Query         psy738
Match_columns 62
No_of_seqs    125 out of 422
Neff          5.3 
Searched_HMMs 46136
Date          Fri Aug 16 16:44:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy738.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/738hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3738|consensus              100.0 2.8E-33   6E-38  208.1   2.2   61    1-61    331-391 (559)
  2 KOG3736|consensus              100.0 3.2E-31   7E-36  200.7   3.5   60    1-61    353-412 (578)
  3 KOG3737|consensus               99.9 1.3E-23 2.8E-28  157.0   1.5   61    1-61    371-435 (603)
  4 cd02510 pp-GalNAc-T pp-GalNAc-  99.2   1E-11 2.2E-16   84.6   4.4   60    1-61    209-269 (299)
  5 PF11407 RestrictionMunI:  Type  77.6     1.2 2.7E-05   30.8   1.1   26   34-59    156-183 (202)
  6 KOG3629|consensus               59.5     5.7 0.00012   31.9   1.5   28   31-58    126-153 (728)
  7 PF03615 GCM:  GCM motif protei  59.2     5.2 0.00011   26.5   1.0   24    1-24     89-117 (143)
  8 PF12909 DUF3832:  Protein of u  56.5     8.8 0.00019   23.3   1.7   25   33-59     41-65  (89)
  9 PRK09194 prolyl-tRNA synthetas  56.5     4.2 9.1E-05   31.1   0.3   28    2-29    394-421 (565)
 10 TIGR00409 proS_fam_II prolyl-t  51.8     2.7 5.8E-05   32.5  -1.4   27    2-28    399-425 (568)
 11 KOG4405|consensus               35.4      17 0.00036   28.6   0.7   17    4-21    172-188 (547)
 12 KOG2416|consensus               31.1      14 0.00031   29.9  -0.3   45   10-55    442-486 (718)
 13 PF05401 NodS:  Nodulation prot  30.1      13 0.00028   25.7  -0.6   16    3-18    139-159 (201)
 14 cd08584 PI-PLCc_GDPD_SF_unchar  29.1      13 0.00028   25.4  -0.8   19   36-54    119-137 (192)
 15 PF01641 SelR:  SelR domain;  I  28.9      36 0.00078   21.8   1.3   10   12-21     94-103 (124)
 16 PF10906 DUF2697:  Protein of u  28.1      23  0.0005   20.7   0.3   18   34-53     51-68  (68)
 17 COG0163 UbiX 3-polyprenyl-4-hy  27.0      33 0.00072   23.7   1.0    8    5-12     83-90  (191)
 18 PRK05508 methionine sulfoxide   25.3      31 0.00068   22.1   0.6   11   12-22     87-97  (119)
 19 smart00037 CNX Connexin homolo  24.8      24 0.00052   18.1  -0.0   13   43-55      1-13  (34)
 20 COG0229 Conserved domain frequ  23.2      37 0.00079   22.5   0.6   14   12-26     99-112 (140)
 21 COG0350 Ada Methylated DNA-pro  23.2      42  0.0009   22.1   0.9    9    7-15    135-143 (168)
 22 PHA02836 putative transmembran  23.1      30 0.00065   23.1   0.2   16    4-20     45-60  (153)
 23 PF06326 Vesiculo_matrix:  Vesi  22.9      58  0.0013   22.5   1.6   16   36-51     87-102 (228)
 24 PF14803 Nudix_N_2:  Nudix N-te  22.3      47   0.001   16.7   0.8    8    1-8       5-12  (34)
 25 PF13639 zf-RING_2:  Ring finge  22.1      90  0.0019   15.4   1.9   14    4-17     14-27  (44)
 26 TIGR01913 bet_lambda phage rec  22.0     9.4  0.0002   25.9  -2.4   10   42-51    133-142 (188)
 27 PF11672 DUF3268:  Protein of u  21.7 1.5E+02  0.0034   18.3   3.2   48    2-49      8-73  (102)
 28 KOG1941|consensus               21.4      18  0.0004   28.0  -1.2   13    5-17    381-393 (518)
 29 KOG4628|consensus               21.1      48   0.001   24.7   0.9   17    3-19    242-258 (348)
 30 PHA02641 hypothetical protein;  20.8      35 0.00076   23.4   0.2   16    4-20     75-90  (188)
 31 cd06224 REM Guanine nucleotide  20.7      62  0.0013   18.8   1.2   22   33-54     65-86  (122)
 32 PF13854 Kelch_5:  Kelch motif   20.6      39 0.00085   16.7   0.3   12    9-20      1-12  (42)

No 1  
>KOG3738|consensus
Probab=99.97  E-value=2.8e-33  Score=208.11  Aligned_cols=61  Identities=59%  Similarity=1.141  Sum_probs=59.4

Q ss_pred             CccceeEEecccceEeeccCCCCCCCCCCcchhhhHHHhHhHHhhccccchhhhhcCCCCC
Q psy738            1 MCGGVLEIATCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWLDEWKHFYYAINPENM   61 (62)
Q Consensus         1 mCGG~ie~~PCSRVGHifr~~~Py~~~~~~~~~~~rN~~RvaevWmDeyk~~~y~~~p~~~   61 (62)
                      ||||+|||+||||||||||+++||.||+|.+.+..+|.+|+|||||||||.+||+.+|.|+
T Consensus       331 ~CGGslEIvPCSRVGHVFRkrHpy~FP~gs~~ty~~NTkr~AEvWmDEYK~~yyaarPsAr  391 (559)
T KOG3738|consen  331 QCGGSLEIVPCSRVGHVFRKRHPYTFPGGSGNTYIKNTKRAAEVWMDEYKNYYYAARPSAR  391 (559)
T ss_pred             eeCCeeEEEeccchhhhhhccCCCcCCCCCCcchhhcchHHHHHHHHHHHHHHHhcCchhh
Confidence            7999999999999999999999999999999999999999999999999999999999885


No 2  
>KOG3736|consensus
Probab=99.96  E-value=3.2e-31  Score=200.73  Aligned_cols=60  Identities=55%  Similarity=1.027  Sum_probs=57.1

Q ss_pred             CccceeEEecccceEeeccCCCCCCCCCCcchhhhHHHhHhHHhhccccchhhhhcCCCCC
Q psy738            1 MCGGVLEIATCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWLDEWKHFYYAINPENM   61 (62)
Q Consensus         1 mCGG~ie~~PCSRVGHifr~~~Py~~~~~~~~~~~rN~~RvaevWmDeyk~~~y~~~p~~~   61 (62)
                      ||||+|||+||||||||||++.||++|++. +++.+|++|+|||||||||++||.++|.++
T Consensus       353 qCGG~lei~PCSrVGHifRk~~pY~~p~~~-~~~~~N~~RlAeVWmDeyK~~~y~~~P~~~  412 (578)
T KOG3736|consen  353 QCGGRLEIVPCSRVGHIFRKRKPYTFPDGT-DTATRNLKRLAEVWMDEYKEQFYKRMPGLR  412 (578)
T ss_pred             ccCCeEEecCccceeeeeecCCCccCCCcc-hhhhhchhhhhhhhhHHHHHHHHhhCcccc
Confidence            899999999999999999999999999765 788999999999999999999999999875


No 3  
>KOG3737|consensus
Probab=99.87  E-value=1.3e-23  Score=156.99  Aligned_cols=61  Identities=38%  Similarity=0.798  Sum_probs=54.1

Q ss_pred             CccceeEEecccceEeeccCCCCCCCCCC----cchhhhHHHhHhHHhhccccchhhhhcCCCCC
Q psy738            1 MCGGVLEIATCSHVGHVFRKSTPYTFPGG----TSNIVNHNNARLAEVWLDEWKHFYYAINPENM   61 (62)
Q Consensus         1 mCGG~ie~~PCSRVGHifr~~~Py~~~~~----~~~~~~rN~~RvaevWmDeyk~~~y~~~p~~~   61 (62)
                      ||||+|+++||||||||||+..||++.+-    .+..+..|++||+|+||||||+|||.+.|++.
T Consensus       371 QCGG~i~fVPCSrVGHvYR~~mpy~fgk~~~k~~~p~i~iNy~RVvetW~Ddyk~YfytreP~a~  435 (603)
T KOG3737|consen  371 QCGGKILFVPCSRVGHVYRSLMPYQFGKPPIKVGSPPILINYVRVVETWWDDYKDYFYTREPEAQ  435 (603)
T ss_pred             eeCCEEEEEEccccchhhhccccccCCCCccccCCCceEeehhhHHHHHHHhhhhheeecChhhc
Confidence            79999999999999999999999997321    13467899999999999999999999999874


No 4  
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans. UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins.
Probab=99.23  E-value=1e-11  Score=84.58  Aligned_cols=60  Identities=55%  Similarity=1.132  Sum_probs=53.3

Q ss_pred             CccceeEEecccceEeecc-CCCCCCCCCCcchhhhHHHhHhHHhhccccchhhhhcCCCCC
Q psy738            1 MCGGVLEIATCSHVGHVFR-KSTPYTFPGGTSNIVNHNNARLAEVWLDEWKHFYYAINPENM   61 (62)
Q Consensus         1 mCGG~ie~~PCSRVGHifr-~~~Py~~~~~~~~~~~rN~~RvaevWmDeyk~~~y~~~p~~~   61 (62)
                      +||+++..+|+|+|.|+++ ...||..+.+.. .+.+|.+|.++.|+|+++.++|..+|++.
T Consensus       209 ~~G~~i~~~p~a~v~H~~~~~~~~~~~~~~~~-~~~~n~~r~~~~w~~~~~~~~~~~~~~~~  269 (299)
T cd02510         209 QCGGSIEIVPCSRVGHIFRRKRKPYTFPGGSG-TVLRNYKRVAEVWMDEYKEYFYKARPELR  269 (299)
T ss_pred             HcCCeEEEeeccEEEEeccccCCCCCCCCccc-HHHHHHHHHHHHHHHHHHHHHHhcCcccc
Confidence            5899999999999999999 788998875432 57899999999999999999999998764


No 5  
>PF11407 RestrictionMunI:  Type II restriction enzyme MunI;  InterPro: IPR022725 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   Type II restriction enzyme MunI recognises the palindromic sequence C/AATTG. It makes contact with the DNA via the major groove []. ; PDB: 1D02_B.
Probab=77.63  E-value=1.2  Score=30.82  Aligned_cols=26  Identities=27%  Similarity=0.763  Sum_probs=17.0

Q ss_pred             hhHHHhHhHH--hhccccchhhhhcCCC
Q psy738           34 VNHNNARLAE--VWLDEWKHFYYAINPE   59 (62)
Q Consensus        34 ~~rN~~Rvae--vWmDeyk~~~y~~~p~   59 (62)
                      +.|--+|+-|  -|.|||.+.||-++|.
T Consensus       156 ITRDpkR~REIt~Wf~~y~~nyF~Wr~~  183 (202)
T PF11407_consen  156 ITRDPKRVREITFWFDEYDKNYFMWRPT  183 (202)
T ss_dssp             GGG-HHHHHHHHHHHTT-CCCEEEE-TT
T ss_pred             cccCcccceeeeeehhhcccceEEecCC
Confidence            4555566655  5999999988888775


No 6  
>KOG3629|consensus
Probab=59.47  E-value=5.7  Score=31.86  Aligned_cols=28  Identities=21%  Similarity=0.538  Sum_probs=23.4

Q ss_pred             chhhhHHHhHhHHhhccccchhhhhcCC
Q psy738           31 SNIVNHNNARLAEVWLDEWKHFYYAINP   58 (62)
Q Consensus        31 ~~~~~rN~~RvaevWmDeyk~~~y~~~p   58 (62)
                      ...+.+|++|+...|+|.|-+-||.-.|
T Consensus       126 s~~~v~naI~il~~WL~~~pEDF~~~~~  153 (728)
T KOG3629|consen  126 SALLVQNAIRILMCWLETYPEDFYDSDK  153 (728)
T ss_pred             HHHHHHHHHHHHHHHHHhChHhhcCccH
Confidence            4457799999999999999998887543


No 7  
>PF03615 GCM:  GCM motif protein;  InterPro: IPR003902  GCM transcription factors are a family of proteins which contain a GCM motif. The GCM motif is a domain that has been identified in proteins belonging to a family of transcriptional regulators involved in fundamental developmental processes which comprise Drosophila melanogaster GCM and its mammalian homologs [, , , ]. IN GCM transcription factors the N-terminal moiety contains a DNA-binding domain of 150 residues. Sequence conservation is highest in this GCM domain. In contrast, the C-terminal moiety contains one or two transactivating regions and is only poorly conserved.  The GCM motif has been shown to be a DNA binding domain that recognises preferentially the nonpalindromic octamer 5'-ATGCGGGT-3' [, , ]. The GCM motif contains many conserved basic amino acid residues, seven cysteine residues, and four histidine residues []. The conserved cysteines are involved in shaping the overall conformation of the domain, in the process of DNA binding and in the redox regulation of DNA binding []. The GCM domain as a new class of Zn-containing DNA-binding domain with no similarity to any other DNA-binding domain []. The GCM domain consists of a large and a small domain tethered together by one of the two Zn ions present in the structure. The large and the small domains comprise five- and three-stranded beta-sheets, respectively, with three small helical segments packed against the same side of the two beta-sheets. The GCM domain exercises a novel mode of sequence-specific DNA recognition, where the five-stranded beta-pleated sheet inserts into the major groove of the DNA. Residues protruding from the edge strand of the beta-pleated sheet and the following loop and strand contact the bases and backbone of both DNA strands, providing specificity for its DNA target site. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1ODH_A.
Probab=59.18  E-value=5.2  Score=26.50  Aligned_cols=24  Identities=33%  Similarity=0.643  Sum_probs=10.8

Q ss_pred             CccceeEEeccc-----ceEeeccCCCCC
Q psy738            1 MCGGVLEIATCS-----HVGHVFRKSTPY   24 (62)
Q Consensus         1 mCGG~ie~~PCS-----RVGHifr~~~Py   24 (62)
                      .|.|+||++||-     =|-|+.|....+
T Consensus        89 ~C~g~L~~~pCrGh~GYPVThFWr~~~~~  117 (143)
T PF03615_consen   89 NCKGRLELIPCRGHCGYPVTHFWRHDGNA  117 (143)
T ss_dssp             -S--BEEEE---TBTTB--EEEEEE-SSB
T ss_pred             ccCCceeEEeccCcCCCceeEEEecCCCE
Confidence            399999999995     255666655443


No 8  
>PF12909 DUF3832:  Protein of unknown function (DUF3832);  InterPro: IPR024308 This domain found in bacteria and Acanthamoeba polyphaga mimivirus (APMV) L591 protein has no known function. In Q0AZ30 from SWISSPROT and other uncharacterised proteins this domain is found C-terminal, while the N terminus shows remote homology to the bacterial toxin/antitoxin 'addiction module' (PF12910 from PFAM).; PDB: 3K6Q_C.
Probab=56.53  E-value=8.8  Score=23.31  Aligned_cols=25  Identities=16%  Similarity=0.432  Sum_probs=18.9

Q ss_pred             hhhHHHhHhHHhhccccchhhhhcCCC
Q psy738           33 IVNHNNARLAEVWLDEWKHFYYAINPE   59 (62)
Q Consensus        33 ~~~rN~~RvaevWmDeyk~~~y~~~p~   59 (62)
                      .+..+++-.|+.|||+++ +|++ .|+
T Consensus        41 ~lie~l~dYAedy~~~~~-~~~~-apn   65 (89)
T PF12909_consen   41 DLIEDLRDYAEDYMNRFP-LFYN-APN   65 (89)
T ss_dssp             HHHHHHHHHHHHHHHTHH-HHHT-STT
T ss_pred             HHHHHHHHHHHHHHHHHH-HHhc-CCC
Confidence            356889999999999987 4444 554


No 9  
>PRK09194 prolyl-tRNA synthetase; Provisional
Probab=56.48  E-value=4.2  Score=31.05  Aligned_cols=28  Identities=39%  Similarity=0.591  Sum_probs=24.2

Q ss_pred             ccceeEEecccceEeeccCCCCCCCCCC
Q psy738            2 CGGVLEIATCSHVGHVFRKSTPYTFPGG   29 (62)
Q Consensus         2 CGG~ie~~PCSRVGHifr~~~Py~~~~~   29 (62)
                      |||.|++...=-|||+|+-...|+.+-+
T Consensus       394 c~~~l~~~~~iEvGh~f~lG~~ys~~~~  421 (565)
T PRK09194        394 GGGTLKIARGIEVGHIFQLGTKYSEAMN  421 (565)
T ss_pred             CCceeEEeeeEEEEEEecCCcchhhccC
Confidence            8999999999999999999888886543


No 10 
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II. Prolyl-tRNA synthetase is a class II tRNA synthetase and is recognized by pfam model tRNA-synt_2b, which recognizes tRNA synthetases for Gly, His, Ser, and Pro. The prolyl-tRNA synthetases are divided into two widely divergent groups. This group includes enzymes from Escherichia coli, Bacillus subtilis, Aquifex aeolicus, the spirochete Treponema pallidum, Synechocystis PCC6803, and one of the two prolyL-tRNA synthetases of Saccharomyces cerevisiae. The other group includes the Pro-specific domain of a human multifunctional tRNA ligase and the prolyl-tRNA synthetases from the Archaea, the Mycoplasmas, and the spirochete Borrelia burgdorferi.
Probab=51.79  E-value=2.7  Score=32.50  Aligned_cols=27  Identities=37%  Similarity=0.503  Sum_probs=23.0

Q ss_pred             ccceeEEecccceEeeccCCCCCCCCC
Q psy738            2 CGGVLEIATCSHVGHVFRKSTPYTFPG   28 (62)
Q Consensus         2 CGG~ie~~PCSRVGHifr~~~Py~~~~   28 (62)
                      |||.|.+-..=-|||+|+-..-|+.+-
T Consensus       399 c~~~l~~~rgIEvGhiF~LG~kYS~~~  425 (568)
T TIGR00409       399 GQGTLKIARGIEVGHIFQLGTKYSEAL  425 (568)
T ss_pred             CCCcccccceEEEEEeccchhhhHHhc
Confidence            899999988889999999887777653


No 11 
>KOG4405|consensus
Probab=35.41  E-value=17  Score=28.56  Aligned_cols=17  Identities=41%  Similarity=0.720  Sum_probs=13.9

Q ss_pred             ceeEEecccceEeeccCC
Q psy738            4 GVLEIATCSHVGHVFRKS   21 (62)
Q Consensus         4 G~ie~~PCSRVGHifr~~   21 (62)
                      |.++-||||| |-||.+.
T Consensus       172 g~l~~VPcSR-advFnsk  188 (547)
T KOG4405|consen  172 GELEQVPCSR-ADVFNSK  188 (547)
T ss_pred             CeeeecCchH-Hhhhccc
Confidence            7999999999 4577664


No 12 
>KOG2416|consensus
Probab=31.14  E-value=14  Score=29.86  Aligned_cols=45  Identities=22%  Similarity=0.440  Sum_probs=33.6

Q ss_pred             cccceEeeccCCCCCCCCCCcchhhhHHHhHhHHhhccccchhhhh
Q psy738           10 TCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWLDEWKHFYYA   55 (62)
Q Consensus        10 PCSRVGHifr~~~Py~~~~~~~~~~~rN~~RvaevWmDeyk~~~y~   55 (62)
                      +-|.|-||-.--.||... .....|.||-.-|.+-|||--|.+-|-
T Consensus       442 ~~SnvlhI~nLvRPFTlg-QLkelL~rtgg~Vee~WmDkIKShCyV  486 (718)
T KOG2416|consen  442 EPSNVLHIDNLVRPFTLG-QLKELLGRTGGNVEEFWMDKIKSHCYV  486 (718)
T ss_pred             CccceEeeecccccchHH-HHHHHHhhccCchHHHHHHHhhcceeE
Confidence            357888998777888863 123446688888999999998886664


No 13 
>PF05401 NodS:  Nodulation protein S (NodS);  InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins. The products of the rhizobial nodulation genes are involved in the biosynthesis of lipochitin oligosaccharides (LCOs), which are host-specific signal molecules required for nodule formation. NodS is an S-adenosyl-L-methionine (SAM)-dependent methyltransferase involved in N methylation of LCOs. NodS uses N-deacetylated chitooligosaccharides, the products of the NodBC proteins, as its methyl acceptors [].; GO: 0008757 S-adenosylmethionine-dependent methyltransferase activity, 0009312 oligosaccharide biosynthetic process, 0009877 nodulation; PDB: 3OFK_D 3OFJ_A.
Probab=30.07  E-value=13  Score=25.71  Aligned_cols=16  Identities=44%  Similarity=0.769  Sum_probs=9.9

Q ss_pred             cceeEE-----ecccceEeec
Q psy738            3 GGVLEI-----ATCSHVGHVF   18 (62)
Q Consensus         3 GG~ie~-----~PCSRVGHif   18 (62)
                      ||.+.+     .+|+|.||.|
T Consensus       139 gG~LV~g~~rd~~c~~wgh~~  159 (201)
T PF05401_consen  139 GGHLVFGHARDANCRRWGHAA  159 (201)
T ss_dssp             EEEEEEEEE-HHHHHHTT-S-
T ss_pred             CCEEEEEEecCCcccccCccc
Confidence            455544     3899999987


No 14 
>cd08584 PI-PLCc_GDPD_SF_unchar2 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases. This subfamily corresponds to a group of uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipase C (PI-PLC), and glycerophosphodiester phosphodiesterases (GP-GDE), and also sphingomyelinases D (SMases D) and similar proteins. They hydrolyze the 3'-5' phosphodiester bonds in different substrates, utilizing a similar mechanism of general base and acid catalysis involving two conserved histidine residues.
Probab=29.12  E-value=13  Score=25.42  Aligned_cols=19  Identities=16%  Similarity=0.478  Sum_probs=13.8

Q ss_pred             HHHhHhHHhhccccchhhh
Q psy738           36 HNNARLAEVWLDEWKHFYY   54 (62)
Q Consensus        36 rN~~RvaevWmDeyk~~~y   54 (62)
                      +=+-++.-||+|+|....+
T Consensus       119 ~~~~~~~~VW~D~f~~~~~  137 (192)
T cd08584         119 SLYEKADWVWIDSFTSLWL  137 (192)
T ss_pred             HhhccccEEEEecccccCC
Confidence            3345788899999877544


No 15 
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=28.89  E-value=36  Score=21.79  Aligned_cols=10  Identities=60%  Similarity=1.119  Sum_probs=7.8

Q ss_pred             cceEeeccCC
Q psy738           12 SHVGHVFRKS   21 (62)
Q Consensus        12 SRVGHifr~~   21 (62)
                      |++||||...
T Consensus        94 ~HLGHVF~DG  103 (124)
T PF01641_consen   94 SHLGHVFDDG  103 (124)
T ss_dssp             CEEEEEESTS
T ss_pred             CccccEeCCC
Confidence            4799999843


No 16 
>PF10906 DUF2697:  Protein of unknown function (DUF2697);  InterPro: IPR020301 This entry contains proteins with no known function.
Probab=28.09  E-value=23  Score=20.67  Aligned_cols=18  Identities=28%  Similarity=0.444  Sum_probs=13.7

Q ss_pred             hhHHHhHhHHhhccccchhh
Q psy738           34 VNHNNARLAEVWLDEWKHFY   53 (62)
Q Consensus        34 ~~rN~~RvaevWmDeyk~~~   53 (62)
                      ..-|+-|+.  |.||.|..|
T Consensus        51 ~k~~AFr~l--f~DE~K~~f   68 (68)
T PF10906_consen   51 QKFNAFRIL--FWDELKNSF   68 (68)
T ss_pred             HHHHHHHHH--HHHHHHhcC
Confidence            456777776  999998754


No 17 
>COG0163 UbiX 3-polyprenyl-4-hydroxybenzoate decarboxylase [Coenzyme metabolism]
Probab=27.04  E-value=33  Score=23.71  Aligned_cols=8  Identities=50%  Similarity=0.708  Sum_probs=6.6

Q ss_pred             eeEEeccc
Q psy738            5 VLEIATCS   12 (62)
Q Consensus         5 ~ie~~PCS   12 (62)
                      .|.|+|||
T Consensus        83 gMiI~PCS   90 (191)
T COG0163          83 GMIIAPCS   90 (191)
T ss_pred             cEEEEeCc
Confidence            47899998


No 18 
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=25.35  E-value=31  Score=22.08  Aligned_cols=11  Identities=45%  Similarity=0.897  Sum_probs=8.5

Q ss_pred             cceEeeccCCC
Q psy738           12 SHVGHVFRKST   22 (62)
Q Consensus        12 SRVGHifr~~~   22 (62)
                      |+.||||....
T Consensus        87 ~HLGHVF~d~g   97 (119)
T PRK05508         87 GHLGHVFEGEG   97 (119)
T ss_pred             CccCcccCCCC
Confidence            57999998543


No 19 
>smart00037 CNX Connexin homologues. Connexin channels participate in the regulation of signaling between  developing and differentiated cell types.
Probab=24.76  E-value=24  Score=18.12  Aligned_cols=13  Identities=38%  Similarity=0.631  Sum_probs=9.9

Q ss_pred             Hhhccccchhhhh
Q psy738           43 EVWLDEWKHFYYA   55 (62)
Q Consensus        43 evWmDeyk~~~y~   55 (62)
                      .||-||-+++.-.
T Consensus         1 ~vw~DEq~~FvCn   13 (34)
T smart00037        1 SVWGDEQSDFVCN   13 (34)
T ss_pred             Cccccchhhceec
Confidence            3799998887653


No 20 
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=23.21  E-value=37  Score=22.46  Aligned_cols=14  Identities=50%  Similarity=0.842  Sum_probs=10.4

Q ss_pred             cceEeeccCCCCCCC
Q psy738           12 SHVGHVFRKSTPYTF   26 (62)
Q Consensus        12 SRVGHifr~~~Py~~   26 (62)
                      |+.||||... |...
T Consensus        99 sHLGHVF~DG-P~~t  112 (140)
T COG0229          99 SHLGHVFPDG-PPPT  112 (140)
T ss_pred             CccccccCCC-CCCC
Confidence            7899999654 6554


No 21 
>COG0350 Ada Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair]
Probab=23.19  E-value=42  Score=22.08  Aligned_cols=9  Identities=33%  Similarity=0.423  Sum_probs=7.6

Q ss_pred             EEecccceE
Q psy738            7 EIATCSHVG   15 (62)
Q Consensus         7 e~~PCSRVG   15 (62)
                      .++||=||=
T Consensus       135 IiIPCHRVi  143 (168)
T COG0350         135 IIIPCHRVI  143 (168)
T ss_pred             EEecCeEeE
Confidence            589999984


No 22 
>PHA02836 putative transmembrane protein; Provisional
Probab=23.07  E-value=30  Score=23.06  Aligned_cols=16  Identities=25%  Similarity=0.544  Sum_probs=12.5

Q ss_pred             ceeEEecccceEeeccC
Q psy738            4 GVLEIATCSHVGHVFRK   20 (62)
Q Consensus         4 G~ie~~PCSRVGHifr~   20 (62)
                      |+|.++| |.||.+|=.
T Consensus        45 GRI~~vP-~~vGkLyl~   60 (153)
T PHA02836         45 GRIGFVP-VGIGNLFLK   60 (153)
T ss_pred             cceeeee-cchhhhhHH
Confidence            7888888 788887754


No 23 
>PF06326 Vesiculo_matrix:  Vesiculovirus matrix protein;  InterPro: IPR009397 This family consists of several Vesiculovirus matrix proteins. The matrix (M) protein of vesicular stomatitis virus (VSV) expressed in the absence of other viral components causes many of the cytopathic effects of VSV, including an inhibition of host gene expression and the induction of cell rounding. It has been shown that M protein also induces apoptosis in the absence of other viral components. It is thought that the activation of apoptotic pathways causes the inhibition of host gene expression and cell rounding by M protein [].; GO: 0005198 structural molecule activity, 0019031 viral envelope; PDB: 1LG7_A 2W2R_A.
Probab=22.85  E-value=58  Score=22.53  Aligned_cols=16  Identities=19%  Similarity=0.544  Sum_probs=11.9

Q ss_pred             HHHhHhHHhhccccch
Q psy738           36 HNNARLAEVWLDEWKH   51 (62)
Q Consensus        36 rN~~RvaevWmDeyk~   51 (62)
                      ....++++.|.|+|.-
T Consensus        87 ~d~~~il~~w~d~Y~G  102 (228)
T PF06326_consen   87 SDLYKILSNWLDNYDG  102 (228)
T ss_dssp             HHHHHHHGGGGTT--S
T ss_pred             HHHHHHHHHHHHhCCC
Confidence            4678999999999963


No 24 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=22.26  E-value=47  Score=16.65  Aligned_cols=8  Identities=63%  Similarity=1.128  Sum_probs=3.6

Q ss_pred             CccceeEE
Q psy738            1 MCGGVLEI    8 (62)
Q Consensus         1 mCGG~ie~    8 (62)
                      +||+.++.
T Consensus         5 ~CG~~l~~   12 (34)
T PF14803_consen    5 QCGGPLER   12 (34)
T ss_dssp             TT--B-EE
T ss_pred             cccChhhh
Confidence            58888776


No 25 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=22.10  E-value=90  Score=15.40  Aligned_cols=14  Identities=29%  Similarity=0.342  Sum_probs=9.2

Q ss_pred             ceeEEecccceEee
Q psy738            4 GVLEIATCSHVGHV   17 (62)
Q Consensus         4 G~ie~~PCSRVGHi   17 (62)
                      ..+..+||.++-|.
T Consensus        14 ~~~~~l~C~H~fh~   27 (44)
T PF13639_consen   14 EKVVKLPCGHVFHR   27 (44)
T ss_dssp             SCEEEETTSEEEEH
T ss_pred             CeEEEccCCCeeCH
Confidence            45678899655553


No 26 
>TIGR01913 bet_lambda phage recombination protein Bet. This model represents the phage recombination protein Bet from a number of phage, including phage lambda. All members of this family are found in phage genomes or in putative prophage regions of bacterial genomes.
Probab=21.99  E-value=9.4  Score=25.85  Aligned_cols=10  Identities=30%  Similarity=0.351  Sum_probs=7.9

Q ss_pred             HHhhccccch
Q psy738           42 AEVWLDEWKH   51 (62)
Q Consensus        42 aevWmDeyk~   51 (62)
                      +++|+|||..
T Consensus       133 ~~~~~~eY~~  142 (188)
T TIGR01913       133 ISVPFDAYKM  142 (188)
T ss_pred             EEEehhHhhh
Confidence            6789999854


No 27 
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=21.69  E-value=1.5e+02  Score=18.28  Aligned_cols=48  Identities=25%  Similarity=0.339  Sum_probs=29.1

Q ss_pred             ccceeEEecccceEeeccCCCCC----------------C-CCCC-cchhhhHHHhHhHHhhcccc
Q psy738            2 CGGVLEIATCSHVGHVFRKSTPY----------------T-FPGG-TSNIVNHNNARLAEVWLDEW   49 (62)
Q Consensus         2 CGG~ie~~PCSRVGHifr~~~Py----------------~-~~~~-~~~~~~rN~~RvaevWmDey   49 (62)
                      |||..++++=|.|---.-...||                + .|-| ..+.-.|+....|+-.+|..
T Consensus         8 Cg~~~~l~~~~~iYg~~~~~~~~~y~C~~C~AyVG~H~~t~~PlGtLAd~~lR~~R~~ah~~fd~l   73 (102)
T PF11672_consen    8 CGGPAELVDGSEIYGHRYDDGPYLYVCTPCDAYVGCHPGTDIPLGTLADAELRRARKAAHRAFDPL   73 (102)
T ss_pred             CCCeeEEcccchhcCccCCCCceeEECCCCCceeeeeCCCCCcCcccCCHHHHHHHHHHHHHHHHH
Confidence            89999988876664311122344                1 2322 33455688888888877763


No 28 
>KOG1941|consensus
Probab=21.35  E-value=18  Score=28.04  Aligned_cols=13  Identities=38%  Similarity=0.697  Sum_probs=11.5

Q ss_pred             eeEEecccceEee
Q psy738            5 VLEIATCSHVGHV   17 (62)
Q Consensus         5 ~ie~~PCSRVGHi   17 (62)
                      +++.+|||+|-|.
T Consensus       381 ~LqALpCsHIfH~  393 (518)
T KOG1941|consen  381 RLQALPCSHIFHL  393 (518)
T ss_pred             cccccchhHHHHH
Confidence            6889999999986


No 29 
>KOG4628|consensus
Probab=21.10  E-value=48  Score=24.74  Aligned_cols=17  Identities=47%  Similarity=0.573  Sum_probs=13.9

Q ss_pred             cceeEEecccceEeecc
Q psy738            3 GGVLEIATCSHVGHVFR   19 (62)
Q Consensus         3 GG~ie~~PCSRVGHifr   19 (62)
                      |-++-++||+|.-|.-.
T Consensus       242 GdklRiLPC~H~FH~~C  258 (348)
T KOG4628|consen  242 GDKLRILPCSHKFHVNC  258 (348)
T ss_pred             CCeeeEecCCCchhhcc
Confidence            56788999999999743


No 30 
>PHA02641 hypothetical protein; Provisional
Probab=20.84  E-value=35  Score=23.35  Aligned_cols=16  Identities=19%  Similarity=0.505  Sum_probs=12.6

Q ss_pred             ceeEEecccceEeeccC
Q psy738            4 GVLEIATCSHVGHVFRK   20 (62)
Q Consensus         4 G~ie~~PCSRVGHifr~   20 (62)
                      |+|.++| +.||.+|=.
T Consensus        75 GRI~~vP-~~VGKLyld   90 (188)
T PHA02641         75 SKIDILP-KNVGKLYLD   90 (188)
T ss_pred             cceeeee-cchhhhhHH
Confidence            7888888 788888754


No 31 
>cd06224 REM Guanine nucleotide exchange factor for Ras-like GTPases; N-terminal domain (RasGef_N), also called REM domain (Ras exchanger motif). This domain is common in nucleotide exchange factors for Ras-like small GTPases and is typically found immediately N-terminal to the RasGef (Cdc25-like) domain. REM contacts the GTPase and is assumed to participate in the catalytic activity of the exchange factor. Proteins with the REM domain include Sos1 and Sos2, which relay signals from tyrosine-kinase mediated signalling to Ras, RasGRP1-4, RasGRF1,2, CNrasGEF, and RAP-specific nucleotide exchange factors, to name a few.
Probab=20.68  E-value=62  Score=18.83  Aligned_cols=22  Identities=5%  Similarity=0.360  Sum_probs=17.1

Q ss_pred             hhhHHHhHhHHhhccccchhhh
Q psy738           33 IVNHNNARLAEVWLDEWKHFYY   54 (62)
Q Consensus        33 ~~~rN~~RvaevWmDeyk~~~y   54 (62)
                      .++...+.+...|+++|-.-|+
T Consensus        65 ~~~~~v~~~l~~Wv~~~~~df~   86 (122)
T cd06224          65 PIRLRVLNVLRTWVENYPYDFF   86 (122)
T ss_pred             HHHHHHHHHHHHHHHhCCCccc
Confidence            3566778889999999877664


No 32 
>PF13854 Kelch_5:  Kelch motif
Probab=20.65  E-value=39  Score=16.75  Aligned_cols=12  Identities=17%  Similarity=0.138  Sum_probs=8.4

Q ss_pred             ecccceEeeccC
Q psy738            9 ATCSHVGHVFRK   20 (62)
Q Consensus         9 ~PCSRVGHifr~   20 (62)
                      +|+.|-+|-.=.
T Consensus         1 ~P~~R~~hs~~~   12 (42)
T PF13854_consen    1 IPSPRYGHSAVV   12 (42)
T ss_pred             CCCCccceEEEE
Confidence            588888886543


Done!