Query         psy7374
Match_columns 106
No_of_seqs    131 out of 360
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 16:37:30 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7374.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7374hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3586|consensus               99.5 1.2E-14 2.6E-19  123.3   5.3   34   72-105    77-110 (437)
  2 KOG3585|consensus               99.1 6.5E-11 1.4E-15   96.7   3.9   35   72-106    22-56  (328)
  3 TIGR01552 phd_fam prevent-host  41.9      24 0.00052   20.7   2.0   23   82-105    12-34  (52)
  4 COG3967 DltE Short-chain dehyd  37.7      23  0.0005   29.2   1.8   21   82-104    19-39  (245)
  5 PF04001 Vhr1:  Transcription f  22.4      19  0.0004   26.0  -1.0   21   76-96     15-35  (95)
  6 PF11733 NP1-WLL:  Non-capsid p  17.6      52  0.0011   23.6   0.4   29   12-40     10-42  (94)
  7 PF10419 TFIIIC_sub6:  TFIIIC s  13.8      89  0.0019   18.2   0.7    9   90-98     27-35  (35)
  8 PF08495 FIST:  FIST N domain;   13.0      61  0.0013   22.8  -0.2   27   76-105   165-192 (198)
  9 PF15000 TUSC2:  Tumour suppres  11.8 1.1E+02  0.0024   22.6   0.8   21   79-103    56-76  (111)
 10 PF06881 Elongin_A:  RNA polyme  11.5 1.1E+02  0.0025   20.9   0.8   18   74-91     31-48  (109)

No 1  
>KOG3586|consensus
Probab=99.52  E-value=1.2e-14  Score=123.32  Aligned_cols=34  Identities=65%  Similarity=1.175  Sum_probs=32.8

Q ss_pred             ccceeeeecCHHHHHHHHccCceeeeeCCCccCC
Q psy7374          72 LRHVTCHLETKELWDKFNELGTEMIITKTGRKLF  105 (106)
Q Consensus        72 ~~~i~v~Le~~~LW~~Fh~lgtEMIITKsGRRMF  105 (106)
                      ...|.|.||.++||++||++||||||||+|||||
T Consensus        77 ~a~i~~~Le~keLWdrFh~lGTEMIITKsGRRMF  110 (437)
T KOG3586|consen   77 LAPIQVQLETKELWDRFHDLGTEMIITKSGRRMF  110 (437)
T ss_pred             ccceEEEeehHHHHHHHHhcCceEEEeccccccc
Confidence            5689999999999999999999999999999999


No 2  
>KOG3585|consensus
Probab=99.09  E-value=6.5e-11  Score=96.70  Aligned_cols=35  Identities=54%  Similarity=0.944  Sum_probs=32.6

Q ss_pred             ccceeeeecCHHHHHHHHccCceeeeeCCCccCCC
Q psy7374          72 LRHVTCHLETKELWDKFNELGTEMIITKTGRKLFQ  106 (106)
Q Consensus        72 ~~~i~v~Le~~~LW~~Fh~lgtEMIITKsGRRMF~  106 (106)
                      ...|+|+|++.+||++||.++|||||||.|||||.
T Consensus        22 ~~~~~v~l~~~eLW~~fh~~~~EmiitK~GRrmFP   56 (328)
T KOG3585|consen   22 PIQVKVSLENRELWKKFHEHGTEMIVTKRGRRMFP   56 (328)
T ss_pred             CcccEEEEechhHHHhhccCccEEEEecCCceecc
Confidence            34599999999999999999999999999999994


No 3  
>TIGR01552 phd_fam prevent-host-death family protein. This model recognizes a region of about 55 amino acids toward the N-terminal end of bacterial proteins of about 85 amino acids in length. The best-characterized member is prevent-host-death (phd) of bacteriophage P1, the antidote partner of death-on-curing (doc) (TIGR01550) in an addiction module. Addiction modules prevent plasmid curing by killing the host cell as the longer-lived killing protein persists while the gene for the shorter-lived antidote is lost. Note, however, that relatively few members of this family appear to be plasmid or phage-encoded. Also, there is little overlap, except for phage P1 itself, of species with this family and with the doc family.
Probab=41.89  E-value=24  Score=20.74  Aligned_cols=23  Identities=30%  Similarity=0.394  Sum_probs=16.8

Q ss_pred             HHHHHHHHccCceeeeeCCCccCC
Q psy7374          82 KELWDKFNELGTEMIITKTGRKLF  105 (106)
Q Consensus        82 ~~LW~~Fh~lgtEMIITKsGRRMF  105 (106)
                      .++++....-+ +++||+.|+..|
T Consensus        12 ~~~l~~v~~~~-pv~It~~g~~~a   34 (52)
T TIGR01552        12 GELLKRVRDGE-PVTITKRGRPVA   34 (52)
T ss_pred             HHHHHHHHCCC-CEEEEECCcceE
Confidence            45666776644 999999998653


No 4  
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=37.67  E-value=23  Score=29.21  Aligned_cols=21  Identities=43%  Similarity=0.612  Sum_probs=17.4

Q ss_pred             HHHHHHHHccCceeeeeCCCccC
Q psy7374          82 KELWDKFNELGTEMIITKTGRKL  104 (106)
Q Consensus        82 ~~LW~~Fh~lgtEMIITKsGRRM  104 (106)
                      .+|=++|+++||+-||+  |||+
T Consensus        19 l~lak~f~elgN~VIi~--gR~e   39 (245)
T COG3967          19 LALAKRFLELGNTVIIC--GRNE   39 (245)
T ss_pred             HHHHHHHHHhCCEEEEe--cCcH
Confidence            46789999999999997  5654


No 5  
>PF04001 Vhr1:  Transcription factor Vhr1;  InterPro: IPR007147 This is a family of proteins of unknown function found in yeast.
Probab=22.44  E-value=19  Score=25.97  Aligned_cols=21  Identities=19%  Similarity=0.525  Sum_probs=17.5

Q ss_pred             eeeecCHHHHHHHHccCceee
Q psy7374          76 TCHLETKELWDKFNELGTEMI   96 (106)
Q Consensus        76 ~v~Le~~~LW~~Fh~lgtEMI   96 (106)
                      .+.+.++.+|+.|.....|.|
T Consensus        15 ~LnF~De~~WK~FSsRRLELI   35 (95)
T PF04001_consen   15 QLNFHDERKWKRFSSRRLELI   35 (95)
T ss_pred             HhCCccHHHHHHHHHHHHHHH
Confidence            456788999999999888876


No 6  
>PF11733 NP1-WLL:  Non-capsid protein NP1;  InterPro: IPR021075  This entry represents the bocavirus non-capsid protein NP1 []. 
Probab=17.56  E-value=52  Score=23.64  Aligned_cols=29  Identities=38%  Similarity=0.692  Sum_probs=17.9

Q ss_pred             ccccccCCCCccccccc----ccccCCCCCccc
Q psy7374          12 HNHKRRRGSPIRKSQRD----RDDRSRSPPEIS   40 (106)
Q Consensus        12 ~~~~~~~~~~~~~~~~~----~~~~s~s~~~~~   40 (106)
                      |..-+|.|||.|...+.    +..|||||+--+
T Consensus        10 hrs~kR~~sp~r~ER~r~Wq~hrsrSRSPIR~~   42 (94)
T PF11733_consen   10 HRSYKRKGSPLRDERKRQWQHHRSRSRSPIRHH   42 (94)
T ss_pred             hhhhccCCCcchhhhhhhhhhccccccChhhhh
Confidence            55567889998764321    223788887543


No 7  
>PF10419 TFIIIC_sub6:  TFIIIC subunit;  InterPro: IPR019481  This conserved domain is found in a family of proteins that function as subunits of transcription factor IIIC (TFIIIC) []. TFIIIC in yeast and humans is required for transcription of tRNA and 5 S RNA genes by RNA polymerase III. The yeast proteins in this entry are fused to phosphoglycerate mutase domain. 
Probab=13.81  E-value=89  Score=18.22  Aligned_cols=9  Identities=33%  Similarity=0.745  Sum_probs=6.3

Q ss_pred             ccCceeeee
Q psy7374          90 ELGTEMIIT   98 (106)
Q Consensus        90 ~lgtEMIIT   98 (106)
                      .+||||+++
T Consensus        27 ~iGT~l~F~   35 (35)
T PF10419_consen   27 TIGTELFFE   35 (35)
T ss_pred             hcceeEeeC
Confidence            367888864


No 8  
>PF08495 FIST:  FIST N domain;  InterPro: IPR013702 The FIST N domain is a novel sensory domain, which is present in signal transduction proteins from Bacteria, Archaea and Eukarya. Chromosomal proximity of FIST-encoding genes to those coding for proteins involved in amino acid metabolism and transport suggest that FIST domains bind small ligands, such as amino acids [].
Probab=12.99  E-value=61  Score=22.85  Aligned_cols=27  Identities=22%  Similarity=0.480  Sum_probs=16.7

Q ss_pred             eeeecCHHHHHHHHccCceeeeeCC-CccCC
Q psy7374          76 TCHLETKELWDKFNELGTEMIITKT-GRKLF  105 (106)
Q Consensus        76 ~v~Le~~~LW~~Fh~lgtEMIITKs-GRRMF  105 (106)
                      ++.......|+.+   +.+|+|||+ ||.++
T Consensus       165 ~~~~~~~~g~~p~---g~~~~VT~a~~~~I~  192 (198)
T PF08495_consen  165 KIDSFVSHGWEPI---GKPMTVTKAEGNIIY  192 (198)
T ss_pred             eEEEEEecCeEeC---CCCEEEEEecCCEEE
Confidence            3333334455544   789999996 66554


No 9  
>PF15000 TUSC2:  Tumour suppressor candidate 2
Probab=11.83  E-value=1.1e+02  Score=22.58  Aligned_cols=21  Identities=48%  Similarity=0.681  Sum_probs=16.4

Q ss_pred             ecCHHHHHHHHccCceeeeeCCCcc
Q psy7374          79 LETKELWDKFNELGTEMIITKTGRK  103 (106)
Q Consensus        79 Le~~~LW~~Fh~lgtEMIITKsGRR  103 (106)
                      =|+-+|=.+|.+   | ||||+|++
T Consensus        56 DeDGdlAhEFYe---E-~v~~~g~~   76 (111)
T PF15000_consen   56 DEDGDLAHEFYE---E-VVTKNGRK   76 (111)
T ss_pred             cCCcchhhhhhh---h-hhccCCcc
Confidence            356678888887   6 99999875


No 10 
>PF06881 Elongin_A:  RNA polymerase II transcription factor SIII (Elongin) subunit A;  InterPro: IPR010684 This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A. In mammals, the Elongin complex activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin is a heterotrimer composed of A, B, and C subunits of 110, 18, and 15 kilodaltons, respectively. Subunit A has been shown to function as the transcriptionally active component of Elongin [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus, 0016021 integral to membrane
Probab=11.54  E-value=1.1e+02  Score=20.90  Aligned_cols=18  Identities=28%  Similarity=0.409  Sum_probs=14.6

Q ss_pred             ceeeeecCHHHHHHHHcc
Q psy7374          74 HVTCHLETKELWDKFNEL   91 (106)
Q Consensus        74 ~i~v~Le~~~LW~~Fh~l   91 (106)
                      .+.+..+.++||..|...
T Consensus        31 np~l~~~tdeLW~~~i~r   48 (109)
T PF06881_consen   31 NPHLIEDTDELWKKLIKR   48 (109)
T ss_pred             CCCcchhhHHHHHHHHHh
Confidence            456777899999999875


Done!