Diaphorina citri psyllid: psy7403

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
SVASQLILGQSVVAETYDSVTIYFSDIVGFTSLSAESTPLQVVELLNDLYTCFDSVIENFDVYKVIFVVLSEIYSISLAALDYESNNILDNLLSRMEQYANNLEALVEERTADYLEEKRKCEELLYQLLPKDYESNNILDNLLSRMEQYANNLEALVEERTADYLEEKRKCEELLYQLLPNCYQGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSPFTKEVLDTFGTFDLELRGEVEMKVETIGDAYMVVSGLPMRNGNLHAREIARMSLALLDTVVTFTIRHRPTDQLKLRIGMHTGCRDKFRDQSSFVSVASQLILGQSVVAETYDSVTIYFSDIVGFTSLSAESTPELRGEVEMKE
cHHHHHHccccccccccccEEEEEcccccHHHHHcccccHHHHHHHHHHHHHHccccccccEEEEEEEEEEcEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccccccHHHHccccccccccEEEEccccccccccccccccEEEEcHHHHHHHHccccccEEEEccccEEEccccccEEEEECcccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEEECccccccccccccHHHHHHHHHccccccccccccEEEEEEcccccEEEcccccccccccEEccc
SVASQLILGQSVVAETYDSVTIYFSDIVGFTSLSAESTPLQVVELLNDLYTCFDSVIENFDVYKVIFVVLSEIYSISLAALDYESNNILDNLLSRMEQYANNLEALVEERTADYLEEKRKCEELLYQLLPKDYESNNILDNLLSRMEQYANNLEALVEERTADYLEEKRKCEELLYQLLPNCYQGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSPFTKEVLDTFGTFDLELRGEVEMKVETIGDAYMVVSGLPMRNGNLHAREIARMSLALLDTVVTFTIRHRPTDQLKLRIGMHTGCRDKFRDQSSFVSVASQLILGQSVVAETYDSVTIYFSDIVGFTSLSAESTPELRGEVEMK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SVASQLILGQSVVAETYDSVTIYFSDIVGFTSLSAESTPLQVVELLNDLYTCFDSVIENFDVYKVIFVVLSEIYSISLAALDYESNNIxxxxxxxxxxxxxxxxxxxxxRTADYLEEKRKCEELLYQLLPKDYESNNIxxxxxxxxxxxxxxxxxxxxxRTADYLEEKRKCEELLYQLLPNCYQGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSPFTKEVLDTFGTFDLELRGEVEMKVETIGDAYMVVSGLPMRNGNLHAREIARMSLALLDTVVTFTIRHRPTDQLKLRIGMHTGCRDKFRDQSSFVSVASQLILGQSVVAETYDSVTIYFSDIVGFTSLSAESTPELRGEVEMKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Atrial natriuretic peptide receptor 1 Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.confidentP16066

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0001653 [MF]peptide receptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0004383 [MF]guanylate cyclase activityprobableGO:0009975, GO:0003824, GO:0016829, GO:0016849, GO:0003674
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0043679 [CC]axon terminusprobableGO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0006182 [BP]cGMP biosynthetic processprobableGO:0009187, GO:0044249, GO:0034641, GO:0009165, GO:0044237, GO:0072521, GO:0072522, GO:1901362, GO:0046068, GO:1901360, GO:1901576, GO:0044710, GO:0052652, GO:0009259, GO:0008150, GO:0071704, GO:0009190, GO:0018130, GO:0009987, GO:0006139, GO:0006793, GO:0006725, GO:0009152, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:0044281
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UVJ, chain A
Confidence level:very confident
Coverage over the Query: 10-98,123-128,162-262
View the alignment between query and template
View the model in PyMOL
Template: 3UVJ, chain A
Confidence level:very confident
Coverage over the Query: 196-367
View the alignment between query and template
View the model in PyMOL
Template: 1FX2, chain A
Confidence level:very confident
Coverage over the Query: 9-98,123-263
View the alignment between query and template
View the model in PyMOL