Sum_probs=8.4

Q ss_pred             ccCCCCCccCCC----hhHHHhhh
Q psy7353          83 FPCPVCGKEFSR----PDKMKNHM  102 (139)
Q Consensus        83 ~~C~~C~~~f~~----~~~l~~H~  102 (139)
                      ..|..|+..+..    .+.|.+|+
T Consensus        17 a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   17 AKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EEETTTTEE-----SSTHHHHHHH
T ss_pred             EEeCCCCeEEeeCCCcHHHHHHhh
Confidence            345555544433    24555555


No 82 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=77.04  E-value=0.31  Score=37.90  Aligned_cols=56  Identities=23%  Similarity=0.507  Sum_probs=40.0

Q ss_pred             cCCCCCcCCChHHHHHHHHHhcCCCc-ccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCC
Q psy7353          57 CPVCGKEFSRPDKMKNHMKTGCQRKV-FPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRG  120 (139)
Q Consensus        57 c~~C~~~~~~~~~l~~h~~~~~~~~~-~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~  120 (139)
                      |..||..|....+|..-+. ++..+. -.|+.|.+.|.++-+..-|.+       |-.|+.||..
T Consensus       126 CT~CGPRfTIi~alPYDR~-nTsM~~F~lC~~C~~EY~dP~nRRfHAQ-------p~aCp~CGP~  182 (750)
T COG0068         126 CTNCGPRFTIIEALPYDRE-NTSMADFPLCPFCDKEYKDPLNRRFHAQ-------PIACPKCGPH  182 (750)
T ss_pred             cCCCCcceeeeccCCCCcc-cCccccCcCCHHHHHHhcCccccccccc-------cccCcccCCC
Confidence            8889999888877655433 333333 369999999999988655544       4589999974


No 83 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=76.79  E-value=1.2  Score=22.33  Aligned_cols=17  Identities=35%  Similarity=0.708  Sum_probs=7.9

Q ss_pred             CcccCCCCCccCCChhH
Q psy7353          81 KVFPCPVCGKEFSRPDK   97 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~~~   97 (139)
                      +.+.|..||..|...+.
T Consensus         3 k~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             eeEEcccCCCeEEEehh
Confidence            34445555554444433


No 84 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=75.80  E-value=0.69  Score=27.27  Aligned_cols=25  Identities=12%  Similarity=0.023  Sum_probs=22.2

Q ss_pred             CCC----CCCCCCCCCCcchhcccccccC
Q psy7353         112 ATT----PQGQRGQRASPVIDFHKDSVFN  136 (139)
Q Consensus       112 ~~C----~~C~~~f~~~~~l~~H~~~~~~  136 (139)
                      |.|    +.|++.+.+...+.+|.+.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            789    8899999999999999988875


No 85 
>KOG2482|consensus
Probab=75.69  E-value=6.5  Score=28.25  Aligned_cols=53  Identities=19%  Similarity=0.418  Sum_probs=31.1

Q ss_pred             CceeecCCCCC-cCCChHHHHHHHHHhcCC----------------------CcccCCCCCccCCChhHHHhhhhh
Q psy7353          52 RKVFPCPVCGK-EFSRPDKMKNHMKTGCQR----------------------KVFPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        52 ~~~~~c~~C~~-~~~~~~~l~~h~~~~~~~----------------------~~~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      .....|-.|+. ..-..+.+..|+..-++-                      ..+.|..|.+.|.++..|..||+.
T Consensus       142 ~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  142 IFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            44556777774 334456666776532211                      124567777777777777777654


No 86 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=75.42  E-value=1.1  Score=22.54  Aligned_cols=11  Identities=36%  Similarity=1.277  Sum_probs=5.1

Q ss_pred             eecCCCCCcCC
Q psy7353          55 FPCPVCGKEFS   65 (139)
Q Consensus        55 ~~c~~C~~~~~   65 (139)
                      |.|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            44555554443


No 87 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=74.22  E-value=5.2  Score=25.00  Aligned_cols=36  Identities=14%  Similarity=0.236  Sum_probs=17.9

Q ss_pred             CCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCC
Q psy7353          80 RKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRG  120 (139)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~  120 (139)
                      ...|.|+.|+..|.....+..   . .. +..|.|+.|+..
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~---~-d~-~~~f~Cp~Cg~~  132 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL---L-DM-DGTFTCPRCGEE  132 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh---c-CC-CCcEECCCCCCE
Confidence            345667777766654332211   0 01 223677777754


No 88 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=74.04  E-value=1.2  Score=19.07  Aligned_cols=19  Identities=26%  Similarity=0.296  Sum_probs=10.1

Q ss_pred             CCCCCCCCCCCCcchhcccc
Q psy7353         113 TTPQGQRGQRASPVIDFHKD  132 (139)
Q Consensus       113 ~C~~C~~~f~~~~~l~~H~~  132 (139)
                      .||.|+..+ ....+..|.+
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466666665 3345555544


No 89 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=72.42  E-value=1.7  Score=21.26  Aligned_cols=11  Identities=36%  Similarity=1.117  Sum_probs=5.8

Q ss_pred             cccCCCCCccC
Q psy7353          82 VFPCPVCGKEF   92 (139)
Q Consensus        82 ~~~C~~C~~~f   92 (139)
                      .|.|+.||..|
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            35555565544


No 90 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=72.42  E-value=2.5  Score=18.13  Aligned_cols=10  Identities=10%  Similarity=-0.024  Sum_probs=5.9

Q ss_pred             CCCCCCCCCC
Q psy7353         113 TTPQGQRGQR  122 (139)
Q Consensus       113 ~C~~C~~~f~  122 (139)
                      .|+.||+.|.
T Consensus        16 ~Cp~CG~~F~   25 (26)
T PF10571_consen   16 FCPHCGYDFE   25 (26)
T ss_pred             cCCCCCCCCc
Confidence            5666666653


No 91 
>KOG4173|consensus
Probab=71.50  E-value=0.54  Score=30.97  Aligned_cols=76  Identities=21%  Similarity=0.304  Sum_probs=52.0

Q ss_pred             ceeecCC--CCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHHhhhhhhcC---------CCCCCCC--CCCCC
Q psy7353          53 KVFPCPV--CGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHD---------CFMPATT--PQGQR  119 (139)
Q Consensus        53 ~~~~c~~--C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~---------~~~~~~C--~~C~~  119 (139)
                      ..+.|++  |...+.....+..|.-.-++   -.|..|.+.|....-|..|+..-|.         |.--|.|  +.|+.
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            4566777  55566666656555433222   2799999999999999988865443         3233888  56999


Q ss_pred             CCCCCcchhccc
Q psy7353         120 GQRASPVIDFHK  131 (139)
Q Consensus       120 ~f~~~~~l~~H~  131 (139)
                      .|.+.-.-..|.
T Consensus       155 KFkT~r~RkdH~  166 (253)
T KOG4173|consen  155 KFKTSRDRKDHM  166 (253)
T ss_pred             hhhhhhhhhhHH
Confidence            999887766663


No 92 
>PF14353 CpXC:  CpXC protein
Probab=71.31  E-value=4.5  Score=24.51  Aligned_cols=12  Identities=25%  Similarity=0.138  Sum_probs=5.7

Q ss_pred             CCCCCCCCCCCC
Q psy7353         112 ATTPQGQRGQRA  123 (139)
Q Consensus       112 ~~C~~C~~~f~~  123 (139)
                      |.|+.||..|..
T Consensus        39 ~~CP~Cg~~~~~   50 (128)
T PF14353_consen   39 FTCPSCGHKFRL   50 (128)
T ss_pred             EECCCCCCceec
Confidence            445555544433


No 93 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=69.92  E-value=3.8  Score=20.39  Aligned_cols=20  Identities=35%  Similarity=0.992  Sum_probs=10.4

Q ss_pred             cCCCCCccCCCh-----hHHHhhhh
Q psy7353          84 PCPVCGKEFSRP-----DKMKNHMK  103 (139)
Q Consensus        84 ~C~~C~~~f~~~-----~~l~~H~~  103 (139)
                      .|..|+..++..     ++|.+|++
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHH
Confidence            455555444332     46666665


No 94 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=69.52  E-value=0.91  Score=24.78  Aligned_cols=14  Identities=0%  Similarity=-0.323  Sum_probs=6.7

Q ss_pred             CCCCC--CCCCCCCCC
Q psy7353         111 PATTP--QGQRGQRAS  124 (139)
Q Consensus       111 ~~~C~--~C~~~f~~~  124 (139)
                      .++|.  +|+.+|+..
T Consensus        27 Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         27 YHQCQNVNCSATFITY   42 (72)
T ss_pred             eeecCCCCCCCEEEEE
Confidence            34454  455555444


No 95 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=69.52  E-value=5  Score=24.46  Aligned_cols=15  Identities=20%  Similarity=0.410  Sum_probs=7.5

Q ss_pred             CcccCCCCCccCCCh
Q psy7353          81 KVFPCPVCGKEFSRP   95 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~   95 (139)
                      .|..|+.||..|...
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            345555555554333


No 96 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=68.53  E-value=2.7  Score=23.79  Aligned_cols=31  Identities=26%  Similarity=0.801  Sum_probs=17.9

Q ss_pred             eeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCC
Q psy7353          54 VFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSR   94 (139)
Q Consensus        54 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   94 (139)
                      .+.|+.|++.        ...+  .....|.|..|+..|.-
T Consensus        35 ~~~Cp~C~~~--------~VkR--~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          35 KHVCPFCGRT--------TVKR--IATGIWKCRKCGAKFAG   65 (89)
T ss_pred             CCcCCCCCCc--------ceee--eccCeEEcCCCCCeecc
Confidence            4678887753        1111  22346778888776644


No 97 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=68.46  E-value=2.9  Score=27.96  Aligned_cols=27  Identities=33%  Similarity=0.844  Sum_probs=18.0

Q ss_pred             CcccCCCCCccCCChhHHHhhhhhhcC
Q psy7353          81 KVFPCPVCGKEFSRPDKMKNHMKTVHD  107 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~~h~  107 (139)
                      .-|.|..|++.|.-......|+...|+
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcCH
Confidence            347788888888888888888776565


No 98 
>KOG2231|consensus
Probab=67.40  E-value=6.5  Score=30.89  Aligned_cols=78  Identities=13%  Similarity=0.173  Sum_probs=49.8

Q ss_pred             HHHHHHHHHhcc-CCCCc-eeecCCCCCcCCChHHHHHHHHHhcCCCccc--CCCCCccCCChhHHHhhhhhhcCCCCCC
Q psy7353          37 YSFQRHAFLYHE-GCQRK-VFPCPVCGKEFSRPDKMKNHMKTGCQRKVFP--CPVCGKEFSRPDKMKNHMKTVHDCFMPA  112 (139)
Q Consensus        37 ~~l~~h~~~~~~-~~~~~-~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~--C~~C~~~f~~~~~l~~H~~~~h~~~~~~  112 (139)
                      ..|+.|++..-. .+..+ .-.|..|...|.+...+..|++.++....|.  -..++.-|.....|..|-+..|     |
T Consensus       163 ~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h~~chfC~~~~~~neyy~~~~dLe~HfR~~H-----f  237 (669)
T KOG2231|consen  163 AELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDHEFCHFCDYKTGQNEYYNDYDDLEEHFRKGH-----F  237 (669)
T ss_pred             HHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccceeheeecCcccccchhcccchHHHHHhhhcC-----c
Confidence            456667654222 11111 2468899999999999999998765443321  1223456788899999988766     4


Q ss_pred             CCC--CCCC
Q psy7353         113 TTP--QGQR  119 (139)
Q Consensus       113 ~C~--~C~~  119 (139)
                      .|+  .|..
T Consensus       238 lCE~~~C~~  246 (669)
T KOG2231|consen  238 LCEEEFCRT  246 (669)
T ss_pred             ccccccccc
Confidence            666  4553


No 99 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=66.22  E-value=1.6  Score=19.45  Aligned_cols=8  Identities=50%  Similarity=1.551  Sum_probs=3.4

Q ss_pred             cccCCCCC
Q psy7353          82 VFPCPVCG   89 (139)
Q Consensus        82 ~~~C~~C~   89 (139)
                      .+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444443


No 100
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=65.72  E-value=4.1  Score=32.41  Aligned_cols=12  Identities=17%  Similarity=0.346  Sum_probs=8.7

Q ss_pred             CCCCCCCCCCCC
Q psy7353         109 FMPATTPQGQRG  120 (139)
Q Consensus       109 ~~~~~C~~C~~~  120 (139)
                      ..|..|+.|+-.
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            457788888854


No 101
>PF12907 zf-met2:  Zinc-binding
Probab=64.93  E-value=2.9  Score=19.98  Aligned_cols=26  Identities=19%  Similarity=0.447  Sum_probs=13.1

Q ss_pred             cCCCCCcc---CCChhHHHhhhhhhcCCC
Q psy7353          84 PCPVCGKE---FSRPDKMKNHMKTVHDCF  109 (139)
Q Consensus        84 ~C~~C~~~---f~~~~~l~~H~~~~h~~~  109 (139)
                      .|.+|...   ......|..|....|++.
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            45555532   233455666655545543


No 102
>KOG1280|consensus
Probab=64.40  E-value=9.8  Score=27.37  Aligned_cols=40  Identities=20%  Similarity=0.452  Sum_probs=24.7

Q ss_pred             CcceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCC
Q psy7353          16 EGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCG   61 (139)
Q Consensus        16 ~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~   61 (139)
                      +..|.|++|+.     +=.+...|+.|....|.... ....|++|.
T Consensus        77 ~qSftCPyC~~-----~Gfte~~f~~Hv~s~Hpda~-~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGI-----MGFTERQFGTHVLSQHPEAS-TSVICPLCA  116 (381)
T ss_pred             cccccCCcccc-----cccchhHHHHHhhhcCcccC-cceeeeccc
Confidence            44688888887     44455567777766666432 334566664


No 103
>KOG2785|consensus
Probab=63.92  E-value=14  Score=27.02  Aligned_cols=58  Identities=24%  Similarity=0.464  Sum_probs=37.7

Q ss_pred             eecCCCCCcCCChHHHHHHHHHhcCC-----------------------CcccCCCCC---ccCCChhHHHhhhhhhcCC
Q psy7353          55 FPCPVCGKEFSRPDKMKNHMKTGCQR-----------------------KVFPCPVCG---KEFSRPDKMKNHMKTVHDC  108 (139)
Q Consensus        55 ~~c~~C~~~~~~~~~l~~h~~~~~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~~h~~  108 (139)
                      -.|..|+..+.+......||..+++-                       .-+.|..|.   +.|......+.||...-..
T Consensus       167 t~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K~HC  246 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDKGHC  246 (390)
T ss_pred             cceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhccCc
Confidence            44666766666666666666655542                       335677777   7888888888888754444


Q ss_pred             CCCC
Q psy7353         109 FMPA  112 (139)
Q Consensus       109 ~~~~  112 (139)
                      ..+|
T Consensus       247 kl~y  250 (390)
T KOG2785|consen  247 KLPY  250 (390)
T ss_pred             ccCC
Confidence            4555


No 104
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=63.18  E-value=11  Score=25.27  Aligned_cols=29  Identities=31%  Similarity=0.575  Sum_probs=20.0

Q ss_pred             CCcceecCCCCCcchhcccCCHHHHHHHHHHhcc
Q psy7353          15 TEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHE   48 (139)
Q Consensus        15 ~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~   48 (139)
                      .+..|.|+.|+|     .|.-.....+|+..-|.
T Consensus        74 ~~~K~~C~lc~K-----lFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGK-----LFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS------EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCc-----ccCChHHHHHHHhhcCH
Confidence            455688888888     88888888888866554


No 105
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=62.76  E-value=4.2  Score=16.76  Aligned_cols=6  Identities=17%  Similarity=0.257  Sum_probs=2.9

Q ss_pred             CCCCCC
Q psy7353         114 TPQGQR  119 (139)
Q Consensus       114 C~~C~~  119 (139)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            455543


No 106
>KOG4124|consensus
Probab=62.39  E-value=3.6  Score=29.54  Aligned_cols=52  Identities=21%  Similarity=0.402  Sum_probs=36.5

Q ss_pred             CcccCCC--CCccCCChhHHHhhhhhhcC------------------CCCCCCCCCCCCCCCCCcchhcccc
Q psy7353          81 KVFPCPV--CGKEFSRPDKMKNHMKTVHD------------------CFMPATTPQGQRGQRASPVIDFHKD  132 (139)
Q Consensus        81 ~~~~C~~--C~~~f~~~~~l~~H~~~~h~------------------~~~~~~C~~C~~~f~~~~~l~~H~~  132 (139)
                      ++|.|.+  |++.++..-.|..|..+.|.                  ..++|.|++|.+++...+.|.-|+.
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceee
Confidence            6777854  88888776666655443222                  2467999999999988888876643


No 107
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=61.81  E-value=12  Score=16.90  Aligned_cols=10  Identities=20%  Similarity=0.401  Sum_probs=5.3

Q ss_pred             CCCCCCCCCC
Q psy7353         111 PATTPQGQRG  120 (139)
Q Consensus       111 ~~~C~~C~~~  120 (139)
                      +-.|+.||.+
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            3466666654


No 108
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=60.97  E-value=5.3  Score=16.77  Aligned_cols=11  Identities=18%  Similarity=0.525  Sum_probs=8.5

Q ss_pred             CcceecCCCCC
Q psy7353          16 EGIYKCMECAK   26 (139)
Q Consensus        16 ~~~~~C~~c~~   26 (139)
                      ...|.|+.||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            45789999984


No 109
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=60.62  E-value=3.1  Score=29.84  Aligned_cols=13  Identities=15%  Similarity=0.368  Sum_probs=7.4

Q ss_pred             cCCChhHHHhhhh
Q psy7353          91 EFSRPDKMKNHMK  103 (139)
Q Consensus        91 ~f~~~~~l~~H~~  103 (139)
                      .|.+...|+.|+-
T Consensus       290 vf~~~~el~~h~~  302 (493)
T COG5236         290 VFPYHTELLEHLT  302 (493)
T ss_pred             EeccHHHHHHHHH
Confidence            4555566666653


No 110
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=60.36  E-value=6.8  Score=22.98  Aligned_cols=24  Identities=29%  Similarity=0.718  Sum_probs=21.6

Q ss_pred             ccC----CCCCccCCChhHHHhhhhhhc
Q psy7353          83 FPC----PVCGKEFSRPDKMKNHMKTVH  106 (139)
Q Consensus        83 ~~C----~~C~~~f~~~~~l~~H~~~~h  106 (139)
                      |.|    ..|++.......+..|.+.+|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            789    999999999999999998765


No 111
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=59.65  E-value=2.4  Score=31.68  Aligned_cols=30  Identities=30%  Similarity=0.679  Sum_probs=23.4

Q ss_pred             CCCcccCCCCCccCCChhHHHhhhhhhcCC
Q psy7353          79 QRKVFPCPVCGKEFSRPDKMKNHMKTVHDC  108 (139)
Q Consensus        79 ~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~  108 (139)
                      .-+-|.|+.|.+.|.....+..|+-..|.+
T Consensus        54 sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   54 SWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             ceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            345678888888888888888888766764


No 112
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=59.59  E-value=8.1  Score=19.10  Aligned_cols=16  Identities=0%  Similarity=-0.213  Sum_probs=9.5

Q ss_pred             CCCCCCCCCCCCCCcc
Q psy7353         111 PATTPQGQRGQRASPV  126 (139)
Q Consensus       111 ~~~C~~C~~~f~~~~~  126 (139)
                      .|.|+.|++.+.-.+.
T Consensus        20 ~~vC~~Cg~~~~~~~~   35 (52)
T smart00661       20 RFVCRKCGYEEPIEQK   35 (52)
T ss_pred             EEECCcCCCeEECCCc
Confidence            4667777766555443


No 113
>PRK04023 DNA polymerase II large subunit; Validated
Probab=57.66  E-value=18  Score=30.07  Aligned_cols=10  Identities=10%  Similarity=0.019  Sum_probs=6.1

Q ss_pred             CCCCCCCCCC
Q psy7353         111 PATTPQGQRG  120 (139)
Q Consensus       111 ~~~C~~C~~~  120 (139)
                      ++.|+.|+..
T Consensus       663 ~y~CPKCG~E  672 (1121)
T PRK04023        663 EDECEKCGRE  672 (1121)
T ss_pred             CCcCCCCCCC
Confidence            3567777654


No 114
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=57.59  E-value=3.8  Score=19.05  Aligned_cols=11  Identities=0%  Similarity=-0.206  Sum_probs=6.1

Q ss_pred             CCCCCCCCCCC
Q psy7353         111 PATTPQGQRGQ  121 (139)
Q Consensus       111 ~~~C~~C~~~f  121 (139)
                      +-.|+.|+-.+
T Consensus        21 ~~~Cd~cg~~L   31 (36)
T PF05191_consen   21 EGVCDNCGGEL   31 (36)
T ss_dssp             TTBCTTTTEBE
T ss_pred             CCccCCCCCee
Confidence            34666666543


No 115
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=56.65  E-value=19  Score=22.97  Aligned_cols=57  Identities=18%  Similarity=0.376  Sum_probs=30.7

Q ss_pred             eeecCCCCCcCCChHHHHHHHHHhcCCCcccCCC--CCccCCChhHHHhhhhhhcCCCCCC
Q psy7353          54 VFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPV--CGKEFSRPDKMKNHMKTVHDCFMPA  112 (139)
Q Consensus        54 ~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~h~~~~~~  112 (139)
                      ...|+.|.-.... +.....-+.+...|+-.|..  |.+. -....|.+|.+..|+..+|-
T Consensus        80 ~L~CPLCRG~V~G-Wtvve~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP~  138 (162)
T PF07800_consen   80 ELACPLCRGEVKG-WTVVEPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSARPS  138 (162)
T ss_pred             cccCccccCceec-eEEchHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCCCCc
Confidence            3457777632221 11222234445556666644  5432 33467888888878876663


No 116
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=56.42  E-value=4.9  Score=24.79  Aligned_cols=11  Identities=45%  Similarity=1.189  Sum_probs=5.6

Q ss_pred             eeecCCCCCcC
Q psy7353          54 VFPCPVCGKEF   64 (139)
Q Consensus        54 ~~~c~~C~~~~   64 (139)
                      .+.|..|+..|
T Consensus        70 ~~~C~~CG~~~   80 (135)
T PRK03824         70 VLKCRNCGNEW   80 (135)
T ss_pred             EEECCCCCCEE
Confidence            35555555443


No 117
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=56.21  E-value=16  Score=17.74  Aligned_cols=10  Identities=0%  Similarity=-0.193  Sum_probs=6.0

Q ss_pred             CCCCCCCCCC
Q psy7353         110 MPATTPQGQR  119 (139)
Q Consensus       110 ~~~~C~~C~~  119 (139)
                      ..|.|..|++
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            4566666654


No 118
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.72  E-value=2.9  Score=28.22  Aligned_cols=16  Identities=38%  Similarity=1.070  Sum_probs=9.3

Q ss_pred             ceeecCCCCCcCCChH
Q psy7353          53 KVFPCPVCGKEFSRPD   68 (139)
Q Consensus        53 ~~~~c~~C~~~~~~~~   68 (139)
                      +.+.||+|+..|....
T Consensus        18 k~ieCPvC~tkFkkee   33 (267)
T COG1655          18 KTIECPVCNTKFKKEE   33 (267)
T ss_pred             ceeccCcccchhhhhh
Confidence            3456666666655544


No 119
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=55.22  E-value=1.5  Score=25.39  Aligned_cols=11  Identities=55%  Similarity=1.367  Sum_probs=6.9

Q ss_pred             CceeecCCCCC
Q psy7353          52 RKVFPCPVCGK   62 (139)
Q Consensus        52 ~~~~~c~~C~~   62 (139)
                      .+.|.|+.|+.
T Consensus        20 ~k~FtCp~Cgh   30 (104)
T COG4888          20 PKTFTCPRCGH   30 (104)
T ss_pred             CceEecCccCC
Confidence            45566777764


No 120
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=54.41  E-value=8  Score=29.43  Aligned_cols=10  Identities=40%  Similarity=0.627  Sum_probs=6.8

Q ss_pred             CCCCCCCCCC
Q psy7353         110 MPATTPQGQR  119 (139)
Q Consensus       110 ~~~~C~~C~~  119 (139)
                      .|..|+.|+-
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            3667777765


No 121
>KOG2785|consensus
Probab=54.35  E-value=22  Score=26.03  Aligned_cols=56  Identities=25%  Similarity=0.364  Sum_probs=42.9

Q ss_pred             CcceecCCCCCcchhcccCCHHHHHHHHHHhccCC--------------------CCceeecCCCC---CcCCChHHHHH
Q psy7353          16 EGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGC--------------------QRKVFPCPVCG---KEFSRPDKMKN   72 (139)
Q Consensus        16 ~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~--------------------~~~~~~c~~C~---~~~~~~~~l~~   72 (139)
                      ..|-.|-.|++     .+.+...-..||...|.-.                    +...+.|..|+   ..|....+...
T Consensus       164 ~~Pt~CLfC~~-----~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~  238 (390)
T KOG2785|consen  164 LIPTDCLFCDK-----KSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRA  238 (390)
T ss_pred             cCCcceeecCC-----CcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHH
Confidence            34567889999     8999888888987655421                    23567888888   88999999999


Q ss_pred             HHHH
Q psy7353          73 HMKT   76 (139)
Q Consensus        73 h~~~   76 (139)
                      ||..
T Consensus       239 HM~~  242 (390)
T KOG2785|consen  239 HMRD  242 (390)
T ss_pred             HHhh
Confidence            9873


No 122
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=53.92  E-value=25  Score=30.05  Aligned_cols=10  Identities=60%  Similarity=1.471  Sum_probs=6.0

Q ss_pred             cccCCCCCcc
Q psy7353          82 VFPCPVCGKE   91 (139)
Q Consensus        82 ~~~C~~C~~~   91 (139)
                      +|.|+.||..
T Consensus       692 vy~CPsCGae  701 (1337)
T PRK14714        692 VYVCPDCGAE  701 (1337)
T ss_pred             ceeCccCCCc
Confidence            4566666654


No 123
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=52.23  E-value=2.1  Score=18.74  Aligned_cols=20  Identities=5%  Similarity=-0.040  Sum_probs=10.6

Q ss_pred             CCCCCCCCCCCCCcchhcccc
Q psy7353         112 ATTPQGQRGQRASPVIDFHKD  132 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~H~~  132 (139)
                      |.|-.|++.| ....++.|..
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht~   20 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHTS   20 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT---
T ss_pred             CeeecCCCCc-CcCCcCCCCc
Confidence            3566677777 5555656643


No 124
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=51.89  E-value=2  Score=20.44  Aligned_cols=10  Identities=0%  Similarity=-0.237  Sum_probs=6.3

Q ss_pred             CCCCCCCCCC
Q psy7353         112 ATTPQGQRGQ  121 (139)
Q Consensus       112 ~~C~~C~~~f  121 (139)
                      |.|..|+..+
T Consensus        29 y~C~~C~~~w   38 (40)
T smart00440       29 YVCTKCGHRW   38 (40)
T ss_pred             EEeCCCCCEe
Confidence            6666666554


No 125
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=51.54  E-value=1.8  Score=28.44  Aligned_cols=16  Identities=0%  Similarity=-0.078  Sum_probs=9.6

Q ss_pred             CCCCCCCCCCCCCcch
Q psy7353         112 ATTPQGQRGQRASPVI  127 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~l  127 (139)
                      +.|..|+++++..-.|
T Consensus        44 ~~C~~CgYR~~DV~~~   59 (201)
T COG1779          44 GVCERCGYRSTDVKTL   59 (201)
T ss_pred             EEccccCCcccceeec
Confidence            5677777766654433


No 126
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=51.38  E-value=11  Score=18.85  Aligned_cols=6  Identities=50%  Similarity=1.464  Sum_probs=2.2

Q ss_pred             ecCCCC
Q psy7353          20 KCMECA   25 (139)
Q Consensus        20 ~C~~c~   25 (139)
                      .|..||
T Consensus         8 ~C~~Cg   13 (49)
T COG1996           8 KCARCG   13 (49)
T ss_pred             EhhhcC
Confidence            333333


No 127
>PRK10220 hypothetical protein; Provisional
Probab=51.29  E-value=12  Score=22.20  Aligned_cols=10  Identities=40%  Similarity=1.315  Sum_probs=4.6

Q ss_pred             ccCCCCCccC
Q psy7353          83 FPCPVCGKEF   92 (139)
Q Consensus        83 ~~C~~C~~~f   92 (139)
                      |.|++|+..+
T Consensus        21 ~vCpeC~hEW   30 (111)
T PRK10220         21 YICPECAHEW   30 (111)
T ss_pred             EECCcccCcC
Confidence            4445444433


No 128
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=50.27  E-value=1.3  Score=20.52  Aligned_cols=11  Identities=0%  Similarity=-0.173  Sum_probs=5.2

Q ss_pred             CCCCCCCCCCC
Q psy7353         112 ATTPQGQRGQR  122 (139)
Q Consensus       112 ~~C~~C~~~f~  122 (139)
                      -.|..||..++
T Consensus        22 isC~~CGPr~~   32 (35)
T PF07503_consen   22 ISCTNCGPRYS   32 (35)
T ss_dssp             --BTTCC-SCC
T ss_pred             ccCCCCCCCEE
Confidence            36677776654


No 129
>KOG3002|consensus
Probab=50.12  E-value=18  Score=25.59  Aligned_cols=82  Identities=20%  Similarity=0.336  Sum_probs=47.3

Q ss_pred             CceeecCCCCCcCCChHHHHHHHHHhcCCCcccCC----CCCccCCChhHHHhhhhhhcCCCCCCCCCC----CCCCCCC
Q psy7353          52 RKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCP----VCGKEFSRPDKMKNHMKTVHDCFMPATTPQ----GQRGQRA  123 (139)
Q Consensus        52 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~----~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~----C~~~f~~  123 (139)
                      .....|+.|...+.....+..  ..-.....++|+    .|.+.|.+... ..|.+.. .. .||.|+.    |.+.- .
T Consensus        78 ~~~~~CP~Cr~~~g~~R~~am--EkV~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C-~f-~~~~CP~p~~~C~~~G-~  151 (299)
T KOG3002|consen   78 KVSNKCPTCRLPIGNIRCRAM--EKVAEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVC-EF-RPCSCPVPGAECKYTG-S  151 (299)
T ss_pred             hhcccCCccccccccHHHHHH--HHHHHhceecccccccCCceeeccccc-ccccccc-cc-CCcCCCCCcccCCccC-c
Confidence            345679999877665544432  222333445554    48888877766 5666642 22 6888864    55432 3


Q ss_pred             CcchhcccccccCcCC
Q psy7353         124 SPVIDFHKDSVFNKDI  139 (139)
Q Consensus       124 ~~~l~~H~~~~~~~~~  139 (139)
                      ..+|..|...-|..||
T Consensus       152 ~~~l~~H~~~~hk~~~  167 (299)
T KOG3002|consen  152 YKDLYAHLNDTHKSDI  167 (299)
T ss_pred             HHHHHHHHHhhChhhh
Confidence            3456667655565543


No 130
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=50.01  E-value=5.4  Score=22.80  Aligned_cols=32  Identities=25%  Similarity=0.624  Sum_probs=18.3

Q ss_pred             ceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCC
Q psy7353          53 KVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSR   94 (139)
Q Consensus        53 ~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~   94 (139)
                      ..|.|+.|++.-..          -...-+|.|..|++.|.-
T Consensus        35 a~y~CpfCgk~~vk----------R~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         35 AKYFCPFCGKHAVK----------RQAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             CCccCCCCCCCcee----------eeeeEEEEcCCCCCEEeC
Confidence            35778888753111          112246788888776643


No 131
>KOG3408|consensus
Probab=49.07  E-value=4  Score=24.61  Aligned_cols=23  Identities=35%  Similarity=0.674  Sum_probs=14.0

Q ss_pred             cccCCCCCccCCChhHHHhhhhh
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      .|.|..|.+-|.+...|..|.++
T Consensus        57 qfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   57 QFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             eeehhhhhhhhcchHHHHHHHhc
Confidence            35566666666666666666554


No 132
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=48.33  E-value=12  Score=22.19  Aligned_cols=10  Identities=10%  Similarity=-0.110  Sum_probs=4.6

Q ss_pred             CCCCCCCCCC
Q psy7353         112 ATTPQGQRGQ  121 (139)
Q Consensus       112 ~~C~~C~~~f  121 (139)
                      |.|++|+...
T Consensus        20 ~iCpeC~~EW   29 (109)
T TIGR00686        20 LICPSCLYEW   29 (109)
T ss_pred             eECccccccc
Confidence            4444444443


No 133
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=48.02  E-value=31  Score=21.34  Aligned_cols=57  Identities=16%  Similarity=0.334  Sum_probs=30.9

Q ss_pred             CceeecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCC--ChhHHHhhhhhhcCCCCCCCCCCCCCCCCCCcc
Q psy7353          52 RKVFPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFS--RPDKMKNHMKTVHDCFMPATTPQGQRGQRASPV  126 (139)
Q Consensus        52 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~--~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~  126 (139)
                      .+-|.|.+|.....++..|          +|-+|  ||+..-  --.+|=.|-.+ |+     .||.|.-.|.+...
T Consensus        78 ~~lYeCnIC~etS~ee~FL----------KPneC--CgY~iCn~Cya~LWK~~~~-yp-----vCPvCkTSFKss~~  136 (140)
T PF05290_consen   78 PKLYECNICKETSAEERFL----------KPNEC--CGYSICNACYANLWKFCNL-YP-----VCPVCKTSFKSSSS  136 (140)
T ss_pred             CCceeccCcccccchhhcC----------Ccccc--cchHHHHHHHHHHHHHccc-CC-----CCCccccccccccc
Confidence            4567777776554443322          23333  333211  12344444444 55     89999999987654


No 134
>KOG2907|consensus
Probab=47.34  E-value=12  Score=22.36  Aligned_cols=40  Identities=18%  Similarity=0.304  Sum_probs=20.8

Q ss_pred             ccCCCCCccCCChhHHHhhhhh-hcCCCCCCCCCCCCCCCCCC
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKT-VHDCFMPATTPQGQRGQRAS  124 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~-~h~~~~~~~C~~C~~~f~~~  124 (139)
                      ..|+.||..=.....|  .+|. .-+-.--|.|+.|++.|+..
T Consensus        75 ~kCpkCghe~m~Y~T~--QlRSADEGQTVFYTC~kC~~k~~e~  115 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTL--QLRSADEGQTVFYTCPKCKYKFTEN  115 (116)
T ss_pred             ccCcccCCchhhhhhh--hcccccCCceEEEEcCccceeeecc
Confidence            4688888532222221  1222 01111248999999988753


No 135
>PRK14873 primosome assembly protein PriA; Provisional
Probab=46.62  E-value=14  Score=29.32  Aligned_cols=11  Identities=9%  Similarity=-0.040  Sum_probs=7.7

Q ss_pred             CCCCCCCCCCC
Q psy7353         110 MPATTPQGQRG  120 (139)
Q Consensus       110 ~~~~C~~C~~~  120 (139)
                      .|+.|+.|+-.
T Consensus       421 ~p~~Cp~Cgs~  431 (665)
T PRK14873        421 PDWRCPRCGSD  431 (665)
T ss_pred             cCccCCCCcCC
Confidence            36788888754


No 136
>KOG2593|consensus
Probab=45.81  E-value=21  Score=26.58  Aligned_cols=38  Identities=11%  Similarity=0.164  Sum_probs=22.0

Q ss_pred             cCCCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCC
Q psy7353          78 CQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQR  119 (139)
Q Consensus        78 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~  119 (139)
                      +...-|.|+.|.+.|+.-..++--.    ...-.|.|..|+-
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L~~----~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQLLD----NETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHHhhc----ccCceEEEecCCC
Confidence            3445678888887776655542221    2223577777764


No 137
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=45.71  E-value=14  Score=18.69  Aligned_cols=24  Identities=21%  Similarity=0.430  Sum_probs=10.1

Q ss_pred             CcccCCCCCccCCChhHHHhhhhh
Q psy7353          81 KVFPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      ..|.|+.|...|-..-+.-.|...
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~L   43 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHETL   43 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTTS
T ss_pred             CeEECCCCCCccccCcChhhhccc
Confidence            345666666666555555445443


No 138
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=45.52  E-value=41  Score=21.90  Aligned_cols=8  Identities=25%  Similarity=0.260  Sum_probs=5.0

Q ss_pred             CCCCCCCC
Q psy7353         112 ATTPQGQR  119 (139)
Q Consensus       112 ~~C~~C~~  119 (139)
                      |.||.||.
T Consensus       133 F~Cp~Cg~  140 (176)
T COG1675         133 FTCPKCGE  140 (176)
T ss_pred             CCCCCCCc
Confidence            56666664


No 139
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=44.85  E-value=16  Score=19.29  Aligned_cols=11  Identities=64%  Similarity=1.467  Sum_probs=5.2

Q ss_pred             CcccCCCCCcc
Q psy7353          81 KVFPCPVCGKE   91 (139)
Q Consensus        81 ~~~~C~~C~~~   91 (139)
                      +.|.|+.||..
T Consensus        45 r~~~C~~Cg~~   55 (69)
T PF07282_consen   45 RVFTCPNCGFE   55 (69)
T ss_pred             ceEEcCCCCCE
Confidence            34455555543


No 140
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=44.76  E-value=4.1  Score=25.09  Aligned_cols=20  Identities=40%  Similarity=0.889  Sum_probs=8.8

Q ss_pred             ccCCCCCccCCChhHHHhhhhhh
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKTV  105 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~  105 (139)
                      ..|.+||+.|..   |.+|++++
T Consensus        73 i~clecGk~~k~---LkrHL~~~   92 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTH   92 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHT
T ss_pred             eEEccCCcccch---HHHHHHHc
Confidence            456666665543   35666653


No 141
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=43.44  E-value=16  Score=21.74  Aligned_cols=10  Identities=20%  Similarity=0.265  Sum_probs=6.6

Q ss_pred             ccCCCCCccC
Q psy7353          83 FPCPVCGKEF   92 (139)
Q Consensus        83 ~~C~~C~~~f   92 (139)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            5677777554


No 142
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=43.15  E-value=22  Score=26.44  Aligned_cols=11  Identities=36%  Similarity=0.857  Sum_probs=5.5

Q ss_pred             cccCCCCCccC
Q psy7353          82 VFPCPVCGKEF   92 (139)
Q Consensus        82 ~~~C~~C~~~f   92 (139)
                      -|.|+.||..+
T Consensus       367 g~rC~kCg~~~  377 (421)
T COG1571         367 GFRCKKCGTRA  377 (421)
T ss_pred             CcccccccccC
Confidence            45555555443


No 143
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=42.73  E-value=11  Score=18.98  Aligned_cols=10  Identities=0%  Similarity=-0.373  Sum_probs=4.9

Q ss_pred             CCCCCCCCCC
Q psy7353         111 PATTPQGQRG  120 (139)
Q Consensus       111 ~~~C~~C~~~  120 (139)
                      .+.|+.|++.
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            3455555543


No 144
>KOG2593|consensus
Probab=41.44  E-value=21  Score=26.54  Aligned_cols=38  Identities=24%  Similarity=0.473  Sum_probs=25.3

Q ss_pred             CCCcceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCC
Q psy7353          14 VTEGIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGK   62 (139)
Q Consensus        14 ~~~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~   62 (139)
                      +...-|.|+.|.+     .|.+...++.-..  -    .-.|.|..|+.
T Consensus       124 t~~~~Y~Cp~C~k-----kyt~Lea~~L~~~--~----~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQK-----KYTSLEALQLLDN--E----TGEFHCENCGG  161 (436)
T ss_pred             cccccccCCcccc-----chhhhHHHHhhcc--c----CceEEEecCCC
Confidence            3445688999998     7887766653321  1    34688888874


No 145
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=40.81  E-value=13  Score=17.58  Aligned_cols=13  Identities=31%  Similarity=0.807  Sum_probs=5.3

Q ss_pred             ecCCCCCcCCChH
Q psy7353          56 PCPVCGKEFSRPD   68 (139)
Q Consensus        56 ~c~~C~~~~~~~~   68 (139)
                      .|+.|+-.+.+..
T Consensus        21 ~C~~C~G~W~d~~   33 (41)
T PF13453_consen   21 VCPSCGGIWFDAG   33 (41)
T ss_pred             ECCCCCeEEccHH
Confidence            3444444444333


No 146
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=40.74  E-value=26  Score=17.64  Aligned_cols=13  Identities=38%  Similarity=1.183  Sum_probs=6.5

Q ss_pred             ccCCCCCccCCCh
Q psy7353          83 FPCPVCGKEFSRP   95 (139)
Q Consensus        83 ~~C~~C~~~f~~~   95 (139)
                      +.|..||..|...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            4555555544433


No 147
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=40.36  E-value=9.6  Score=17.50  Aligned_cols=15  Identities=7%  Similarity=-0.046  Sum_probs=7.6

Q ss_pred             CCCCCCCCCCCCcch
Q psy7353         113 TTPQGQRGQRASPVI  127 (139)
Q Consensus       113 ~C~~C~~~f~~~~~l  127 (139)
                      .|.+|++.|.....+
T Consensus         5 ~C~eC~~~f~dSyL~   19 (34)
T PF01286_consen    5 KCDECGKPFMDSYLL   19 (34)
T ss_dssp             E-TTT--EES-SSCC
T ss_pred             hHhHhCCHHHHHHHH
Confidence            577788877776555


No 148
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=39.77  E-value=29  Score=26.28  Aligned_cols=29  Identities=24%  Similarity=0.395  Sum_probs=24.6

Q ss_pred             cceecCCCCCcchhcccCCHHHHHHHHHHhccCC
Q psy7353          17 GIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGC   50 (139)
Q Consensus        17 ~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~   50 (139)
                      +.|.|+.|.+     .|.+...+..|+...|.+.
T Consensus        56 rFWiCp~Csk-----kF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   56 RFWICPRCSK-----KFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eEeeCCcccc-----eeCCHHHHHHHHHHhhhhh
Confidence            4588999998     8999999999998777763


No 149
>KOG0717|consensus
Probab=39.19  E-value=7.6  Score=29.09  Aligned_cols=23  Identities=9%  Similarity=0.065  Sum_probs=19.3

Q ss_pred             CCCCCCCCCCCCCcchhcccccc
Q psy7353         112 ATTPQGQRGQRASPVIDFHKDSV  134 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~H~~~~  134 (139)
                      +.|..|.+.|.+...|..|..++
T Consensus       293 lyC~vCnKsFKseKq~kNHEnSK  315 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENSK  315 (508)
T ss_pred             eEEeeccccccchHHHHhhHHHH
Confidence            67889999999999998887664


No 150
>PRK05978 hypothetical protein; Provisional
Probab=38.78  E-value=21  Score=22.54  Aligned_cols=11  Identities=0%  Similarity=-0.203  Sum_probs=6.2

Q ss_pred             CCCCCCCCCCC
Q psy7353         113 TTPQGQRGQRA  123 (139)
Q Consensus       113 ~C~~C~~~f~~  123 (139)
                      .|+.|+..|..
T Consensus        54 ~C~~CG~~~~~   64 (148)
T PRK05978         54 HCAACGEDFTH   64 (148)
T ss_pred             CccccCCcccc
Confidence            56666655543


No 151
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=38.35  E-value=19  Score=18.12  Aligned_cols=10  Identities=0%  Similarity=-0.343  Sum_probs=6.0

Q ss_pred             CCCCCCCCCC
Q psy7353         111 PATTPQGQRG  120 (139)
Q Consensus       111 ~~~C~~C~~~  120 (139)
                      .|.|..|++.
T Consensus        37 R~~CGkCgyT   46 (51)
T COG1998          37 RWACGKCGYT   46 (51)
T ss_pred             eeEeccccce
Confidence            4566666653


No 152
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=38.14  E-value=23  Score=17.37  Aligned_cols=22  Identities=27%  Similarity=0.502  Sum_probs=13.5

Q ss_pred             ccCCCCCccCCChhHHHhhhhh
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      |.|-.|.....-.+.|-.|++.
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            4566666655666666666653


No 153
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=38.00  E-value=11  Score=23.47  Aligned_cols=10  Identities=10%  Similarity=-0.137  Sum_probs=5.7

Q ss_pred             CCCCCCCCCC
Q psy7353         112 ATTPQGQRGQ  121 (139)
Q Consensus       112 ~~C~~C~~~f  121 (139)
                      |.|+.|++.|
T Consensus       125 ~~C~~C~kiy  134 (147)
T PF01927_consen  125 WRCPGCGKIY  134 (147)
T ss_pred             EECCCCCCEe
Confidence            5566666554


No 154
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=37.73  E-value=23  Score=17.11  Aligned_cols=16  Identities=44%  Similarity=1.010  Sum_probs=10.8

Q ss_pred             cCCCCCccCCChhHHH
Q psy7353          84 PCPVCGKEFSRPDKMK   99 (139)
Q Consensus        84 ~C~~C~~~f~~~~~l~   99 (139)
                      .|..|+..|++.-.+.
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            4777777777765543


No 155
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=37.68  E-value=41  Score=17.33  Aligned_cols=11  Identities=45%  Similarity=1.071  Sum_probs=6.5

Q ss_pred             CCcccCCCCCc
Q psy7353          80 RKVFPCPVCGK   90 (139)
Q Consensus        80 ~~~~~C~~C~~   90 (139)
                      ...|.|+.||-
T Consensus        12 ~v~~~Cp~cGi   22 (55)
T PF13824_consen   12 HVNFECPDCGI   22 (55)
T ss_pred             ccCCcCCCCCC
Confidence            44566666664


No 156
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=37.57  E-value=2.6  Score=33.43  Aligned_cols=58  Identities=22%  Similarity=0.480  Sum_probs=36.1

Q ss_pred             ecCCCCCcCCChHHHHHHHHHhcCCC-cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCC
Q psy7353          56 PCPVCGKEFSRPDKMKNHMKTGCQRK-VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQ  121 (139)
Q Consensus        56 ~c~~C~~~~~~~~~l~~h~~~~~~~~-~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f  121 (139)
                      .|..||..|.....|..-. ..+... .-.|+.|.+.+.++.+...|-.       +-.|+.||.+.
T Consensus        92 nCt~CGPr~~i~~~lpydr-~~t~m~~f~~C~~C~~ey~~p~~rr~h~~-------~~~C~~Cgp~l  150 (711)
T TIGR00143        92 SCTHCGPRFTIIEALPYDR-ENTSMADFPLCPDCAKEYKDPLDRRFHAQ-------PIACPRCGPQL  150 (711)
T ss_pred             cccCCCCCeEEeecCCCCC-CCcCCCCCcCCHHHHHHhcCCccccCCCC-------CccCCCCCcEE
Confidence            3888998877766544322 222223 2368889888887766433322       44899999754


No 157
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=37.51  E-value=15  Score=18.69  Aligned_cols=18  Identities=28%  Similarity=1.032  Sum_probs=6.5

Q ss_pred             HHHHHHHhcCCCcccCCC
Q psy7353          70 MKNHMKTGCQRKVFPCPV   87 (139)
Q Consensus        70 l~~h~~~~~~~~~~~C~~   87 (139)
                      |..|....-..++..|+.
T Consensus        26 l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   26 LDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             HHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHccCCCCcEECCC
Confidence            444444333333334433


No 158
>PRK05580 primosome assembly protein PriA; Validated
Probab=36.20  E-value=30  Score=27.53  Aligned_cols=10  Identities=20%  Similarity=0.531  Sum_probs=6.3

Q ss_pred             CCCCCCCCCC
Q psy7353         110 MPATTPQGQR  119 (139)
Q Consensus       110 ~~~~C~~C~~  119 (139)
                      .|+.|+.|+.
T Consensus       420 ~~~~Cp~Cg~  429 (679)
T PRK05580        420 IPKACPECGS  429 (679)
T ss_pred             CCCCCCCCcC
Confidence            3567777754


No 159
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=35.37  E-value=28  Score=22.99  Aligned_cols=12  Identities=25%  Similarity=0.714  Sum_probs=7.3

Q ss_pred             CcccCCCCCccC
Q psy7353          81 KVFPCPVCGKEF   92 (139)
Q Consensus        81 ~~~~C~~C~~~f   92 (139)
                      ..+.|..||..+
T Consensus        29 ~lvrC~eCG~V~   40 (201)
T COG1326          29 PLVRCEECGTVH   40 (201)
T ss_pred             eEEEccCCCcEe
Confidence            356677776554


No 160
>KOG4118|consensus
Probab=34.92  E-value=11  Score=20.11  Aligned_cols=24  Identities=4%  Similarity=-0.103  Sum_probs=11.7

Q ss_pred             CCCCCCCCCCCCCcchhccccccc
Q psy7353         112 ATTPQGQRGQRASPVIDFHKDSVF  135 (139)
Q Consensus       112 ~~C~~C~~~f~~~~~l~~H~~~~~  135 (139)
                      |.|..|.....+.-.++-|+...|
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kH   62 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKH   62 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcC
Confidence            445555554444444444444444


No 161
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=34.82  E-value=20  Score=20.50  Aligned_cols=14  Identities=21%  Similarity=0.081  Sum_probs=9.4

Q ss_pred             CCCCCCCCCCCCCC
Q psy7353         110 MPATTPQGQRGQRA  123 (139)
Q Consensus       110 ~~~~C~~C~~~f~~  123 (139)
                      .|-.|..||+.|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            35677777777766


No 162
>KOG2636|consensus
Probab=34.59  E-value=19  Score=26.92  Aligned_cols=27  Identities=11%  Similarity=-0.027  Sum_probs=22.0

Q ss_pred             cCCCCCCCCCCCC-CCCCCCcchhcccc
Q psy7353         106 HDCFMPATTPQGQ-RGQRASPVIDFHKD  132 (139)
Q Consensus       106 h~~~~~~~C~~C~-~~f~~~~~l~~H~~  132 (139)
                      |+-...|.|.+|| +.+.=+-.+++|..
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            5666779999999 88888888888854


No 163
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=34.36  E-value=0.93  Score=21.47  Aligned_cols=10  Identities=0%  Similarity=-0.369  Sum_probs=6.3

Q ss_pred             CCCCCCCCCC
Q psy7353         112 ATTPQGQRGQ  121 (139)
Q Consensus       112 ~~C~~C~~~f  121 (139)
                      |.|..|+..|
T Consensus        29 y~C~~C~~~w   38 (39)
T PF01096_consen   29 YVCCNCGHRW   38 (39)
T ss_dssp             EEESSSTEEE
T ss_pred             EEeCCCCCee
Confidence            6676676554


No 164
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.30  E-value=8.9  Score=21.12  Aligned_cols=9  Identities=33%  Similarity=1.191  Sum_probs=4.7

Q ss_pred             eeecCCCCC
Q psy7353          54 VFPCPVCGK   62 (139)
Q Consensus        54 ~~~c~~C~~   62 (139)
                      .|.|..|+.
T Consensus        12 ~Y~c~~cg~   20 (82)
T COG2331          12 SYECTECGN   20 (82)
T ss_pred             EEeecccch
Confidence            355555554


No 165
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=33.86  E-value=24  Score=20.71  Aligned_cols=7  Identities=0%  Similarity=-0.182  Sum_probs=3.3

Q ss_pred             CCCCCCC
Q psy7353         112 ATTPQGQ  118 (139)
Q Consensus       112 ~~C~~C~  118 (139)
                      |.|+.|+
T Consensus        32 y~C~~C~   38 (102)
T PF11672_consen   32 YVCTPCD   38 (102)
T ss_pred             EECCCCC
Confidence            4454444


No 166
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=33.84  E-value=24  Score=21.09  Aligned_cols=10  Identities=30%  Similarity=0.786  Sum_probs=4.9

Q ss_pred             eecCCCCCcC
Q psy7353          55 FPCPVCGKEF   64 (139)
Q Consensus        55 ~~c~~C~~~~   64 (139)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (115)
T TIGR00100        71 CECEDCSEEV   80 (115)
T ss_pred             EEcccCCCEE
Confidence            4455555433


No 167
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=33.79  E-value=31  Score=20.22  Aligned_cols=9  Identities=22%  Similarity=0.785  Sum_probs=4.9

Q ss_pred             ceecCCCCC
Q psy7353          18 IYKCMECAK   26 (139)
Q Consensus        18 ~~~C~~c~~   26 (139)
                      |+.|..||.
T Consensus         2 pH~CtrCG~   10 (112)
T COG3364           2 PHQCTRCGE   10 (112)
T ss_pred             Cceeccccc
Confidence            445555555


No 168
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=33.37  E-value=21  Score=16.77  Aligned_cols=13  Identities=0%  Similarity=-0.391  Sum_probs=9.5

Q ss_pred             CCCCCCCCCCCCC
Q psy7353         111 PATTPQGQRGQRA  123 (139)
Q Consensus       111 ~~~C~~C~~~f~~  123 (139)
                      |+.|..|+..|=.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            7788888877643


No 169
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=33.23  E-value=40  Score=19.56  Aligned_cols=38  Identities=26%  Similarity=0.549  Sum_probs=12.3

Q ss_pred             CceeecCCCCCcCCChHHHHHHHHHhcCCC-cccCCCCCccCCCh
Q psy7353          52 RKVFPCPVCGKEFSRPDKMKNHMKTGCQRK-VFPCPVCGKEFSRP   95 (139)
Q Consensus        52 ~~~~~c~~C~~~~~~~~~l~~h~~~~~~~~-~~~C~~C~~~f~~~   95 (139)
                      .+.-.|..|+.++-...      .--.+++ .|.|..|-+.|...
T Consensus        12 ~ke~~CalCG~tWg~~y------~Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   12 TKEMGCALCGATWGDYY------EEVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             SGGGS-SS---S---SS-------B-TT--BSSS--SSSS-TTS-
T ss_pred             cccccccccCCcHHHHH------HhhcCCEEEEEcHHHHHHHHHH
Confidence            34446778876654321      1123334 45567777777654


No 170
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.18  E-value=18  Score=22.89  Aligned_cols=19  Identities=21%  Similarity=0.476  Sum_probs=11.5

Q ss_pred             CCCcccCCCCCccCCChhH
Q psy7353          79 QRKVFPCPVCGKEFSRPDK   97 (139)
Q Consensus        79 ~~~~~~C~~C~~~f~~~~~   97 (139)
                      .+.|..|..||+.|.|...
T Consensus        65 ~~~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CCCChhHHhCCCCCchHHH
Confidence            3456666667776666543


No 171
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=33.11  E-value=21  Score=22.46  Aligned_cols=19  Identities=0%  Similarity=-0.197  Sum_probs=14.5

Q ss_pred             CCCCCCCCCCCCCCCcchh
Q psy7353         110 MPATTPQGQRGQRASPVID  128 (139)
Q Consensus       110 ~~~~C~~C~~~f~~~~~l~  128 (139)
                      +--.|..|+++|++..-++
T Consensus        27 RRReC~~C~~RFTTyErve   45 (147)
T TIGR00244        27 RRRECLECHERFTTFERAE   45 (147)
T ss_pred             ecccCCccCCccceeeecc
Confidence            3468999999999875543


No 172
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=32.97  E-value=22  Score=16.78  Aligned_cols=12  Identities=17%  Similarity=0.030  Sum_probs=7.3

Q ss_pred             CCCCCCCCCCCC
Q psy7353         112 ATTPQGQRGQRA  123 (139)
Q Consensus       112 ~~C~~C~~~f~~  123 (139)
                      +.|+.|+..+.+
T Consensus        33 ~~C~~CGE~~~~   44 (46)
T TIGR03831        33 LVCPQCGEEYLD   44 (46)
T ss_pred             cccccCCCEeeC
Confidence            567777765543


No 173
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=32.94  E-value=15  Score=22.65  Aligned_cols=18  Identities=39%  Similarity=0.700  Sum_probs=8.7

Q ss_pred             cCCCCCccCCChhHHHhhhhh
Q psy7353          84 PCPVCGKEFSRPDKMKNHMKT  104 (139)
Q Consensus        84 ~C~~C~~~f~~~~~l~~H~~~  104 (139)
                      .|.++|+.|   -+|.+|+.+
T Consensus        78 icLEDGkkf---KSLKRHL~t   95 (148)
T COG4957          78 ICLEDGKKF---KSLKRHLTT   95 (148)
T ss_pred             EEeccCcch---HHHHHHHhc
Confidence            345555444   234555555


No 174
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=32.91  E-value=32  Score=20.61  Aligned_cols=10  Identities=30%  Similarity=0.903  Sum_probs=6.7

Q ss_pred             ccCCCCCccC
Q psy7353          83 FPCPVCGKEF   92 (139)
Q Consensus        83 ~~C~~C~~~f   92 (139)
                      +.|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            5677777554


No 175
>KOG4167|consensus
Probab=31.89  E-value=6.9  Score=31.05  Aligned_cols=25  Identities=44%  Similarity=0.832  Sum_probs=21.4

Q ss_pred             CcccCCCCCccCCChhHHHhhhhhh
Q psy7353          81 KVFPCPVCGKEFSRPDKMKNHMKTV  105 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~~  105 (139)
                      -.|.|.+|++.|.-.-++..||++|
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~H  815 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTH  815 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHH
Confidence            4689999999998888888888883


No 176
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.79  E-value=22  Score=18.70  Aligned_cols=9  Identities=33%  Similarity=1.231  Sum_probs=4.1

Q ss_pred             ceeecCCCC
Q psy7353          53 KVFPCPVCG   61 (139)
Q Consensus        53 ~~~~c~~C~   61 (139)
                      +.|-|+.|.
T Consensus        30 rtymC~eC~   38 (68)
T COG4896          30 RTYMCPECE   38 (68)
T ss_pred             eeEechhhH
Confidence            334454443


No 177
>PF12773 DZR:  Double zinc ribbon
Probab=31.74  E-value=53  Score=15.95  Aligned_cols=10  Identities=10%  Similarity=0.062  Sum_probs=6.8

Q ss_pred             CCCCCCCCCC
Q psy7353         111 PATTPQGQRG  120 (139)
Q Consensus       111 ~~~C~~C~~~  120 (139)
                      ...|+.|+..
T Consensus        29 ~~~C~~Cg~~   38 (50)
T PF12773_consen   29 KKICPNCGAE   38 (50)
T ss_pred             CCCCcCCcCC
Confidence            4577777765


No 178
>COG1773 Rubredoxin [Energy production and conversion]
Probab=31.61  E-value=14  Score=19.00  Aligned_cols=10  Identities=0%  Similarity=-0.502  Sum_probs=5.8

Q ss_pred             CCCCCCCCCC
Q psy7353         112 ATTPQGQRGQ  121 (139)
Q Consensus       112 ~~C~~C~~~f  121 (139)
                      |+|..|++.|
T Consensus         4 ~~C~~CG~vY   13 (55)
T COG1773           4 WRCSVCGYVY   13 (55)
T ss_pred             eEecCCceEe
Confidence            5666666544


No 179
>KOG1842|consensus
Probab=31.51  E-value=26  Score=26.28  Aligned_cols=29  Identities=17%  Similarity=0.171  Sum_probs=23.7

Q ss_pred             cceecCCCCCcchhcccCCHHHHHHHHHHhccCC
Q psy7353          17 GIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGC   50 (139)
Q Consensus        17 ~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~   50 (139)
                      .-|.||.|..     .|.+...|..|....|.++
T Consensus        14 egflCPiC~~-----dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLL-----DLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhh-----hhhhHHHHHHHHhhhcccc
Confidence            3478999998     8999999999987777663


No 180
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=31.38  E-value=20  Score=17.99  Aligned_cols=11  Identities=0%  Similarity=-0.508  Sum_probs=7.4

Q ss_pred             CCCCCCCCCCC
Q psy7353         112 ATTPQGQRGQR  122 (139)
Q Consensus       112 ~~C~~C~~~f~  122 (139)
                      |.|..|++.+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            66777776654


No 181
>KOG2071|consensus
Probab=31.01  E-value=25  Score=27.24  Aligned_cols=28  Identities=14%  Similarity=-0.188  Sum_probs=23.6

Q ss_pred             CCCCCCCCCCCCCCCCCcchhccccccc
Q psy7353         108 CFMPATTPQGQRGQRASPVIDFHKDSVF  135 (139)
Q Consensus       108 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~  135 (139)
                      ..+|-.|.-||.+|.......+|++.|-
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            4677899999999999998888877664


No 182
>KOG0978|consensus
Probab=30.62  E-value=40  Score=26.91  Aligned_cols=19  Identities=16%  Similarity=0.085  Sum_probs=12.6

Q ss_pred             CCCCCCCCCCCCCCCcchh
Q psy7353         110 MPATTPQGQRGQRASPVID  128 (139)
Q Consensus       110 ~~~~C~~C~~~f~~~~~l~  128 (139)
                      +.-.||.|+..|...+-+.
T Consensus       677 RqRKCP~Cn~aFganDv~~  695 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHR  695 (698)
T ss_pred             hcCCCCCCCCCCCcccccc
Confidence            3457888888887665443


No 183
>PHA02998 RNA polymerase subunit; Provisional
Probab=30.61  E-value=12  Score=24.33  Aligned_cols=36  Identities=14%  Similarity=0.242  Sum_probs=18.9

Q ss_pred             ccCCCCCccCCChhHHHhhhhhhcCCCC---CCCCCCCCCCCC
Q psy7353          83 FPCPVCGKEFSRPDKMKNHMKTVHDCFM---PATTPQGQRGQR  122 (139)
Q Consensus        83 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~---~~~C~~C~~~f~  122 (139)
                      ..|+.|+..=....  +..++.  ++|.   -|.|..|+..|.
T Consensus       144 v~CPkCg~~~A~f~--qlQTRS--ADEPmT~FYkC~~CG~~wk  182 (195)
T PHA02998        144 TPCPNCKSKNTTPM--MIQTRA--ADEPPLVRHACRDCKKHFK  182 (195)
T ss_pred             CCCCCCCCCceEEE--EEeecc--CCCCceEEEEcCCCCCccC
Confidence            46888875322222  222222  2222   278988987664


No 184
>KOG4167|consensus
Probab=30.57  E-value=13  Score=29.72  Aligned_cols=25  Identities=36%  Similarity=0.583  Sum_probs=19.0

Q ss_pred             CcceecCCCCCcchhcccCCHHHHHHHHHH
Q psy7353          16 EGIYKCMECAKVDVIKTFKNKYSFQRHAFL   45 (139)
Q Consensus        16 ~~~~~C~~c~~~~~~~~f~~~~~l~~h~~~   45 (139)
                      .+.|.|.+|++     .|.....+..||..
T Consensus       790 ~giFpCreC~k-----vF~KiKSrNAHMK~  814 (907)
T KOG4167|consen  790 TGIFPCRECGK-----VFFKIKSRNAHMKT  814 (907)
T ss_pred             CceeehHHHHH-----HHHHHhhhhHHHHH
Confidence            56788888888     67777777777765


No 185
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=30.54  E-value=24  Score=22.34  Aligned_cols=17  Identities=0%  Similarity=-0.283  Sum_probs=13.1

Q ss_pred             CCCCCCCCCCCCCCcch
Q psy7353         111 PATTPQGQRGQRASPVI  127 (139)
Q Consensus       111 ~~~C~~C~~~f~~~~~l  127 (139)
                      --.|+.|+.+|++..-.
T Consensus        28 RReC~~C~~RFTTfE~~   44 (156)
T COG1327          28 RRECLECGERFTTFERA   44 (156)
T ss_pred             hhcccccccccchhhee
Confidence            46899999999986443


No 186
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=30.51  E-value=24  Score=26.71  Aligned_cols=39  Identities=13%  Similarity=0.171  Sum_probs=22.6

Q ss_pred             CCcccCCCCCccCCChhHHHhhhhhhcCC----CC--CCCCCCCCCC
Q psy7353          80 RKVFPCPVCGKEFSRPDKMKNHMKTVHDC----FM--PATTPQGQRG  120 (139)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~~~h~~----~~--~~~C~~C~~~  120 (139)
                      ...|.|..|+..|....--... .+ -+|    +.  .|.||.|+..
T Consensus       423 ~~~~~c~~c~~~yd~~~g~~~~-~~-~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        423 GPRMQCSVCQWIYDPAKGEPMQ-DV-APGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             CCeEEECCCCeEECCCCCCccc-CC-CCCCChhhCCCCCcCcCCCCc
Confidence            4568999999887654211111 11 121    22  3899999975


No 187
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.47  E-value=31  Score=21.04  Aligned_cols=16  Identities=25%  Similarity=0.503  Sum_probs=9.9

Q ss_pred             CCcccCCCCCccCCCh
Q psy7353          80 RKVFPCPVCGKEFSRP   95 (139)
Q Consensus        80 ~~~~~C~~C~~~f~~~   95 (139)
                      +.|--|.-||+.|.+.
T Consensus        66 e~psfchncgs~fpwt   81 (160)
T COG4306          66 EPPSFCHNCGSRFPWT   81 (160)
T ss_pred             CCcchhhcCCCCCCcH
Confidence            3455566677777665


No 188
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=30.44  E-value=64  Score=22.71  Aligned_cols=25  Identities=16%  Similarity=0.254  Sum_probs=16.8

Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCC
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQ  121 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f  121 (139)
                      -|.|+.|...|...               |-.|+.|+-.|
T Consensus       255 GyvCs~Clsi~C~~---------------p~~C~~Cgt~f  279 (279)
T TIGR00627       255 GFVCSVCLSVLCQY---------------TPICKTCKTAF  279 (279)
T ss_pred             eEECCCccCCcCCC---------------CCCCCCCCCCC
Confidence            38888887766432               12788888765


No 189
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=29.17  E-value=34  Score=21.67  Aligned_cols=34  Identities=12%  Similarity=0.203  Sum_probs=20.6

Q ss_pred             CcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCC
Q psy7353          81 KVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRG  120 (139)
Q Consensus        81 ~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~  120 (139)
                      -+|.|. |+..|...   .+|-.. -.|+ .|.|..|+..
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~-~~g~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTV-RRGE-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchh---hhcccc-cccc-eEEeccCCce
Confidence            468888 88665433   233332 3445 7888888754


No 190
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=28.78  E-value=34  Score=17.10  Aligned_cols=20  Identities=15%  Similarity=0.102  Sum_probs=12.3

Q ss_pred             CCCCCCCCCCCCCCcchhccccc
Q psy7353         111 PATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus       111 ~~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      +=.|+.|...|.   +|..|+.+
T Consensus         5 ~GYCE~C~~ky~---~l~~Hi~s   24 (49)
T PF07535_consen    5 PGYCENCRVKYD---DLEEHIQS   24 (49)
T ss_pred             CccCccccchhh---hHHHHhCC
Confidence            345777777665   36666654


No 191
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=28.66  E-value=16  Score=22.96  Aligned_cols=9  Identities=33%  Similarity=1.025  Sum_probs=5.4

Q ss_pred             eeecCCCCC
Q psy7353          54 VFPCPVCGK   62 (139)
Q Consensus        54 ~~~c~~C~~   62 (139)
                      .+.|..|+.
T Consensus       112 ~l~C~~Cg~  120 (146)
T PF07295_consen  112 TLVCENCGH  120 (146)
T ss_pred             eEecccCCC
Confidence            456666664


No 192
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=28.32  E-value=46  Score=15.49  Aligned_cols=15  Identities=13%  Similarity=0.147  Sum_probs=7.6

Q ss_pred             CCCCCCCCCCCCcch
Q psy7353         113 TTPQGQRGQRASPVI  127 (139)
Q Consensus       113 ~C~~C~~~f~~~~~l  127 (139)
                      .|+.|+++|-...+-
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            466777776655443


No 193
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=27.87  E-value=31  Score=16.06  Aligned_cols=10  Identities=40%  Similarity=1.129  Sum_probs=5.4

Q ss_pred             cceecCCCCC
Q psy7353          17 GIYKCMECAK   26 (139)
Q Consensus        17 ~~~~C~~c~~   26 (139)
                      ..|+|..||+
T Consensus         5 ~~YkC~~CGn   14 (36)
T PF06397_consen    5 EFYKCEHCGN   14 (36)
T ss_dssp             EEEE-TTT--
T ss_pred             cEEEccCCCC
Confidence            4688888887


No 194
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=27.43  E-value=34  Score=17.55  Aligned_cols=18  Identities=17%  Similarity=0.525  Sum_probs=9.5

Q ss_pred             cccCCCCCccCCChhHHH
Q psy7353          82 VFPCPVCGKEFSRPDKMK   99 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~   99 (139)
                      .+-|--||..|.+...|.
T Consensus        27 ~~YC~~Cg~~Y~d~~dL~   44 (55)
T PF13821_consen   27 HNYCFWCGTKYDDEEDLE   44 (55)
T ss_pred             CceeeeeCCccCCHHHHH
Confidence            344555555555555543


No 195
>PTZ00448 hypothetical protein; Provisional
Probab=27.06  E-value=25  Score=25.69  Aligned_cols=23  Identities=9%  Similarity=-0.133  Sum_probs=19.4

Q ss_pred             CCCCCCCCCCCCCCcchhccccc
Q psy7353         111 PATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus       111 ~~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      .|.|..|+..|.+....+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            68899999999888888888665


No 196
>PRK12496 hypothetical protein; Provisional
Probab=26.53  E-value=63  Score=20.67  Aligned_cols=11  Identities=27%  Similarity=0.691  Sum_probs=8.0

Q ss_pred             ccCCCCCccCC
Q psy7353          83 FPCPVCGKEFS   93 (139)
Q Consensus        83 ~~C~~C~~~f~   93 (139)
                      |.|..|++.|.
T Consensus       128 ~~C~gC~~~~~  138 (164)
T PRK12496        128 KVCKGCKKKYP  138 (164)
T ss_pred             EECCCCCcccc
Confidence            67888887663


No 197
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=26.40  E-value=22  Score=17.81  Aligned_cols=21  Identities=14%  Similarity=0.063  Sum_probs=12.0

Q ss_pred             CCCCCCCCCCCCCCCcchhccccc
Q psy7353         110 MPATTPQGQRGQRASPVIDFHKDS  133 (139)
Q Consensus       110 ~~~~C~~C~~~f~~~~~l~~H~~~  133 (139)
                      +|=.|+.|...|.   .|..|+.+
T Consensus         4 k~GYCE~Cr~kfd---~l~~Hi~s   24 (49)
T smart00586        4 KPGYCENCREKYD---DLETHLLS   24 (49)
T ss_pred             CCcccccHhHHHh---hHHHHhcc
Confidence            4446777776654   35555543


No 198
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=25.96  E-value=20  Score=18.02  Aligned_cols=10  Identities=20%  Similarity=0.109  Sum_probs=3.6

Q ss_pred             CCCCCCCCCC
Q psy7353         113 TTPQGQRGQR  122 (139)
Q Consensus       113 ~C~~C~~~f~  122 (139)
                      .||.|+..|.
T Consensus        22 ~CPlC~r~l~   31 (54)
T PF04423_consen   22 CCPLCGRPLD   31 (54)
T ss_dssp             E-TTT--EE-
T ss_pred             cCCCCCCCCC
Confidence            5666666553


No 199
>PRK06260 threonine synthase; Validated
Probab=25.69  E-value=54  Score=24.12  Aligned_cols=12  Identities=33%  Similarity=1.054  Sum_probs=7.6

Q ss_pred             CCcccCCCCCcc
Q psy7353          80 RKVFPCPVCGKE   91 (139)
Q Consensus        80 ~~~~~C~~C~~~   91 (139)
                      +..+.|+.|+..
T Consensus        17 ~~~~~Cp~cg~~   28 (397)
T PRK06260         17 EIIYTCPECGGL   28 (397)
T ss_pred             CccccCCCCCCe
Confidence            345678778654


No 200
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=25.60  E-value=19  Score=16.46  Aligned_cols=11  Identities=45%  Similarity=1.153  Sum_probs=6.4

Q ss_pred             CceeecCCCCC
Q psy7353          52 RKVFPCPVCGK   62 (139)
Q Consensus        52 ~~~~~c~~C~~   62 (139)
                      ...+.|+.|+.
T Consensus        20 r~R~vC~~Cg~   30 (34)
T PF14803_consen   20 RERLVCPACGF   30 (34)
T ss_dssp             S-EEEETTTTE
T ss_pred             ccceECCCCCC
Confidence            44566777764


No 201
>KOG4727|consensus
Probab=25.59  E-value=34  Score=22.15  Aligned_cols=22  Identities=18%  Similarity=0.427  Sum_probs=19.4

Q ss_pred             cccCCCCCccCCChhHHHhhhh
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMK  103 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~  103 (139)
                      -|.|.+|+-.+.+..++..|+.
T Consensus        75 GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   75 GYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ceeeeecceeehhhHHHHHHhc
Confidence            4889999999999999998875


No 202
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=25.50  E-value=80  Score=21.88  Aligned_cols=10  Identities=30%  Similarity=1.022  Sum_probs=6.5

Q ss_pred             CceeecCCCC
Q psy7353          52 RKVFPCPVCG   61 (139)
Q Consensus        52 ~~~~~c~~C~   61 (139)
                      .+.|.|..|.
T Consensus       110 drqFaC~~Cd  119 (278)
T PF15135_consen  110 DRQFACSSCD  119 (278)
T ss_pred             ceeeeccccc
Confidence            3567777775


No 203
>PF14369 zf-RING_3:  zinc-finger
Probab=25.47  E-value=37  Score=15.56  Aligned_cols=10  Identities=20%  Similarity=0.315  Sum_probs=6.9

Q ss_pred             CCCCCCCCCC
Q psy7353         113 TTPQGQRGQR  122 (139)
Q Consensus       113 ~C~~C~~~f~  122 (139)
                      .|+.|+-+|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5777777764


No 204
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=25.23  E-value=45  Score=23.17  Aligned_cols=32  Identities=28%  Similarity=0.418  Sum_probs=19.7

Q ss_pred             cCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCCC
Q psy7353          84 PCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRAS  124 (139)
Q Consensus        84 ~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~  124 (139)
                      .|+.||.....         ....+-..|.|+.|+..+..+
T Consensus       237 pC~~Cg~~I~~---------~~~~gR~ty~Cp~CQ~~~~~~  268 (269)
T PRK14811        237 PCPRCGTPIEK---------IVVGGRGTHFCPQCQPLRPLR  268 (269)
T ss_pred             CCCcCCCeeEE---------EEECCCCcEECCCCcCCCCCC
Confidence            57778744211         113445568999999876543


No 205
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=24.82  E-value=40  Score=17.31  Aligned_cols=14  Identities=7%  Similarity=0.024  Sum_probs=8.3

Q ss_pred             CCCCCCCCCCCCcc
Q psy7353         113 TTPQGQRGQRASPV  126 (139)
Q Consensus       113 ~C~~C~~~f~~~~~  126 (139)
                      .|+.|+..|....+
T Consensus         7 ~C~~Cg~~~~~~dD   20 (54)
T PF14446_consen    7 KCPVCGKKFKDGDD   20 (54)
T ss_pred             cChhhCCcccCCCC
Confidence            56667766654433


No 206
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=24.76  E-value=35  Score=21.18  Aligned_cols=32  Identities=9%  Similarity=0.224  Sum_probs=17.4

Q ss_pred             cccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCC
Q psy7353          82 VFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQ  121 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f  121 (139)
                      .|.|..|+..+.      ++.+  +.....|.|..|+-.+
T Consensus       112 ~y~C~~C~~~~~------~~rr--~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RVRR--SNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eEcc--ccCcceEEcCCCCCEE
Confidence            567777776543      2222  1222457777777654


No 207
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=24.64  E-value=1.6e+02  Score=17.28  Aligned_cols=42  Identities=17%  Similarity=0.416  Sum_probs=29.4

Q ss_pred             cceecCCCCCcchhcccCCHHHHHHHHHHhccCCCCceeecCCCCCcCCCh
Q psy7353          17 GIYKCMECAKVDVIKTFKNKYSFQRHAFLYHEGCQRKVFPCPVCGKEFSRP   67 (139)
Q Consensus        17 ~~~~C~~c~~~~~~~~f~~~~~l~~h~~~~~~~~~~~~~~c~~C~~~~~~~   67 (139)
                      ..|.|+.-|.     .|.+...+-..+....    .+-|.|...|+.-...
T Consensus         2 eVf~i~~T~E-----iF~dYe~Y~~R~~~y~----~~vwtC~~TGk~~LTy   43 (102)
T PF10537_consen    2 EVFYIPFTGE-----IFRDYEEYLKRMILYN----QRVWTCEITGKSNLTY   43 (102)
T ss_pred             ceEEeCCCCc-----ccCCHHHHHHHHHHHh----CCeeEEecCCCCCCCH
Confidence            3577888887     8998887766655433    5678999888754444


No 208
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=23.68  E-value=53  Score=19.56  Aligned_cols=9  Identities=22%  Similarity=0.538  Sum_probs=5.6

Q ss_pred             ccCCCCCcc
Q psy7353          83 FPCPVCGKE   91 (139)
Q Consensus        83 ~~C~~C~~~   91 (139)
                      +.|..|+..
T Consensus        71 ~~C~~Cg~~   79 (114)
T PRK03681         71 CWCETCQQY   79 (114)
T ss_pred             EEcccCCCe
Confidence            567777653


No 210
>KOG1842|consensus
Probab=23.61  E-value=41  Score=25.32  Aligned_cols=31  Identities=19%  Similarity=0.462  Sum_probs=24.5

Q ss_pred             CCCCceeecCCCCCcCCChHHHHHHHHHhcC
Q psy7353          49 GCQRKVFPCPVCGKEFSRPDKMKNHMKTGCQ   79 (139)
Q Consensus        49 ~~~~~~~~c~~C~~~~~~~~~l~~h~~~~~~   79 (139)
                      +.....|.||+|...|.....|..|....+.
T Consensus        10 ~~i~egflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   10 GEILEGFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             chhhhcccCchHhhhhhhHHHHHHHHhhhcc
Confidence            3335678999999999999999999876554


No 211
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=23.55  E-value=45  Score=20.55  Aligned_cols=15  Identities=27%  Similarity=0.722  Sum_probs=11.1

Q ss_pred             cccCCCCCccCCChh
Q psy7353          82 VFPCPVCGKEFSRPD   96 (139)
Q Consensus        82 ~~~C~~C~~~f~~~~   96 (139)
                      |..|..||..|.+.+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            457888888887665


No 212
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.52  E-value=28  Score=18.36  Aligned_cols=46  Identities=13%  Similarity=0.055  Sum_probs=24.0

Q ss_pred             HHHHhcCCCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCCCCCCC
Q psy7353          73 HMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQRGQRA  123 (139)
Q Consensus        73 h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~  123 (139)
                      +...+.++.++.|+.=+..|..+.-+   +-  -..+..-.|+.|+.+|+.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~---L~--mg~~gev~CPYC~t~y~l   60 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVF---LD--MGDEGEVVCPYCSTRYRL   60 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEE---EE--cCCCCcEecCccccEEEe
Confidence            34455566777776544333322111   11  122334588889888764


No 213
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=23.40  E-value=46  Score=20.39  Aligned_cols=16  Identities=0%  Similarity=-0.242  Sum_probs=11.0

Q ss_pred             CCCCCCCCCCCCCCCC
Q psy7353         109 FMPATTPQGQRGQRAS  124 (139)
Q Consensus       109 ~~~~~C~~C~~~f~~~  124 (139)
                      ...|.|..|++.|+..
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4457788888777654


No 214
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=23.38  E-value=43  Score=16.57  Aligned_cols=10  Identities=10%  Similarity=-0.127  Sum_probs=5.7

Q ss_pred             CCCCCCCCCC
Q psy7353         111 PATTPQGQRG  120 (139)
Q Consensus       111 ~~~C~~C~~~  120 (139)
                      -|.|+.|+..
T Consensus        34 ~w~CP~C~a~   43 (47)
T PF00301_consen   34 DWVCPVCGAP   43 (47)
T ss_dssp             T-B-TTTSSB
T ss_pred             CCcCcCCCCc
Confidence            3888888764


No 215
>PLN02294 cytochrome c oxidase subunit Vb
Probab=23.06  E-value=45  Score=21.57  Aligned_cols=11  Identities=18%  Similarity=0.709  Sum_probs=9.1

Q ss_pred             CcceecCCCCC
Q psy7353          16 EGIYKCMECAK   26 (139)
Q Consensus        16 ~~~~~C~~c~~   26 (139)
                      .++.+|++||.
T Consensus       139 Gkp~RCpeCG~  149 (174)
T PLN02294        139 GKSFECPVCTQ  149 (174)
T ss_pred             CCceeCCCCCC
Confidence            46888999997


No 216
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=23.04  E-value=19  Score=18.63  Aligned_cols=36  Identities=14%  Similarity=0.393  Sum_probs=16.1

Q ss_pred             ecCCCCCcCCChHHHHHHHH-HhcCCCcccCCCCCcc
Q psy7353          56 PCPVCGKEFSRPDKMKNHMK-TGCQRKVFPCPVCGKE   91 (139)
Q Consensus        56 ~c~~C~~~~~~~~~l~~h~~-~~~~~~~~~C~~C~~~   91 (139)
                      .|..|++.+........-.+ .......|.|..|...
T Consensus         4 kC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             EEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            56667654433322111111 2223345777777543


No 217
>PLN02748 tRNA dimethylallyltransferase
Probab=23.00  E-value=36  Score=25.85  Aligned_cols=25  Identities=12%  Similarity=-0.020  Sum_probs=20.9

Q ss_pred             CCCCCCCCCC-CCCCCcchhcccccc
Q psy7353         110 MPATTPQGQR-GQRASPVIDFHKDSV  134 (139)
Q Consensus       110 ~~~~C~~C~~-~f~~~~~l~~H~~~~  134 (139)
                      +.|.|+.|+. .+.-...+..|++++
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlksr  442 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQGR  442 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcch
Confidence            5688999997 788888899998764


No 218
>KOG1994|consensus
Probab=22.72  E-value=40  Score=22.93  Aligned_cols=24  Identities=17%  Similarity=0.552  Sum_probs=20.1

Q ss_pred             CCcccCCCCCccCCChhHHHhhhh
Q psy7353          80 RKVFPCPVCGKEFSRPDKMKNHMK  103 (139)
Q Consensus        80 ~~~~~C~~C~~~f~~~~~l~~H~~  103 (139)
                      .-.|.|..||..|.+..+|..|-.
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehCP  260 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHCP  260 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhCC
Confidence            456889999999999999988843


No 219
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=22.63  E-value=32  Score=24.39  Aligned_cols=32  Identities=19%  Similarity=0.364  Sum_probs=18.4

Q ss_pred             eecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCCh
Q psy7353          55 FPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRP   95 (139)
Q Consensus        55 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   95 (139)
                      .+|+.|+..+.... |        .+..+.|+.|+.-|.-.
T Consensus        39 ~kc~~C~~~~~~~~-l--------~~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         39 VQCENCYGLNYKKF-L--------KSKMNICEQCGYHLKMS   70 (296)
T ss_pred             eECCCccchhhHHH-H--------HHcCCCCCCCCCCcCCC
Confidence            35887875433221 1        12346888888766544


No 220
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=21.63  E-value=50  Score=19.19  Aligned_cols=10  Identities=30%  Similarity=0.740  Sum_probs=8.8

Q ss_pred             cceecCCCCC
Q psy7353          17 GIYKCMECAK   26 (139)
Q Consensus        17 ~~~~C~~c~~   26 (139)
                      .+.+|++||.
T Consensus        78 ~~~rC~eCG~   87 (97)
T cd00924          78 KPKRCPECGH   87 (97)
T ss_pred             CceeCCCCCc
Confidence            6889999997


No 221
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=21.47  E-value=24  Score=23.08  Aligned_cols=37  Identities=16%  Similarity=0.457  Sum_probs=16.2

Q ss_pred             HHHHHHHHhcCCCcccCCC----CCccCCChhHHHhhhhhhcC
Q psy7353          69 KMKNHMKTGCQRKVFPCPV----CGKEFSRPDKMKNHMKTVHD  107 (139)
Q Consensus        69 ~l~~h~~~~~~~~~~~C~~----C~~~f~~~~~l~~H~~~~h~  107 (139)
                      ....|.... .-+|+.|+.    |+.. -....|..|....|.
T Consensus        32 ~~~~HE~~C-~~~p~~CP~~~~~C~~~-G~~~~l~~Hl~~~H~   72 (198)
T PF03145_consen   32 EKREHEEEC-PFRPCSCPFPGSGCDWQ-GSYKELLDHLRDKHS   72 (198)
T ss_dssp             GHHHHHHT--TTSEEE-SSSSTT---E-EECCCHHHHHHHHTT
T ss_pred             ChhhHhccC-CCcCCcCCCCCCCcccc-CCHHHHHHHHHHHCC
Confidence            444555432 235666655    4321 123356677766564


No 222
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=21.42  E-value=43  Score=15.89  Aligned_cols=13  Identities=15%  Similarity=0.000  Sum_probs=9.4

Q ss_pred             CCCCCCCCCCCCC
Q psy7353         112 ATTPQGQRGQRAS  124 (139)
Q Consensus       112 ~~C~~C~~~f~~~  124 (139)
                      -.|+.|+..|...
T Consensus        14 ~~C~~CgM~Y~~~   26 (41)
T PF13878_consen   14 TTCPTCGMLYSPG   26 (41)
T ss_pred             cCCCCCCCEECCC
Confidence            5889999766543


No 223
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=21.30  E-value=32  Score=20.09  Aligned_cols=9  Identities=67%  Similarity=1.774  Sum_probs=5.1

Q ss_pred             ceeecCCCC
Q psy7353          53 KVFPCPVCG   61 (139)
Q Consensus        53 ~~~~c~~C~   61 (139)
                      ..|.|+.|+
T Consensus        20 t~f~CP~Cg   28 (99)
T PRK14892         20 KIFECPRCG   28 (99)
T ss_pred             cEeECCCCC
Confidence            345666665


No 224
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=21.19  E-value=40  Score=24.55  Aligned_cols=27  Identities=11%  Similarity=-0.112  Sum_probs=22.1

Q ss_pred             cCCCCCCCCCCCC-CCCCCCcchhcccc
Q psy7353         106 HDCFMPATTPQGQ-RGQRASPVIDFHKD  132 (139)
Q Consensus       106 h~~~~~~~C~~C~-~~f~~~~~l~~H~~  132 (139)
                      |+-++.|.|.+|+ +.+.-+..+++|..
T Consensus       369 hgLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         369 HGLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             cCCCcceeeeecccccccchHHHHhhhh
Confidence            6667779999999 88888888888853


No 225
>PRK12860 transcriptional activator FlhC; Provisional
Probab=21.10  E-value=84  Score=20.75  Aligned_cols=46  Identities=20%  Similarity=0.299  Sum_probs=26.3

Q ss_pred             cCCChHHHHHHHHHhcCCCcccCCCCCccCCChhHHHhhhhhhcCCCCCCCCCCCC
Q psy7353          63 EFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRPDKMKNHMKTVHDCFMPATTPQGQ  118 (139)
Q Consensus        63 ~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~  118 (139)
                      .+...+.|....... .-....|..||-.|....         +.....|.|+.|.
T Consensus       116 s~tRAw~LvRf~~s~-~L~l~~C~~Cgg~fv~~~---------~e~~~~f~CplC~  161 (189)
T PRK12860        116 DLTRAWTLVRFFDAG-MLQLARCCRCGGKFVTHA---------HDLRHNFVCGLCQ  161 (189)
T ss_pred             cHHHHHHHHHHhcCC-CeeeccCCCCCCCeeccc---------cccCCCCcCCCCC
Confidence            344555555544422 123467888988776332         1222368999987


No 226
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.92  E-value=36  Score=16.97  Aligned_cols=16  Identities=44%  Similarity=0.866  Sum_probs=9.6

Q ss_pred             cCCCCCccCCChhHHH
Q psy7353          84 PCPVCGKEFSRPDKMK   99 (139)
Q Consensus        84 ~C~~C~~~f~~~~~l~   99 (139)
                      .|++|+.-|++...+.
T Consensus        14 ICpvCqRPFsWRkKW~   29 (54)
T COG4338          14 ICPVCQRPFSWRKKWA   29 (54)
T ss_pred             hhhhhcCchHHHHHHH
Confidence            4667777776654443


No 227
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=20.73  E-value=20  Score=21.45  Aligned_cols=11  Identities=9%  Similarity=-0.142  Sum_probs=8.7

Q ss_pred             CCCCCCCCCCC
Q psy7353         112 ATTPQGQRGQR  122 (139)
Q Consensus       112 ~~C~~C~~~f~  122 (139)
                      |.|..|+..++
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            88888888765


No 228
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=20.71  E-value=41  Score=24.08  Aligned_cols=23  Identities=4%  Similarity=-0.191  Sum_probs=15.7

Q ss_pred             CCCCCCCCCCCCCCCcchhcccc
Q psy7353         110 MPATTPQGQRGQRASPVIDFHKD  132 (139)
Q Consensus       110 ~~~~C~~C~~~f~~~~~l~~H~~  132 (139)
                      ..|+|+.|...|-...+.--|..
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~  409 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHET  409 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHH
Confidence            45888888887776666555544


No 229
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=20.35  E-value=1e+02  Score=15.21  Aligned_cols=12  Identities=33%  Similarity=0.894  Sum_probs=6.2

Q ss_pred             ccCCCCCccCCC
Q psy7353          83 FPCPVCGKEFSR   94 (139)
Q Consensus        83 ~~C~~C~~~f~~   94 (139)
                      ..|..||..|-.
T Consensus        19 ~~Cr~Cg~~~C~   30 (57)
T cd00065          19 HHCRNCGRIFCS   30 (57)
T ss_pred             cccCcCcCCcCh
Confidence            445555555443


No 230
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=20.16  E-value=38  Score=23.85  Aligned_cols=32  Identities=25%  Similarity=0.718  Sum_probs=19.1

Q ss_pred             eecCCCCCcCCChHHHHHHHHHhcCCCcccCCCCCccCCCh
Q psy7353          55 FPCPVCGKEFSRPDKMKNHMKTGCQRKVFPCPVCGKEFSRP   95 (139)
Q Consensus        55 ~~c~~C~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~   95 (139)
                      ..|+.|+..+.... |.        ...+.|+.|+.-|.-.
T Consensus        27 ~~c~~c~~~~~~~~-l~--------~~~~vc~~c~~h~rl~   58 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-LE--------RNLEVCPKCDHHMRMD   58 (285)
T ss_pred             eECCCCcchhhHHH-HH--------hhCCCCCCCCCcCcCC
Confidence            46888876533322 11        2346899999876544


No 231
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=20.01  E-value=56  Score=15.47  Aligned_cols=9  Identities=11%  Similarity=0.110  Sum_probs=5.4

Q ss_pred             CCCCCCCCC
Q psy7353         112 ATTPQGQRG  120 (139)
Q Consensus       112 ~~C~~C~~~  120 (139)
                      |.|+.|+..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            456666654


Done!