Diaphorina citri psyllid: psy738

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--
MCGGVLEIATCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWLDEWKHFYYAINPENMI
ccccEEEEEccccCEEEcccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHcccccc
MCGGVLEIATCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWLDEWKHFYYAINPEN**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGGVLEIATCSHVGHVFRKSTPYTFPGGTSNIVNHNNARLAEVWLDEWKHFYYAINPENMI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polypeptide N-acetylgalactosaminyltransferase 1 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.confidentQ07537
Polypeptide N-acetylgalactosaminyltransferase 1 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.confidentQ10473
Polypeptide N-acetylgalactosaminyltransferase 1 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.confidentQ10472

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006493 [BP]protein O-linked glycosylationconfidentGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0004653 [MF]polypeptide N-acetylgalactosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008376, GO:0008194
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016266 [BP]O-glycan processingprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0030145 [MF]manganese ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0009312 [BP]oligosaccharide biosynthetic processprobableGO:1901576, GO:0005975, GO:0044238, GO:0009311, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0044723
GO:0018243 [BP]protein O-linked glycosylation via threonineprobableGO:0044237, GO:0044249, GO:0018210, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0018242 [BP]protein O-linked glycosylation via serineprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0018209, GO:0044238, GO:0006493, GO:0006486, GO:0005975, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0032580 [CC]Golgi cisterna membraneprobableGO:0043229, GO:0005622, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031985, GO:0031984, GO:0031090, GO:0016020, GO:0044431, GO:0005795, GO:0005794, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0002378 [BP]immunoglobulin biosynthetic processprobableGO:1901576, GO:0071704, GO:0043170, GO:0002376, GO:0002377, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0002440
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0043687 [BP]post-translational protein modificationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XHB, chain A
Confidence level:very confident
Coverage over the Query: 1-18,31-60
View the alignment between query and template
View the model in PyMOL