Diaphorina citri psyllid: psy7396


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
ILYTALGKTTKNHLKDLFSYHQVNILSAADGKCVAEMKISQEHTNTFGTLHGGMTATLVDYLSGCALLTHKNVMEESSKISHSGVSVDLHITYIRGAKIGEQIVIESSTKKCGKKLAFLDVLIKNKETGALVATGVHTKYIAGYS
ccHHHHcccccccccccHHccccEEEEEEccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccCEEEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEEEccc
***TALGKTTKNHLKDLFSYHQVNILSAADGKCVAEMKISQEHTNTFGTLHGGMTATLVDYLSGCALLTHKNVMEESSKISHSGVSVDLHITYIRGAKIGEQIVIESSTKKCGKKLAFLDVLIKNKETGALVATGVHTKYIAG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILYTALGKTTKNHLKDLFSYHQVNILSAADGKCVAEMKISQEHTNTFGTLHGGMTATLVDYLSGCALLTHKNVMEESSKISHSGVSVDLHITYIRGAKIGEQIVIESSTKKCGKKLAFLDVLIKNKETGALVATGVHTKYIAGYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative esterase C31F10.02 confidentP87304
Acyl-coenzyme A thioesterase 13 Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Has acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Can also hydrolyze 3-hydroxyphenylacetyl-CoA (in vitro).confidentQ9CQR4
Acyl-coenzyme A thioesterase 13 Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Has acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Can also hydrolyze 3-hydroxyphenylacetyl-CoA and 3,4-dihydrohyphenylacetyl-CoA (in vitro).confidentQ9NPJ3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0047617 [MF]acyl-CoA hydrolase activityprobableGO:0016787, GO:0016289, GO:0016790, GO:0016788, GO:0003824, GO:0003674
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005777 [CC]peroxisomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H4U, chain A
Confidence level:very confident
Coverage over the Query: 15-142
View the alignment between query and template
View the model in PyMOL