Diaphorina citri psyllid: psy7404

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190------

SLVQDLNTLQASDSFEAWRLKESHDLSDLVQRRLEYLQNPSDCRTAKKLVCTLNKGCGYGCQLHHVVYCFIVAYATQRTLILKSKGWRYARGGWEEVFEPVSKTCTSPEGASTSSWPGHDETQVIKLPVIDSISPRPAYLPLSIPKDLEPRLSRLHGDPIVWWIGQILKYLFKPQPKTRDFLSKYGEKINFQKPIV

cHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEECcccccccHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccc

SLVQDLNTLQASD****WRL***HDLSDLVQRRLEYLQNPSDCRTAKKLVCTLNKGCGYGCQLHHVVYCFIVAYATQRTLILKSKGWRYARGGWEEVFEPVSKTCT********SWPGHDETQVIKLPVIDSISPRPAYLPLSIPKDLEPRLSRLHGDPIVWWIGQILKYLFKPQPKTRDFLSKYGEKINFQKPIV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SLVQDLNTLQASDSFEAWRLKESHDLSDLVQRRLEYLQNPSDCRTAKKLVCTLNKGCGYGCQLHHVVYCFIVAYATQRTLILKSKGWRYARGGWEEVFEPVSKTCTSPEGASTSSWPGHDETQVIKLPVIDSISPRPAYLPLSIPKDLEPRLSRLHGDPIVWWIGQILKYLFKPQPKTRDFLSKYGEKINFQKPIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Alpha-(1,6)-fucosyltransferase	Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.	confident	Q659X0
Alpha-(1,6)-fucosyltransferase	Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.	confident	Q9VYV5
Alpha-(1,6)-fucosyltransferase	Catalyzes the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans.	confident	Q9WTS2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0046921 [MF]	alpha-(1->6)-fucosyltransferase activity	probable	GO:0008417, GO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758
GO:0036065 [BP]	fucosylation	probable	GO:0044238, GO:0005975, GO:0070085, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0044260 [BP]	cellular macromolecule metabolic process	probable	GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DE0, chain X
Confidence level:very confident
Coverage over the Query: 1-196
View the alignment between query and template
View the model in PyMOL