Query psy7405
Match_columns 87
No_of_seqs 17 out of 19
Neff 2.0
Searched_HMMs 46136
Date Fri Aug 16 17:25:18 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy7405.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7405hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 COG1875 NYN ribonuclease and A 36.6 23 0.0005 30.4 1.8 45 23-68 186-233 (436)
2 PF12936 Kri1_C: KRI1-like fam 34.8 10 0.00022 25.7 -0.5 19 49-67 29-47 (93)
3 PF11752 DUF3309: Protein of u 24.3 40 0.00087 21.2 0.9 13 21-33 13-25 (49)
4 PF09736 Bud13: Pre-mRNA-splic 22.3 76 0.0016 22.6 2.1 26 32-58 107-133 (145)
5 PF02756 GYR: GYR motif; Inte 17.3 46 0.001 17.4 0.1 13 47-59 2-14 (18)
6 PF03597 CcoS: Cytochrome oxid 15.8 54 0.0012 19.6 0.2 14 32-45 28-41 (45)
7 PF15374 CCDC71L: Coiled-coil 15.5 62 0.0013 27.3 0.5 35 16-63 26-68 (376)
8 smart00713 GYR Motif of unknow 14.2 65 0.0014 18.1 0.2 13 47-59 2-14 (26)
9 COG3197 FixS Uncharacterized p 13.1 65 0.0014 20.8 -0.0 14 32-45 29-42 (58)
10 PF03338 Pox_J1: Poxvirus J1 p 12.2 74 0.0016 23.8 0.0 16 42-57 53-68 (145)
No 1
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]
Probab=36.55 E-value=23 Score=30.39 Aligned_cols=45 Identities=29% Similarity=0.551 Sum_probs=31.8
Q ss_pred CCCCCCCccccccCCCCCCcccccCCccccccc---ccccccCcccCCC
Q psy7405 23 EYPTYPSFKSIYDDPVNPHERINIPGYRYLPIS---RETYGISPRNIQP 68 (87)
Q Consensus 23 d~Ptwp~~ksIyddp~~a~~RI~sPGY~Y~PVs---RetYGySPR~Iy~ 68 (87)
+-|-+|+ --+-.+...|.+|+++-|=..++++ ++++|++||+++.
T Consensus 186 ~~~~~~~-f~l~~~~~~a~g~~~~~~~~i~~l~~~~~~vwGi~prn~eQ 233 (436)
T COG1875 186 DLPCYPG-FRLLGSSSSALGRVNPNGKVILLLKHEDQEVWGIRPRNAEQ 233 (436)
T ss_pred cCCCCCC-eeecCccccceeeecCCCCEEEecccCchhhhccCcccHHH
Confidence 3444444 1223333788999999888888555 8999999999864
No 2
>PF12936 Kri1_C: KRI1-like family C-terminal; InterPro: IPR024626 The yeast member of the Kri1-like family (Kri1p) is found to be required for 40S ribosome biogenesis in the nucleolus []. This entry represents the C-terminal domain of this protein family.
Probab=34.84 E-value=10 Score=25.66 Aligned_cols=19 Identities=16% Similarity=0.662 Sum_probs=17.4
Q ss_pred cccccccccccccCcccCC
Q psy7405 49 YRYLPISRETYGISPRNIQ 67 (87)
Q Consensus 49 Y~Y~PVsRetYGySPR~Iy 67 (87)
++|..|.-+.||+|.+-|-
T Consensus 29 FkYr~V~p~~fGLt~~eIL 47 (93)
T PF12936_consen 29 FKYREVPPNSFGLTTEEIL 47 (93)
T ss_pred eeeeecCcccCCCCHHHHH
Confidence 9999999999999998773
No 3
>PF11752 DUF3309: Protein of unknown function (DUF3309); InterPro: IPR021738 This family is conserved in bacteria but its function is not known.
Probab=24.25 E-value=40 Score=21.15 Aligned_cols=13 Identities=31% Similarity=0.585 Sum_probs=9.5
Q ss_pred ccCCCCCCCcccc
Q psy7405 21 ISEYPTYPSFKSI 33 (87)
Q Consensus 21 ~~d~Ptwp~~ksI 33 (87)
.-..|+||++++-
T Consensus 13 igalP~wp~sr~w 25 (49)
T PF11752_consen 13 IGALPTWPYSRGW 25 (49)
T ss_pred HhcCCCCCCCCCC
Confidence 3457899998764
No 4
>PF09736 Bud13: Pre-mRNA-splicing factor of RES complex; InterPro: IPR018609 Bud site selection protein 13, also known as pre-mRNA-splicing factor CWC26, belongs to the pre-mRNA retention and splicing (RES) complex. May also be involved in positioning the proximal bud pole signal [, , ]. The presence of RES subunit homologues in numerous eukaryotes suggests that its function is evolutionarily conserved [].
Probab=22.33 E-value=76 Score=22.57 Aligned_cols=26 Identities=35% Similarity=0.768 Sum_probs=18.7
Q ss_pred ccccCCCCCCcccc-cCCcccccccccc
Q psy7405 32 SIYDDPVNPHERIN-IPGYRYLPISRET 58 (87)
Q Consensus 32 sIyddp~~a~~RI~-sPGY~Y~PVsRet 58 (87)
..|.-|--+ +|.. -||||++=|.|-+
T Consensus 107 ~~Y~G~~pp-NRFgI~PGyRWDGVDRsN 133 (145)
T PF09736_consen 107 PKYKGPFPP-NRFGIRPGYRWDGVDRSN 133 (145)
T ss_pred CCCCCCCCC-CcCCCCCCCCCCCcccCC
Confidence 445444444 8888 7999999998853
No 5
>PF02756 GYR: GYR motif; InterPro: IPR004011 The GYR motif is found in several Drosophila melanogaster proteins, in either single or multiple copies. Its function is unknown, however the presence of completely conserved tyrosine residues may suggest it could be a substrate for tyrosine kinases.
Probab=17.25 E-value=46 Score=17.37 Aligned_cols=13 Identities=46% Similarity=0.945 Sum_probs=10.0
Q ss_pred CCccccccccccc
Q psy7405 47 PGYRYLPISRETY 59 (87)
Q Consensus 47 PGY~Y~PVsRetY 59 (87)
-||+|..|.|-.|
T Consensus 2 dGYrYkTvrrl~~ 14 (18)
T PF02756_consen 2 DGYRYKTVRRLKY 14 (18)
T ss_pred CcceeeEeEEEee
Confidence 3899999887554
No 6
>PF03597 CcoS: Cytochrome oxidase maturation protein cbb3-type; InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase.
Probab=15.78 E-value=54 Score=19.59 Aligned_cols=14 Identities=36% Similarity=0.527 Sum_probs=11.6
Q ss_pred ccccCCCCCCcccc
Q psy7405 32 SIYDDPVNPHERIN 45 (87)
Q Consensus 32 sIyddp~~a~~RI~ 45 (87)
-=|||.+.++.||.
T Consensus 28 GQfdD~e~~a~riL 41 (45)
T PF03597_consen 28 GQFDDLEGPAHRIL 41 (45)
T ss_pred CCCCCCcchHhhhh
Confidence 34899999999984
No 7
>PF15374 CCDC71L: Coiled-coil domain-containing protein 71L
Probab=15.55 E-value=62 Score=27.32 Aligned_cols=35 Identities=17% Similarity=0.502 Sum_probs=23.9
Q ss_pred ccCCcccCCC-----CCCCccccccCCCCCCcccccCCcccccc---cccccccCc
Q psy7405 16 FYRPFISEYP-----TYPSFKSIYDDPVNPHERINIPGYRYLPI---SRETYGISP 63 (87)
Q Consensus 16 ~frp~~~d~P-----twp~~ksIyddp~~a~~RI~sPGY~Y~PV---sRetYGySP 63 (87)
+|-|.+-|+. -|-|-.++=+| .|.|. |+|.||||-
T Consensus 26 vF~PmS~dl~~te~qLv~Flq~Lr~e-------------GfqP~ILrSkDVYGYsS 68 (376)
T PF15374_consen 26 VFNPMSKDLSDTEAQLVAFLQGLRHE-------------GFQPTILRSKDVYGYSS 68 (376)
T ss_pred HhCccccccchhHHHHHHHHHHHhhc-------------CCCceeecccccccccc
Confidence 5677766766 35555555444 36788 999999984
No 8
>smart00713 GYR Motif of unknown function with conserved Gly, Tyr, Arg tripeptide in Drosophila proteins.
Probab=14.21 E-value=65 Score=18.13 Aligned_cols=13 Identities=38% Similarity=0.746 Sum_probs=10.4
Q ss_pred CCccccccccccc
Q psy7405 47 PGYRYLPISRETY 59 (87)
Q Consensus 47 PGY~Y~PVsRetY 59 (87)
-||+|..|-|-.|
T Consensus 2 dGYrYKTvRR~~~ 14 (26)
T smart00713 2 DGYRYKTVRRLKL 14 (26)
T ss_pred Cceeeeehhheee
Confidence 4999999987654
No 9
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=13.14 E-value=65 Score=20.84 Aligned_cols=14 Identities=50% Similarity=0.643 Sum_probs=11.7
Q ss_pred ccccCCCCCCcccc
Q psy7405 32 SIYDDPVNPHERIN 45 (87)
Q Consensus 32 sIyddp~~a~~RI~ 45 (87)
-=|||.+.++|||-
T Consensus 29 gQyDDl~g~ae~IL 42 (58)
T COG3197 29 GQYDDLDGPAERIL 42 (58)
T ss_pred CCcccccccHHHHh
Confidence 34999999999985
No 10
>PF03338 Pox_J1: Poxvirus J1 protein; InterPro: IPR005006 This is a family of proteins expressed by members of the Poxviridae.
Probab=12.18 E-value=74 Score=23.80 Aligned_cols=16 Identities=38% Similarity=0.823 Sum_probs=13.2
Q ss_pred cccccCCccccccccc
Q psy7405 42 ERINIPGYRYLPISRE 57 (87)
Q Consensus 42 ~RI~sPGY~Y~PVsRe 57 (87)
|...+=||+|.|+|.+
T Consensus 53 dKLEaiG~~YeplSe~ 68 (145)
T PF03338_consen 53 DKLEAIGYCYEPLSEE 68 (145)
T ss_pred HHHHHccccccchhHH
Confidence 4556779999999987
Done!