Query         psy7380
Match_columns 72
No_of_seqs    93 out of 95
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 16:45:44 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7380.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7380hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3586|consensus               99.6 4.5E-17 9.8E-22  130.0   2.2   53   10-62    248-304 (437)
  2 cd00182 TBOX T-box DNA binding  99.2 3.2E-12   7E-17   91.6   0.4   25   10-34    163-187 (188)
  3 smart00425 TBOX Domain first f  99.1 4.2E-11   9E-16   85.6   0.9   26   10-35    164-189 (190)
  4 PF00907 T-box:  T-box;  InterP  98.7   9E-10 1.9E-14   75.7  -1.6   24    9-32    161-184 (184)
  5 KOG3585|consensus               98.6   1E-08 2.2E-13   78.3   0.7   26   10-35    187-212 (328)
  6 smart00811 Alpha_kinase Alpha-  71.4     2.2 4.7E-05   30.6   1.2   16   13-28      7-22  (198)
  7 PF13516 LRR_6:  Leucine Rich r  33.8      27 0.00058   16.5   1.1   15   12-26      1-15  (24)
  8 COG1825 RplY Ribosomal protein  32.9      11 0.00024   24.6  -0.6   23   13-35     35-57  (93)
  9 PF08540 HMG_CoA_synt_C:  Hydro  32.1     7.7 0.00017   29.5  -1.6   25   46-70     15-39  (282)
 10 PF08218 Citrate_ly_lig:  Citra  31.7      23 0.00049   26.3   0.8   17   15-31      1-17  (182)
 11 PF10053 DUF2290:  Uncharacteri  30.9      29 0.00062   25.7   1.3   40   22-61     79-119 (196)
 12 TIGR03032 conserved hypothetic  22.4      31 0.00068   27.7   0.2    8   65-72    117-124 (335)
 13 PF13130 DUF3952:  Domain of un  21.5      33 0.00071   23.8   0.1   53   17-71     11-65  (107)
 14 PF11228 DUF3027:  Protein of u  21.3      56  0.0012   24.5   1.3   17   56-72    170-186 (193)
 15 KOG0884|consensus               20.3      61  0.0013   23.7   1.3   20    7-26    140-160 (161)

No 1  
>KOG3586|consensus
Probab=99.64  E-value=4.5e-17  Score=130.00  Aligned_cols=53  Identities=42%  Similarity=0.432  Sum_probs=45.9

Q ss_pred             hhhhccceeeecCCccccccccCCCch----hhhhhhhhhhccccccCCCCCCCCCC
Q psy7380          10 AYYKEITKLKIDSNPFAKGFRDSSRLT----EFERQNVLFDRHFMGRILRDEYPPDT   62 (72)
Q Consensus        10 ~qnqqIT~LKID~NPFAKgFRd~s~~~----~~~~eail~~q~~~rsp~r~~~~~~~   62 (72)
                      -|||+||+||||+|||||||||.+++.    +...++++..+++||+|+++...+..
T Consensus       248 YQNq~ITkLKI~sNPFAKGFRD~~~~~~~~~~~~~~~l~~~~~~~r~p~~~~~~~~~  304 (437)
T KOG3586|consen  248 YQNQRITKLKIESNPFAKGFRDCGRNDWPDNEPGGDALLSAFARSRAPLRFPTQPSL  304 (437)
T ss_pred             cccceeeeeeeccCccccccccCCccCccccCcchhhhhhhhhhccCccccccccch
Confidence            499999999999999999999998875    24456688899999999999887763


No 2  
>cd00182 TBOX T-box DNA binding domain of the T-box family of transcriptional regulators. The T-box family is an ancient group that appears to play a critical role in development in all animal species. These genes were uncovered on the basis of similarity to the DNA binding domain of murine Brachyury (T) gene product, the defining feature of the family.  Common features shared by T-box family members are DNA-binding and transcriptional regulatory activity, a role in development and conserved expression patterns, most of the known genes in all species being expressed in mesoderm or mesoderm precursors.
Probab=99.19  E-value=3.2e-12  Score=91.55  Aligned_cols=25  Identities=68%  Similarity=1.034  Sum_probs=23.5

Q ss_pred             hhhhccceeeecCCccccccccCCC
Q psy7380          10 AYYKEITKLKIDSNPFAKGFRDSSR   34 (72)
Q Consensus        10 ~qnqqIT~LKID~NPFAKgFRd~s~   34 (72)
                      -||++||+|||++|||||||||.++
T Consensus       163 YqN~~It~lKi~~NpfAkgfr~~~~  187 (188)
T cd00182         163 YQNQEITQLKIDNNPFAKGFRDNGR  187 (188)
T ss_pred             ecCHhHhhhhhcCCcccccccccCC
Confidence            4899999999999999999999876


No 3  
>smart00425 TBOX Domain first found  in the mice T locus (Brachyury) protein.
Probab=99.05  E-value=4.2e-11  Score=85.55  Aligned_cols=26  Identities=65%  Similarity=0.948  Sum_probs=23.7

Q ss_pred             hhhhccceeeecCCccccccccCCCc
Q psy7380          10 AYYKEITKLKIDSNPFAKGFRDSSRL   35 (72)
Q Consensus        10 ~qnqqIT~LKID~NPFAKgFRd~s~~   35 (72)
                      -||++||+|||++||||||||+.++.
T Consensus       164 YqN~~it~lKi~~NpfAkgfr~~~~~  189 (190)
T smart00425      164 YQNQKITKLKIDNNPFAKGFRDQGRR  189 (190)
T ss_pred             ecccchhhccccCCCCcCccccccCC
Confidence            48999999999999999999998653


No 4  
>PF00907 T-box:  T-box;  InterPro: IPR001699 Transcription factors of the T-box family are required both for early cell-fate decisions, such as those necessary for formation of the basic vertebrate body plan, and for differentiation and organogenesis []. The T-box is defined as the minimal region within the T-box protein that is both necessary and sufficient for sequence-specific DNA binding, all members of the family so far examined bind to the DNA consensus sequence TCACACCT. The T-box is a relatively large DNA-binding domain, generally comprising about a third of the entire protein (17-26 kDa). These genes were uncovered on the basis of similarity to the DNA binding domain [] of Mus musculus (Mouse) Brachyury (T) gene product, which similarity is the defining feature of the family. The Brachyury gene is named for its phenotype, which was identified 70 years ago as a mutant mouse strain with a short blunted tail. The gene, and its paralogues, have become a well-studied model for the family, and hence much of what is known about the T-box family is derived from the murine Brachyury gene. Consistent with its nuclear location, Brachyury protein has a sequence-specific DNA-binding activity and can act as a transcriptional regulator []. Homozygous mutants for the gene undergo extensive developmental anomalies, thus rendering the mutation lethal []. The postulated role of Brachyury is as a transcription factor, regulating the specification and differentiation of posterior mesoderm during gastrulation in a dose-dependent manner []. T-box proteins tend to be expressed in specific organs or cell types, especially during development, and they are generally required for the development of those tissues, for example, Brachyury is expressed in posterior mesoderm and in the developing notochord, and it is required for the formation of these cells in mice []. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1H6F_B 4A04_A 1XBR_B 2X6V_B 2X6U_A.
Probab=98.73  E-value=9e-10  Score=75.70  Aligned_cols=24  Identities=63%  Similarity=0.951  Sum_probs=20.0

Q ss_pred             hhhhhccceeeecCCccccccccC
Q psy7380           9 QAYYKEITKLKIDSNPFAKGFRDS   32 (72)
Q Consensus         9 ~~qnqqIT~LKID~NPFAKgFRd~   32 (72)
                      .-||++|++|||++|||||||||.
T Consensus       161 ~Yqn~~I~~lK~~~Npfak~fr~~  184 (184)
T PF00907_consen  161 AYQNEEIRQLKIDNNPFAKGFRDK  184 (184)
T ss_dssp             S-SSHHHHHHHHHH-GGGGGGHH-
T ss_pred             ccchhhhhhhhhccCCCccccCCC
Confidence            458999999999999999999983


No 5  
>KOG3585|consensus
Probab=98.60  E-value=1e-08  Score=78.25  Aligned_cols=26  Identities=65%  Similarity=0.876  Sum_probs=23.3

Q ss_pred             hhhhccceeeecCCccccccccCCCc
Q psy7380          10 AYYKEITKLKIDSNPFAKGFRDSSRL   35 (72)
Q Consensus        10 ~qnqqIT~LKID~NPFAKgFRd~s~~   35 (72)
                      -||++||+|||++||||||||+....
T Consensus       187 YQn~~it~lKi~~Npfakgfr~~~~~  212 (328)
T KOG3585|consen  187 YQNQEITKLKIDNNPFAKGFRDNIEG  212 (328)
T ss_pred             eecceehhhcccCCcccccccccccc
Confidence            48999999999999999999998443


No 6  
>smart00811 Alpha_kinase Alpha-kinase family. This family is a novel family of eukaryotic protein kinase catalytic domains, which have no detectable similarity to conventional kinases. The family contains myosin heavy chain kinases and Elongation Factor-2 kinase and a bifunctional ion channel. This family is known as the alpha-kinase family. The structure of the kinase domain revealed unexpected similarity to eukaryotic protein kinases in the catalytic core as well as to metabolic enzymes with ATP-grasp domains.
Probab=71.39  E-value=2.2  Score=30.62  Aligned_cols=16  Identities=50%  Similarity=0.717  Sum_probs=13.5

Q ss_pred             hccceeeecCCccccc
Q psy7380          13 KEITKLKIDSNPFAKG   28 (72)
Q Consensus        13 qqIT~LKID~NPFAKg   28 (72)
                      .+.+.+||+.+|||+|
T Consensus         7 ~~~~~v~i~~~pFa~G   22 (198)
T smart00811        7 VSETGVKIELKPFAKG   22 (198)
T ss_pred             cccEEEEEcCCccCCC
Confidence            3566799999999996


No 7  
>PF13516 LRR_6:  Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A ....
Probab=33.84  E-value=27  Score=16.51  Aligned_cols=15  Identities=13%  Similarity=0.348  Sum_probs=9.5

Q ss_pred             hhccceeeecCCccc
Q psy7380          12 YKEITKLKIDSNPFA   26 (72)
Q Consensus        12 nqqIT~LKID~NPFA   26 (72)
                      |..++.|.|.+|.+.
T Consensus         1 ~~~L~~L~l~~n~i~   15 (24)
T PF13516_consen    1 NPNLETLDLSNNQIT   15 (24)
T ss_dssp             -TT-SEEE-TSSBEH
T ss_pred             CCCCCEEEccCCcCC
Confidence            457889999998753


No 8  
>COG1825 RplY Ribosomal protein L25 (general stress protein Ctc) [Translation, ribosomal structure and biogenesis]
Probab=32.92  E-value=11  Score=24.55  Aligned_cols=23  Identities=30%  Similarity=0.437  Sum_probs=18.4

Q ss_pred             hccceeeecCCccccccccCCCc
Q psy7380          13 KEITKLKIDSNPFAKGFRDSSRL   35 (72)
Q Consensus        13 qqIT~LKID~NPFAKgFRd~s~~   35 (72)
                      +..--+.+|+++|+|.||..+.+
T Consensus        35 ~~~v~i~l~~~~~~k~~~~~~~~   57 (93)
T COG1825          35 KEPVNIALDHHEFAKALRKLGYS   57 (93)
T ss_pred             CCCceEEEcHHHHHHHHhhcccc
Confidence            34456899999999999988743


No 9  
>PF08540 HMG_CoA_synt_C:  Hydroxymethylglutaryl-coenzyme A synthase C terminal;  InterPro: IPR013746 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase.  Hydroxymethylglutaryl-CoA synthase (2.3.3.10 from EC) catalyses the condensation of acetyl-CoA with acetoacetyl-CoA to produce HMG-CoA and CoA, the second reaction in the mevalonate-dependent isoprenoid biosynthesis pathway. HMG-CoA synthase contains an important catalytic cysteine residue that acts as a nucleophile in the first step of the reaction: the acetylation of the enzyme by acetyl-CoA (its first substrate) to produce an acetyl-enzyme thioester, releasing the reduced coenzyme A. The subsequent nucleophilic attack on acetoacetyl-CoA (its second substrate) leads to the formation of HMG-CoA []. HMG-CoA synthase occurs in eukaryotes, archaea and certain bacteria []. In vertebrates, there are two isozymes located in different subcellular compartments: a cytosolic form that is the starting point of the mevalonate pathway (leads to cholesterol and other sterolic and isoprenoid compounds), and a mitochondrial form responsible for ketone body biosynthesis. HMG-CoA is also found in other eukaryotes such as insects, plants and fungi []. In bacteria, isoprenoid precursors are generally synthesised via an alternative, non-mevalonate pathway, however a number of Gram-positive pathogens utilise a mevalonate pathway involving HMG-CoA synthase that is parallel to that found in eukaryotes [, ]. This entry represents the C-terminal domain of HMG-CoA synthase enzymes from both eukaryotes and prokaryotes.; GO: 0004421 hydroxymethylglutaryl-CoA synthase activity, 0008299 isoprenoid biosynthetic process; PDB: 1TXT_D 1TVZ_A 1X9E_B 2HDB_B 3V4X_A 3V4N_C 2P8U_A 2FA0_A 2F9A_A 2F82_A ....
Probab=32.12  E-value=7.7  Score=29.55  Aligned_cols=25  Identities=32%  Similarity=0.393  Sum_probs=17.2

Q ss_pred             hccccccCCCCCCCCCCcceeceee
Q psy7380          46 DRHFMGRILRDEYPPDTGKVVNTLY   70 (72)
Q Consensus        46 ~q~~~rsp~r~~~~~~~g~~~~~~~   70 (72)
                      .+.||||-+..++|.-+|+.+|+.|
T Consensus        15 ~yDFyKP~~~seyP~VDG~~S~~~Y   39 (282)
T PF08540_consen   15 VYDFYKPDLSSEYPVVDGKLSIQCY   39 (282)
T ss_dssp             --SEE-BTTT-SS-EE-HHHHHHHH
T ss_pred             chhccCCCCCCCCcEEchHHHHHHH
Confidence            4889999889999999999998876


No 10 
>PF08218 Citrate_ly_lig:  Citrate lyase ligase C-terminal domain;  InterPro: IPR013166 [Citrate (pro-3S)-lyase] ligase (6.2.1.22 from EC), also known as citrate lyase ligase, is responsible for acetylation of the prosthetic group (2-(5''-phosphoribosyl)-3'-dephosphocoenzyme-A) of the gamma subunit of citrate lyase. It converts the inactive thiol form of the enzyme to the active form. In Clostridium sphenoides, citrate lyase ligase actively degrades citrate. In Clostridium sporosphaeroides and Lactococcus lactis, however, the enzyme is under stringent regulatory control. The enzyme's activity in anaerobic bacteria is modulated by phosphorylation and dephosphorylation []. The proteins in this entry represent the C-terminal domain of citrate lyase ligase.; GO: 0008771 [citrate (pro-3S)-lyase] ligase activity
Probab=31.67  E-value=23  Score=26.26  Aligned_cols=17  Identities=35%  Similarity=0.681  Sum_probs=13.6

Q ss_pred             cceeeecCCcccccccc
Q psy7380          15 ITKLKIDSNPFAKGFRD   31 (72)
Q Consensus        15 IT~LKID~NPFAKgFRd   31 (72)
                      |..+-+..|||++|-|-
T Consensus         1 IgaIVMNaNPFT~GH~y   17 (182)
T PF08218_consen    1 IGAIVMNANPFTLGHRY   17 (182)
T ss_pred             CceEEEcCCCCccHHHH
Confidence            44667889999999883


No 11 
>PF10053 DUF2290:  Uncharacterized conserved protein (DUF2290);  InterPro: IPR018742  Members of this family of hypothetical bacterial proteins have no known function. 
Probab=30.92  E-value=29  Score=25.73  Aligned_cols=40  Identities=15%  Similarity=0.320  Sum_probs=30.2

Q ss_pred             CCccccccccCCCchh-hhhhhhhhhccccccCCCCCCCCC
Q psy7380          22 SNPFAKGFRDSSRLTE-FERQNVLFDRHFMGRILRDEYPPD   61 (72)
Q Consensus        22 ~NPFAKgFRd~s~~~~-~~~eail~~q~~~rsp~r~~~~~~   61 (72)
                      -+||.-.|.+.+-.-. .....-+++...+++|+|-+++|+
T Consensus        79 P~P~~~~~q~~~~~y~~D~~~~~i~~~~i~~~PiRfDyd~~  119 (196)
T PF10053_consen   79 PSPYLEDFQEEPEIYIEDYIYADIEEKRIVPSPIRFDYDPD  119 (196)
T ss_pred             cCcchhhhccCCcchHHHHHHHHHHhcccccCceEEecCcc
Confidence            4799999998866533 333355677888999999999993


No 12 
>TIGR03032 conserved hypothetical protein TIGR03032. This protein family is uncharacterized. A number of motifs are conserved perfectly among all member sequences. The function of this protein is unknown.
Probab=22.41  E-value=31  Score=27.72  Aligned_cols=8  Identities=75%  Similarity=1.356  Sum_probs=7.2

Q ss_pred             eeceeecC
Q psy7380          65 VVNTLYSC   72 (72)
Q Consensus        65 ~~~~~~~~   72 (72)
                      ++||+|||
T Consensus       117 fVNT~fSC  124 (335)
T TIGR03032       117 FVNTLFSC  124 (335)
T ss_pred             EEECccee
Confidence            68999999


No 13 
>PF13130 DUF3952:  Domain of unknown function (DUF3952)
Probab=21.52  E-value=33  Score=23.79  Aligned_cols=53  Identities=15%  Similarity=0.155  Sum_probs=35.3

Q ss_pred             eeeecCCccccccccCCCchhhhhhhhhhhccccccC--CCCCCCCCCcceeceeec
Q psy7380          17 KLKIDSNPFAKGFRDSSRLTEFERQNVLFDRHFMGRI--LRDEYPPDTGKVVNTLYS   71 (72)
Q Consensus        17 ~LKID~NPFAKgFRd~s~~~~~~~eail~~q~~~rsp--~r~~~~~~~g~~~~~~~~   71 (72)
                      +-||++-||.|+-++-.+..  ...|--.+|+++...  -++.-.-++|+-.+++|.
T Consensus        11 etKIeYe~~VKALDEGDMkt--VMSASDdGYAyV~e~~i~st~eekeDg~~~~~iyQ   65 (107)
T PF13130_consen   11 ETKIEYERFVKALDEGDMKT--VMSASDDGYAYVKERVIYSTFEEKEDGEHSKTIYQ   65 (107)
T ss_pred             eeeeehHHHHHHhcccchhh--eeccCCCceeEEEEEeeeeeeeeccCcceeeEEEe
Confidence            46999999999988766542  223333456655433  455566678888888873


No 14 
>PF11228 DUF3027:  Protein of unknown function (DUF3027);  InterPro: IPR021391  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=21.27  E-value=56  Score=24.50  Aligned_cols=17  Identities=35%  Similarity=0.765  Sum_probs=14.9

Q ss_pred             CCCCCCCcceeceeecC
Q psy7380          56 DEYPPDTGKVVNTLYSC   72 (72)
Q Consensus        56 ~~~~~~~g~~~~~~~~~   72 (72)
                      .++.|++|+||..-|.|
T Consensus       170 Ne~sp~DGrVVs~d~GC  186 (193)
T PF11228_consen  170 NEWSPADGRVVSLDHGC  186 (193)
T ss_pred             CCCCCCCCCEEccccCc
Confidence            46789999999999988


No 15 
>KOG0884|consensus
Probab=20.26  E-value=61  Score=23.69  Aligned_cols=20  Identities=30%  Similarity=0.571  Sum_probs=16.1

Q ss_pred             Cchhhhh-ccceeeecCCccc
Q psy7380           7 NNQAYYK-EITKLKIDSNPFA   26 (72)
Q Consensus         7 ~~~~qnq-qIT~LKID~NPFA   26 (72)
                      +-||-|+ .|..+-|-.||||
T Consensus       140 tyrpl~~~~ik~itihanp~a  160 (161)
T KOG0884|consen  140 TYRPLNDVHIKDITIHANPFA  160 (161)
T ss_pred             ccccchheeeeeeEEecCcCC
Confidence            4566665 5889999999998


Done!