Query         psy7408
Match_columns 66
No_of_seqs    12 out of 14
Neff          1.6 
Searched_HMMs 46136
Date          Fri Aug 16 17:29:11 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7408.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7408hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK09790 hypothetical protein;  77.1     1.2 2.6E-05   29.7   1.0   26    7-32     63-89  (91)
  2 PF02290 SRP14:  Signal recogni  72.9     2.1 4.5E-05   26.9   1.2   18   18-35     74-91  (93)
  3 PF00846 Hanta_nucleocap:  Hant  57.9     3.4 7.3E-05   33.6   0.0   18   12-29    350-367 (428)
  4 PF08589 DUF1770:  Fungal prote  52.2     8.9 0.00019   25.6   1.3   19   16-34     72-90  (100)
  5 cd00148 PROF Profilin binds ac  47.4      10 0.00023   24.1   1.0   11   23-33      2-13  (127)
  6 PF00690 Cation_ATPase_N:  Cati  46.5      18 0.00039   20.2   1.8   28    5-32     28-56  (69)
  7 PF03909 BSD:  BSD domain  ;  I  43.6      14 0.00031   21.0   1.1   14   18-31     40-53  (62)
  8 TIGR03354 VI_FHA type VI secre  37.4      21 0.00046   27.3   1.5   16   15-30    353-368 (396)
  9 PF00235 Profilin:  Profilin;    36.9      22 0.00048   21.6   1.3   13   23-35      2-15  (121)
 10 PF01806 Paramyxo_P:  Paramyxov  35.9      25 0.00055   27.0   1.7   24    7-32    204-227 (248)
 11 smart00831 Cation_ATPase_N Cat  35.2      27 0.00059   18.9   1.4   29    4-32     17-46  (64)
 12 PF04959 ARS2:  Arsenite-resist  33.1      29 0.00062   25.2   1.6   27    3-32     98-124 (214)
 13 smart00751 BSD domain in trans  32.3      36 0.00079   18.7   1.6   13   19-31     36-48  (51)
 14 PF09053 CagZ:  CagZ;  InterPro  29.9      33 0.00072   25.4   1.4   17   19-35     28-44  (199)
 15 PTZ00316 profilin; Provisional  27.7      35 0.00076   23.9   1.2   12   23-34      3-15  (150)
 16 KOG0750|consensus               27.5      39 0.00084   26.7   1.5   25    9-33    198-222 (304)
 17 KOG1761|consensus               27.2      35 0.00076   23.5   1.1   15   21-35     79-93  (116)
 18 smart00392 PROF Profilin. Bind  24.2      43 0.00093   21.2   1.0   11   23-33      3-14  (129)
 19 PF01639 v110:  Viral family 11  23.7      16 0.00034   24.9  -1.1   17   14-30     26-42  (110)
 20 PF09628 YvfG:  YvfG protein;    21.7      48   0.001   21.2   0.9   28    3-33     12-39  (68)
 21 PF11393 IcmL:  Macrophage kill  21.6      52  0.0011   20.6   1.1   17   21-37     53-69  (108)
 22 PF03245 Phage_lysis:  Bacterio  21.1      63  0.0014   21.0   1.4   24    7-30    100-123 (125)
 23 PF10446 DUF2457:  Protein of u  20.1      66  0.0014   26.5   1.6   13   17-29    401-413 (458)

No 1  
>PRK09790 hypothetical protein; Reviewed
Probab=77.09  E-value=1.2  Score=29.68  Aligned_cols=26  Identities=42%  Similarity=0.690  Sum_probs=21.3

Q ss_pred             hhhhccCCchhhHHHHHHHHHH-hhcc
Q psy7408           7 LDMIGRNEPITRKAKFWQSYVR-ALKG   32 (66)
Q Consensus         7 LdMIGrNE~~skKAkFWqsYvr-aLKG   32 (66)
                      |--||.|-|..||+.||...+. .|||
T Consensus        63 lv~ig~nlpaekk~~f~atliamklkg   89 (91)
T PRK09790         63 LVHIGKNLPAEKKAEFLATLIAMKLKG   89 (91)
T ss_pred             EEEecCCCCccccccHHHHHHHHHHcc
Confidence            4569999999999999999874 3555


No 2  
>PF02290 SRP14:  Signal recognition particle 14kD protein;  InterPro: IPR003210  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the 14 kDa SRP14 component. Both SRP9 and SRP14 have the same (beta)-alpha-beta(3)-alpha fold. The heterodimer has pseudo two-fold symmetry and is saddle-like, consisting of a curved six-stranded beta-sheet that has four helices packed on the convex side and an exposed concave surface lined with positively charged residues. The SRP9/SRP14 heterodimer is essential for SRP RNA binding, mediating the pausing of synthesis of ribosome associated nascent polypeptides that have been engaged by the targeting domain of SRP [].; GO: 0008312 7S RNA binding, 0030942 endoplasmic reticulum signal peptide binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0005786 signal recognition particle, endoplasmic reticulum targeting; PDB: 1914_A 1RY1_D 1E8O_B 2W9J_B.
Probab=72.89  E-value=2.1  Score=26.93  Aligned_cols=18  Identities=44%  Similarity=0.780  Sum_probs=14.6

Q ss_pred             hHHHHHHHHHHhhccccc
Q psy7408          18 RKAKFWQSYVRALKGSTA   35 (66)
Q Consensus        18 kKAkFWqsYvraLKGs~D   35 (66)
                      .=.+||++|...||++=|
T Consensus        74 ~l~~F~~~Y~~v~K~~M~   91 (93)
T PF02290_consen   74 DLDKFWQSYANVLKAGMD   91 (93)
T ss_dssp             CHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHhhCc
Confidence            347899999999998643


No 3  
>PF00846 Hanta_nucleocap:  Hantavirus nucleocapsid protein;  InterPro: IPR002214 Hantaviruses are ssRNA negative-strand viruses. The nucleocapsid protein is an internal protein of the virus particle [, ].; GO: 0019013 viral nucleocapsid; PDB: 2IC9_A 2IC6_A 2K48_A 4FI5_A.
Probab=57.88  E-value=3.4  Score=33.64  Aligned_cols=18  Identities=39%  Similarity=0.796  Sum_probs=0.0

Q ss_pred             cCCchhhHHHHHHHHHHh
Q psy7408          12 RNEPITRKAKFWQSYVRA   29 (66)
Q Consensus        12 rNE~~skKAkFWqsYvra   29 (66)
                      ..|-+-||..|.|||+|.
T Consensus       350 AEEKlkkkssfyqsylrr  367 (428)
T PF00846_consen  350 AEEKLKKKSSFYQSYLRR  367 (428)
T ss_dssp             ------------------
T ss_pred             HHHHHHhhhHHHHHHHHH
Confidence            357789999999999985


No 4  
>PF08589 DUF1770:  Fungal protein of unknown function (DUF1770);  InterPro: IPR013898  The functions of these proteins are unknown. They are rather dissimilar except for a single strongly conserved motif (PDLRFEQ). 
Probab=52.20  E-value=8.9  Score=25.58  Aligned_cols=19  Identities=21%  Similarity=0.359  Sum_probs=15.2

Q ss_pred             hhhHHHHHHHHHHhhcccc
Q psy7408          16 ITRKAKFWQSYVRALKGST   34 (66)
Q Consensus        16 ~skKAkFWqsYvraLKGs~   34 (66)
                      +----+|=|||+.+++|.+
T Consensus        72 PlPDLRFEQSYL~SI~~A~   90 (100)
T PF08589_consen   72 PLPDLRFEQSYLASIRKAD   90 (100)
T ss_pred             CCCcchhHHHHHHHHhccc
Confidence            3334689999999999876


No 5  
>cd00148 PROF Profilin binds actin monomers, membrane polyphosphoinositides such as PI(4,5)P2, and poly-L-proline. Profilin can inhibit actin polymerization into F-actin by binding to monomeric actin (G-actin) and terminal F-actin subunits, but - as a regulator of the cytoskeleton - it may also promote actin polymerization. It plays a role in the assembly of branched actin filament networks, by activating WASP via binding to WASP's proline rich domain. Profilin may link the cytoskeleton with major signalling pathways by interacting with components of the phosphatidylinositol cycle and Ras pathway.
Probab=47.37  E-value=10  Score=24.14  Aligned_cols=11  Identities=55%  Similarity=1.168  Sum_probs=9.6

Q ss_pred             HHHHHH-hhccc
Q psy7408          23 WQSYVR-ALKGS   33 (66)
Q Consensus        23 WqsYvr-aLKGs   33 (66)
                      ||+||. .|-|+
T Consensus         2 Wq~yvd~~L~~~   13 (127)
T cd00148           2 WQAYVDDNLLGT   13 (127)
T ss_pred             hHHHHHHHHhhc
Confidence            999999 68776


No 6  
>PF00690 Cation_ATPase_N:  Cation transporter/ATPase, N-terminus;  InterPro: IPR004014 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2.  This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+ (3.6.3.6 from EC), Na+ (3.6.3.7 from EC), Ca2+ (3.6.3.8 from EC), Na+/K+ (3.6.3.9 from EC), and H+/K+ (3.6.3.10 from EC). In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases [, ]. More information about this protein can be found at Protein of the Month: ATP Synthases [].; PDB: 3KDP_C 3N2F_A 3B8E_A 3N23_A 2XZB_A 1MHS_B 3A3Y_A 2ZXE_A 3B8C_A 3B9B_A ....
Probab=46.53  E-value=18  Score=20.25  Aligned_cols=28  Identities=21%  Similarity=0.515  Sum_probs=22.5

Q ss_pred             hhhhhhccCCc-hhhHHHHHHHHHHhhcc
Q psy7408           5 QHLDMIGRNEP-ITRKAKFWQSYVRALKG   32 (66)
Q Consensus         5 ~HLdMIGrNE~-~skKAkFWqsYvraLKG   32 (66)
                      ..++-+|.|+- ..++..+|+-+++.++.
T Consensus        28 ~r~~~~G~N~l~~~~~~s~~~~~~~~f~~   56 (69)
T PF00690_consen   28 ERRKKYGPNELPEPKKKSLWRIFLKQFKN   56 (69)
T ss_dssp             HHHHHHSSSSTTTTTSSSHHHHHHHHTTS
T ss_pred             HHHHhcccccccccccCcHHHHHHHHHHh
Confidence            45778999998 67778899999888753


No 7  
>PF03909 BSD:  BSD domain  ;  InterPro: IPR005607 The BSD domain is an about 60-residue long domain named after the BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins in which it is found. Additionally, it is also found in several hypothetical proteins. The BSD domain occurs in one or two copies in a variety of species ranging from primal protozoan to human. It can be found associated with other domains such as the BTB domain (see PDOC50097 from PROSITEDOC) or the U-box in multidomain proteins. The function of the BSD domain is yet unknown []. Secondary structure prediction indicates the presence of three predicted alpha helices, which probably form a three-helical bundle in small domains. The third predicted helix contains neighbouring phenylalanine and tryptophan residues - less common amino acids that are invariant in all the BSD domains identified and that are the most striking sequence features of the domain [].  Some proteins known to contain one or two BSD domains are listed below:  Mammalian TFIIH basal transcription factor complex p62 subunit (GTF2H1).  Yeast RNA polymerase II transcription factor B 73 kDa subunit (TFB1), the homologue of BTF2.  Yeast DOS2 protein. It is involved in single-copy DNA replication and ubiquitination.  Drosophila synapse-associated protein SAP47.  Mammalian SYAP1.  Various Arabidopsis thaliana (Mouse-ear cress) hypothetical proteins.; PDB: 1X3A_A 1PFJ_A 2RNR_B 2DII_A.
Probab=43.60  E-value=14  Score=20.96  Aligned_cols=14  Identities=29%  Similarity=0.828  Sum_probs=10.2

Q ss_pred             hHHHHHHHHHHhhc
Q psy7408          18 RKAKFWQSYVRALK   31 (66)
Q Consensus        18 kKAkFWqsYvraLK   31 (66)
                      .-..||+.|...+.
T Consensus        40 ~e~~FW~rYf~~~~   53 (62)
T PF03909_consen   40 SEEEFWKRYFYRLH   53 (62)
T ss_dssp             -HHHHHHHHHCHHH
T ss_pred             CHHHHHHHHHHHHH
Confidence            35789999987653


No 8  
>TIGR03354 VI_FHA type VI secretion system FHA domain protein. Members of this protein family are FHA (forkhead-associated) domain-containing proteins that are part of type VI secretion loci in a considerable number of bacteria, most of which are known pathogens. Species include Pseudomonas aeruginosa PAO1, Aeromonas hydrophila, Yersinia pestis, Burkholderia mallei, etc.
Probab=37.40  E-value=21  Score=27.26  Aligned_cols=16  Identities=31%  Similarity=0.381  Sum_probs=13.0

Q ss_pred             chhhHHHHHHHHHHhh
Q psy7408          15 PITRKAKFWQSYVRAL   30 (66)
Q Consensus        15 ~~skKAkFWqsYvraL   30 (66)
                      ..++|||.|+.|++--
T Consensus       353 ~~~~~a~~W~~Y~~~y  368 (396)
T TIGR03354       353 FGGRDAWAWDMYLRYY  368 (396)
T ss_pred             ccchhHHHHHHHHHHH
Confidence            4479999999998754


No 9  
>PF00235 Profilin:  Profilin;  InterPro: IPR002097 Profilin is a small eukaryotic protein that binds to monomeric actin (G-actin) in a 1:1 ratio thus preventing the polymerisation of actin into filaments (F-actin). It can also in certain circumstance promote actin polymerisation. Profilin also binds to polyphosphoinositides such as PIP2. Overall sequence similarity among profilin from organisms which belong to different phyla (ranging from fungi to mammals) is low, but the N-terminal region is relatively well conserved. That region is thought to be involved in the binding to actin.   A protein structurally similar to profilin is present in the genome of Variola virus and Vaccinia virus (gene A42R). Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Ara t 8, Bet v 2, Cyn d 12, Hel a 2, Mer a 1 and Phl p 11.; GO: 0003779 actin binding, 0007010 cytoskeleton organization, 0015629 actin cytoskeleton; PDB: 1ACF_A 3NEC_C 2V8F_B 2V8C_A 2VK3_A 2JKF_A 2JKG_A 1F2K_B 2ACG_A 1YPR_B ....
Probab=36.94  E-value=22  Score=21.56  Aligned_cols=13  Identities=38%  Similarity=0.933  Sum_probs=10.9

Q ss_pred             HHHHHH-hhccccc
Q psy7408          23 WQSYVR-ALKGSTA   35 (66)
Q Consensus        23 WqsYvr-aLKGs~D   35 (66)
                      ||+||. .|-++.-
T Consensus         2 W~~~i~~~L~~~~~   15 (121)
T PF00235_consen    2 WQDYIDEQLIGTGN   15 (121)
T ss_dssp             HHHHHHTHHHTTSS
T ss_pred             hhHHHHHHhcccCc
Confidence            999999 8888753


No 10 
>PF01806 Paramyxo_P:  Paramyxovirinae P phosphoprotein C-terminal region;  InterPro: IPR002693  Sendai virus is a member of the Paramyxovirinae family. Its negative-sense ssRNA genome is packaged by the viral nucleoprotein (N) within a helical nucleocapsid. Paramyxovirinae use this N-RNA (nucleoprotein-RNA) complex as a template for both transcription and replication. During viral genome replication, the synthesis of viral RNA and its encapsidation by N are concomitant. Viral transcription and replication are carried out by viral RNA-dependent RNA polymerase, which consists of two proteins: L polymerase and phosphoprotein P. The L polymerase carries the enzyme activity. Phosphoprotein P binds the viral nucleocapsid, and positions the L polymerase on the template for transcription and replication formed by nucleoprotein-RNA (N-RNA) [].  This entry represents phosphoprotein P from Sendai virus as well as from close family members. Phosphoprotein P, an indispensable subunit of the viral polymerase complex, is a modular protein organised into two moieties that are both functionally and structurally distinct: a well-conserved C-terminal moiety that contains all the regions required for transcription, and a poorly conserved, intrinsically unstructured N-terminal moiety that provides several additional functions required for replication. The N-terminal moiety is responsible for binding to newly synthesized free N(0) (nucleoprotein that has not yet bound RNA), in order to prevent the binding of N(0) to cellular RNA. The C-terminal moiety consists of an oligomerisation domain, an N-RNA (nucleoprotein-RNA)-binding domain and an L polymerase-binding domain [, ]. ; GO: 0003723 RNA binding, 0003968 RNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0019079 viral genome replication; PDB: 1R4G_A 1EZJ_A.
Probab=35.93  E-value=25  Score=26.98  Aligned_cols=24  Identities=42%  Similarity=0.667  Sum_probs=17.7

Q ss_pred             hhhhccCCchhhHHHHHHHHHHhhcc
Q psy7408           7 LDMIGRNEPITRKAKFWQSYVRALKG   32 (66)
Q Consensus         7 LdMIGrNE~~skKAkFWqsYvraLKG   32 (66)
                      |-+|=-|+|+|+.+|  |+||..|+-
T Consensus       204 L~lvI~nS~LS~~~K--~sYI~~L~~  227 (248)
T PF01806_consen  204 LILVINNSPLSRSEK--QSYINELKK  227 (248)
T ss_dssp             HHHHHTTS---SHHH--HHHHHHHHT
T ss_pred             eeeeeeCCCcchHHH--HHHHHHHHh
Confidence            556778999999999  999999974


No 11 
>smart00831 Cation_ATPase_N Cation transporter/ATPase, N-terminus. This entry represents the conserved N-terminal region found in several classes of cation-transporting P-type ATPases, including those that transport H+, Na+, Ca2+, Na+/K+, and H+/K+. In the H+/K+- and Na+/K+-exchange P-ATPases, this domain is found in the catalytic alpha chain. In gastric H+/K+-ATPases, this domain undergoes reversible sequential phosphorylation inducing conformational changes that may be important for regulating the function of these ATPases PUBMED:12480547, PUBMED:12529322.
Probab=35.17  E-value=27  Score=18.94  Aligned_cols=29  Identities=21%  Similarity=0.280  Sum_probs=21.6

Q ss_pred             hhhhhhhccCCchhhH-HHHHHHHHHhhcc
Q psy7408           4 KQHLDMIGRNEPITRK-AKFWQSYVRALKG   32 (66)
Q Consensus         4 K~HLdMIGrNE~~skK-AkFWqsYvraLKG   32 (66)
                      .+.++-.|.|+-..++ -.||.-++++++.
T Consensus        17 ~~r~~~~G~N~l~~~~~~s~~~~~l~~~~~   46 (64)
T smart00831       17 ARRLERYGPNELPPPKKRSPLLRFLRQFHN   46 (64)
T ss_pred             HHHHHHhCCCCCCCCCCCCHHHHHHHHHHh
Confidence            3567789999966654 6788888888764


No 12 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=33.12  E-value=29  Score=25.15  Aligned_cols=27  Identities=15%  Similarity=0.509  Sum_probs=15.9

Q ss_pred             hhhhhhhhccCCchhhHHHHHHHHHHhhcc
Q psy7408           3 LKQHLDMIGRNEPITRKAKFWQSYVRALKG   32 (66)
Q Consensus         3 fK~HLdMIGrNE~~skKAkFWqsYvraLKG   32 (66)
                      ++-|-|.|   |.+.+++.|+++||.-.+-
T Consensus        98 ~nKH~e~v---e~~~~ev~~fnnY~~Dp~r  124 (214)
T PF04959_consen   98 FNKHPEKV---EEVKKEVEYFNNYLLDPKR  124 (214)
T ss_dssp             HHH-HHHH---HHHHHHHHHHHHH------
T ss_pred             hhcCHHHH---HHHHHHHHHHHHHhcCccc
Confidence            45677777   4577889999999975443


No 13 
>smart00751 BSD domain in transcription factors and synapse-associated proteins.
Probab=32.32  E-value=36  Score=18.68  Aligned_cols=13  Identities=31%  Similarity=0.769  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHhhc
Q psy7408          19 KAKFWQSYVRALK   31 (66)
Q Consensus        19 KAkFWqsYvraLK   31 (66)
                      -..||+.|...+.
T Consensus        36 e~~FW~ryF~~~~   48 (51)
T smart00751       36 EEEFWARYFYLLY   48 (51)
T ss_pred             HHHHHHHHHHHHH
Confidence            4689999987653


No 14 
>PF09053 CagZ:  CagZ;  InterPro: IPR015139  Helicobacter pylori (Campylobacter pylori) clinical isolates can be classified into two types according to their degree of pathogenicity. Type I strains are associated with a severe disease pathology, express functional VacA (vacuolating cytotoxin A) and contain an insertion of 40 kb of foreign DNA: the cag (cytotoxin-associated gene) pathogenicity island (cagPAI). Type II strains lack the 40 kb insert, cagPAI. The cagPAI may be divided into two regions, cag I and cag II and contain approximately 16 and 15 genes, respectively. The cagPAI encodes a type IV secretion system (T4SS), which delivers CagA into the cytosol of gastric epithelial cells through a rigid needle structure covered by Cag7 or CagY, a VirB10-homologous protein, and CagT, a VirB7-homologous protein, at the base []. The CagA protein is the virulence factor that induces morphological changes in host cells, which may be associated with the development of peptic ulcer and gastric carcinoma []. CagZ is a 23 kDa protein consisting of a single compact L-shaped domain, composed of seven alpha-helices that run antiparallel to each other. 70% of the residues are in alpha-helix conformation and no beta-sheet is present. CagZ is essential for the translocation of the pathogenic protein CagA into host cells []. ; PDB: 1S2X_A.
Probab=29.89  E-value=33  Score=25.36  Aligned_cols=17  Identities=41%  Similarity=0.645  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHhhccccc
Q psy7408          19 KAKFWQSYVRALKGSTA   35 (66)
Q Consensus        19 KAkFWqsYvraLKGs~D   35 (66)
                      ..||-|+|..+||.|.|
T Consensus        28 rdkfiqnyatslkdsnd   44 (199)
T PF09053_consen   28 RDKFIQNYATSLKDSND   44 (199)
T ss_dssp             HHHHHHHHTGGGGG--S
T ss_pred             HHHHHHHHHhhcccCCC
Confidence            46899999999999977


No 15 
>PTZ00316 profilin; Provisional
Probab=27.69  E-value=35  Score=23.89  Aligned_cols=12  Identities=58%  Similarity=1.060  Sum_probs=9.8

Q ss_pred             HHHHHHh-hcccc
Q psy7408          23 WQSYVRA-LKGST   34 (66)
Q Consensus        23 WqsYvra-LKGs~   34 (66)
                      ||+||.. |-||.
T Consensus         3 WQaYVD~~L~gsg   15 (150)
T PTZ00316          3 WQAYVDDSLIGSG   15 (150)
T ss_pred             HHHHHHhhhhccC
Confidence            9999994 87764


No 16 
>KOG0750|consensus
Probab=27.51  E-value=39  Score=26.65  Aligned_cols=25  Identities=24%  Similarity=0.335  Sum_probs=18.9

Q ss_pred             hhccCCchhhHHHHHHHHHHhhccc
Q psy7408           9 MIGRNEPITRKAKFWQSYVRALKGS   33 (66)
Q Consensus         9 MIGrNE~~skKAkFWqsYvraLKGs   33 (66)
                      ++=|-..-|-+|-||||++..|-|.
T Consensus       198 lgpr~~D~Sg~avF~~sF~agl~~g  222 (304)
T KOG0750|consen  198 LGPRKKDGSGAAVFYQSFLAGLVAG  222 (304)
T ss_pred             hccCCCCcccchhhHHHHHHHHHhh
Confidence            3445556788899999999988653


No 17 
>KOG1761|consensus
Probab=27.23  E-value=35  Score=23.49  Aligned_cols=15  Identities=47%  Similarity=0.572  Sum_probs=12.7

Q ss_pred             HHHHHHHHhhccccc
Q psy7408          21 KFWQSYVRALKGSTA   35 (66)
Q Consensus        21 kFWqsYvraLKGs~D   35 (66)
                      +|||+|-..|||--|
T Consensus        79 ~F~~~YS~vlk~~M~   93 (116)
T KOG1761|consen   79 KFQQSYSAVLKAQMD   93 (116)
T ss_pred             HHHHHHHHHHHHHhh
Confidence            899999999987544


No 18 
>smart00392 PROF Profilin. Binds actin monomers, membrane polyphosphoinositides and poly-L-proline.
Probab=24.16  E-value=43  Score=21.22  Aligned_cols=11  Identities=64%  Similarity=1.202  Sum_probs=8.4

Q ss_pred             HHHHHHh-hccc
Q psy7408          23 WQSYVRA-LKGS   33 (66)
Q Consensus        23 WqsYvra-LKGs   33 (66)
                      ||+||.. |-||
T Consensus         3 Wq~yvd~~l~~~   14 (129)
T smart00392        3 WQAYVDNLLVGS   14 (129)
T ss_pred             hHHHHHHHhhcc
Confidence            9999996 4443


No 19 
>PF01639 v110:  Viral family 110;  InterPro: IPR004848 This entry represents a family of viral proteins of unknown function known as the 110 family []. They contain a central cysteine rich region with eight conserved cysteines. Some proteins in this entry contain two copies of the cysteine rich region eg P18560 from SWISSPROT.
Probab=23.65  E-value=16  Score=24.86  Aligned_cols=17  Identities=18%  Similarity=0.669  Sum_probs=14.3

Q ss_pred             CchhhHHHHHHHHHHhh
Q psy7408          14 EPITRKAKFWQSYVRAL   30 (66)
Q Consensus        14 E~~skKAkFWqsYvraL   30 (66)
                      -||.+.-.||++|+..-
T Consensus        26 ~PP~~EL~YWCTY~~~C   42 (110)
T PF01639_consen   26 NPPEEELEYWCTYAKHC   42 (110)
T ss_pred             CCChHHhceeccccccC
Confidence            47889999999998753


No 20 
>PF09628 YvfG:  YvfG protein;  InterPro: IPR018590  Yvfg is a hypothetical protein of 71 residues expressed in some bacteria. The monomer consists of two parallel alpha helices, and the protein crystallises as a homo-dimer. ; PDB: 2GSV_A 2JS1_B.
Probab=21.75  E-value=48  Score=21.24  Aligned_cols=28  Identities=29%  Similarity=0.494  Sum_probs=16.8

Q ss_pred             hhhhhhhhccCCchhhHHHHHHHHHHhhccc
Q psy7408           3 LKQHLDMIGRNEPITRKAKFWQSYVRALKGS   33 (66)
Q Consensus         3 fK~HLdMIGrNE~~skKAkFWqsYvraLKGs   33 (66)
                      ||+|++|   |+.--.|-.=-++|-|+.-||
T Consensus        12 ~~q~i~~---N~~~~~ki~AmNaYYr~Vv~t   39 (68)
T PF09628_consen   12 FKQHIQM---NQNYEDKIHAMNAYYRSVVST   39 (68)
T ss_dssp             HHHHHHC----SS-S-CCHHHHHHHHHHHHH
T ss_pred             HHHHHHh---CccHHHHHHHHHHHHHHHHHH
Confidence            7888776   565445555567777776665


No 21 
>PF11393 IcmL:  Macrophage killing protein with similarity to conjugation protein;  InterPro: IPR021055 IcmL contains two amphipathic beta-sheet regions, required for the pore-forming ability which may be related to the transfer of this protein into a host cell membrane []. The icmL gene shows significant similarity to plasmid genes involved in conjugation however IcmL is thought to be required for macrophage killing. It is unknown whether conjugation plays a role in macrophage killing [].
Probab=21.65  E-value=52  Score=20.64  Aligned_cols=17  Identities=29%  Similarity=0.497  Sum_probs=14.3

Q ss_pred             HHHHHHHHhhccccccc
Q psy7408          21 KFWQSYVRALKGSTAIL   37 (66)
Q Consensus        21 kFWqsYvraLKGs~Dir   37 (66)
                      +.|.+|..+|+.|.-|.
T Consensus        53 ~g~~~f~~aL~~Sg~l~   69 (108)
T PF11393_consen   53 EGWNSFQKALQKSGILD   69 (108)
T ss_pred             HHHHHHHHHHHHCCCHH
Confidence            67999999999887664


No 22 
>PF03245 Phage_lysis:  Bacteriophage Rz lysis protein;  InterPro: IPR004929 Many bacteriophages with Gram-negative hosts contain two auxiliary lysis genes Rz and Rz1. These genes are nested, with Rz1 occupying the last third of Rz in a +1 reading frame. Both of these genes are required for host cell lysis if the outer membrane is stabilised by millimolar concentrations of divalent cations, but are otherwise uneccessary []. The Rz protein is believed to posses endopeptidase activity, while Rz1 encodes a prolipoprotein which, after cleavage by a signal peptidase, is located in the outer membrane. It has been suggested that these two proteins may form a complex which cleaves the oligopeptide crosslinks between glycosidic strands in the peptidoglycan and the Lpp lipoproteins of the outer bacterial membrane. For more information see []. This entry represents the Rz protein and related sequences. This family is not considered to be a peptidase according to the MEROPs database.; GO: 0019835 cytolysis
Probab=21.07  E-value=63  Score=21.00  Aligned_cols=24  Identities=21%  Similarity=0.338  Sum_probs=17.1

Q ss_pred             hhhhccCCchhhHHHHHHHHHHhh
Q psy7408           7 LDMIGRNEPITRKAKFWQSYVRAL   30 (66)
Q Consensus         7 LdMIGrNE~~skKAkFWqsYvraL   30 (66)
                      +++-.+-+...++-++.|.|||+.
T Consensus       100 ~~lr~~i~~~~~ql~~LQ~YIr~~  123 (125)
T PF03245_consen  100 FRLRERIDRAIRQLNALQDYIRTQ  123 (125)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            334444455678899999999974


No 23 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=20.06  E-value=66  Score=26.48  Aligned_cols=13  Identities=46%  Similarity=0.912  Sum_probs=10.8

Q ss_pred             hhHHHHHHHHHHh
Q psy7408          17 TRKAKFWQSYVRA   29 (66)
Q Consensus        17 skKAkFWqsYvra   29 (66)
                      -+|-||||-|-+-
T Consensus       401 rRKEKf~rk~C~r  413 (458)
T PF10446_consen  401 RRKEKFWRKHCRR  413 (458)
T ss_pred             hhhHHHHHHHHHH
Confidence            4789999999864


Done!