Query         psy7405
Match_columns 87
No_of_seqs    17 out of 19
Neff          2.0 
Searched_HMMs 46136
Date          Fri Aug 16 17:25:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7405.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7405hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG1875 NYN ribonuclease and A  36.6      23  0.0005   30.4   1.8   45   23-68    186-233 (436)
  2 PF12936 Kri1_C:  KRI1-like fam  34.8      10 0.00022   25.7  -0.5   19   49-67     29-47  (93)
  3 PF11752 DUF3309:  Protein of u  24.3      40 0.00087   21.2   0.9   13   21-33     13-25  (49)
  4 PF09736 Bud13:  Pre-mRNA-splic  22.3      76  0.0016   22.6   2.1   26   32-58    107-133 (145)
  5 PF02756 GYR:  GYR motif;  Inte  17.3      46   0.001   17.4   0.1   13   47-59      2-14  (18)
  6 PF03597 CcoS:  Cytochrome oxid  15.8      54  0.0012   19.6   0.2   14   32-45     28-41  (45)
  7 PF15374 CCDC71L:  Coiled-coil   15.5      62  0.0013   27.3   0.5   35   16-63     26-68  (376)
  8 smart00713 GYR Motif of unknow  14.2      65  0.0014   18.1   0.2   13   47-59      2-14  (26)
  9 COG3197 FixS Uncharacterized p  13.1      65  0.0014   20.8  -0.0   14   32-45     29-42  (58)
 10 PF03338 Pox_J1:  Poxvirus J1 p  12.2      74  0.0016   23.8   0.0   16   42-57     53-68  (145)

No 1  
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General    function prediction only]
Probab=36.55  E-value=23  Score=30.39  Aligned_cols=45  Identities=29%  Similarity=0.551  Sum_probs=31.8

Q ss_pred             CCCCCCCccccccCCCCCCcccccCCccccccc---ccccccCcccCCC
Q psy7405          23 EYPTYPSFKSIYDDPVNPHERINIPGYRYLPIS---RETYGISPRNIQP   68 (87)
Q Consensus        23 d~Ptwp~~ksIyddp~~a~~RI~sPGY~Y~PVs---RetYGySPR~Iy~   68 (87)
                      +-|-+|+ --+-.+...|.+|+++-|=..++++   ++++|++||+++.
T Consensus       186 ~~~~~~~-f~l~~~~~~a~g~~~~~~~~i~~l~~~~~~vwGi~prn~eQ  233 (436)
T COG1875         186 DLPCYPG-FRLLGSSSSALGRVNPNGKVILLLKHEDQEVWGIRPRNAEQ  233 (436)
T ss_pred             cCCCCCC-eeecCccccceeeecCCCCEEEecccCchhhhccCcccHHH
Confidence            3444444 1223333788999999888888555   8999999999864


No 2  
>PF12936 Kri1_C:  KRI1-like family C-terminal;  InterPro: IPR024626 The yeast member of the Kri1-like family (Kri1p) is found to be required for 40S ribosome biogenesis in the nucleolus []. This entry represents the C-terminal domain of this protein family.
Probab=34.84  E-value=10  Score=25.66  Aligned_cols=19  Identities=16%  Similarity=0.662  Sum_probs=17.4

Q ss_pred             cccccccccccccCcccCC
Q psy7405          49 YRYLPISRETYGISPRNIQ   67 (87)
Q Consensus        49 Y~Y~PVsRetYGySPR~Iy   67 (87)
                      ++|..|.-+.||+|.+-|-
T Consensus        29 FkYr~V~p~~fGLt~~eIL   47 (93)
T PF12936_consen   29 FKYREVPPNSFGLTTEEIL   47 (93)
T ss_pred             eeeeecCcccCCCCHHHHH
Confidence            9999999999999998773


No 3  
>PF11752 DUF3309:  Protein of unknown function (DUF3309);  InterPro: IPR021738  This family is conserved in bacteria but its function is not known. 
Probab=24.25  E-value=40  Score=21.15  Aligned_cols=13  Identities=31%  Similarity=0.585  Sum_probs=9.5

Q ss_pred             ccCCCCCCCcccc
Q psy7405          21 ISEYPTYPSFKSI   33 (87)
Q Consensus        21 ~~d~Ptwp~~ksI   33 (87)
                      .-..|+||++++-
T Consensus        13 igalP~wp~sr~w   25 (49)
T PF11752_consen   13 IGALPTWPYSRGW   25 (49)
T ss_pred             HhcCCCCCCCCCC
Confidence            3457899998764


No 4  
>PF09736 Bud13:  Pre-mRNA-splicing factor of RES complex;  InterPro: IPR018609 Bud site selection protein 13, also known as pre-mRNA-splicing factor CWC26, belongs to the pre-mRNA retention and splicing (RES) complex. May also be involved in positioning the proximal bud pole signal [, , ]. The presence of RES subunit homologues in numerous eukaryotes suggests that its function is evolutionarily conserved [].
Probab=22.33  E-value=76  Score=22.57  Aligned_cols=26  Identities=35%  Similarity=0.768  Sum_probs=18.7

Q ss_pred             ccccCCCCCCcccc-cCCcccccccccc
Q psy7405          32 SIYDDPVNPHERIN-IPGYRYLPISRET   58 (87)
Q Consensus        32 sIyddp~~a~~RI~-sPGY~Y~PVsRet   58 (87)
                      ..|.-|--+ +|.. -||||++=|.|-+
T Consensus       107 ~~Y~G~~pp-NRFgI~PGyRWDGVDRsN  133 (145)
T PF09736_consen  107 PKYKGPFPP-NRFGIRPGYRWDGVDRSN  133 (145)
T ss_pred             CCCCCCCCC-CcCCCCCCCCCCCcccCC
Confidence            445444444 8888 7999999998853


No 5  
>PF02756 GYR:  GYR motif;  InterPro: IPR004011 The GYR motif is found in several Drosophila melanogaster proteins, in either single or multiple copies. Its function is unknown, however the presence of completely conserved tyrosine residues may suggest it could be a substrate for tyrosine kinases.
Probab=17.25  E-value=46  Score=17.37  Aligned_cols=13  Identities=46%  Similarity=0.945  Sum_probs=10.0

Q ss_pred             CCccccccccccc
Q psy7405          47 PGYRYLPISRETY   59 (87)
Q Consensus        47 PGY~Y~PVsRetY   59 (87)
                      -||+|..|.|-.|
T Consensus         2 dGYrYkTvrrl~~   14 (18)
T PF02756_consen    2 DGYRYKTVRRLKY   14 (18)
T ss_pred             CcceeeEeEEEee
Confidence            3899999887554


No 6  
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=15.78  E-value=54  Score=19.59  Aligned_cols=14  Identities=36%  Similarity=0.527  Sum_probs=11.6

Q ss_pred             ccccCCCCCCcccc
Q psy7405          32 SIYDDPVNPHERIN   45 (87)
Q Consensus        32 sIyddp~~a~~RI~   45 (87)
                      -=|||.+.++.||.
T Consensus        28 GQfdD~e~~a~riL   41 (45)
T PF03597_consen   28 GQFDDLEGPAHRIL   41 (45)
T ss_pred             CCCCCCcchHhhhh
Confidence            34899999999984


No 7  
>PF15374 CCDC71L:  Coiled-coil domain-containing protein 71L
Probab=15.55  E-value=62  Score=27.32  Aligned_cols=35  Identities=17%  Similarity=0.502  Sum_probs=23.9

Q ss_pred             ccCCcccCCC-----CCCCccccccCCCCCCcccccCCcccccc---cccccccCc
Q psy7405          16 FYRPFISEYP-----TYPSFKSIYDDPVNPHERINIPGYRYLPI---SRETYGISP   63 (87)
Q Consensus        16 ~frp~~~d~P-----twp~~ksIyddp~~a~~RI~sPGY~Y~PV---sRetYGySP   63 (87)
                      +|-|.+-|+.     -|-|-.++=+|             .|.|.   |+|.||||-
T Consensus        26 vF~PmS~dl~~te~qLv~Flq~Lr~e-------------GfqP~ILrSkDVYGYsS   68 (376)
T PF15374_consen   26 VFNPMSKDLSDTEAQLVAFLQGLRHE-------------GFQPTILRSKDVYGYSS   68 (376)
T ss_pred             HhCccccccchhHHHHHHHHHHHhhc-------------CCCceeecccccccccc
Confidence            5677766766     35555555444             36788   999999984


No 8  
>smart00713 GYR Motif of unknown function with conserved Gly, Tyr, Arg tripeptide in Drosophila proteins.
Probab=14.21  E-value=65  Score=18.13  Aligned_cols=13  Identities=38%  Similarity=0.746  Sum_probs=10.4

Q ss_pred             CCccccccccccc
Q psy7405          47 PGYRYLPISRETY   59 (87)
Q Consensus        47 PGY~Y~PVsRetY   59 (87)
                      -||+|..|-|-.|
T Consensus         2 dGYrYKTvRR~~~   14 (26)
T smart00713        2 DGYRYKTVRRLKL   14 (26)
T ss_pred             Cceeeeehhheee
Confidence            4999999987654


No 9  
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=13.14  E-value=65  Score=20.84  Aligned_cols=14  Identities=50%  Similarity=0.643  Sum_probs=11.7

Q ss_pred             ccccCCCCCCcccc
Q psy7405          32 SIYDDPVNPHERIN   45 (87)
Q Consensus        32 sIyddp~~a~~RI~   45 (87)
                      -=|||.+.++|||-
T Consensus        29 gQyDDl~g~ae~IL   42 (58)
T COG3197          29 GQYDDLDGPAERIL   42 (58)
T ss_pred             CCcccccccHHHHh
Confidence            34999999999985


No 10 
>PF03338 Pox_J1:  Poxvirus J1 protein;  InterPro: IPR005006 This is a family of proteins expressed by members of the Poxviridae.
Probab=12.18  E-value=74  Score=23.80  Aligned_cols=16  Identities=38%  Similarity=0.823  Sum_probs=13.2

Q ss_pred             cccccCCccccccccc
Q psy7405          42 ERINIPGYRYLPISRE   57 (87)
Q Consensus        42 ~RI~sPGY~Y~PVsRe   57 (87)
                      |...+=||+|.|+|.+
T Consensus        53 dKLEaiG~~YeplSe~   68 (145)
T PF03338_consen   53 DKLEAIGYCYEPLSEE   68 (145)
T ss_pred             HHHHHccccccchhHH
Confidence            4556779999999987


Done!