Query         psy7416
Match_columns 381
No_of_seqs    289 out of 380
Neff          4.8 
Searched_HMMs 29240
Date          Fri Aug 16 17:43:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7416.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/7416hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 4dgw_A PRE-mRNA-splicing facto  99.4 7.8E-15 2.7E-19  148.0   0.3   72    4-85    296-369 (402)
  2 4dgw_A PRE-mRNA-splicing facto  99.2 7.1E-12 2.4E-16  126.5   4.4   73  134-214   296-368 (402)
  3 2m0d_A Zinc finger and BTB dom  82.3    0.44 1.5E-05   27.6   1.0   22  255-277     2-23  (30)
  4 1znf_A 31ST zinc finger from X  82.0    0.49 1.7E-05   27.0   1.2   21  256-277     1-21  (27)
  5 2m0f_A Zinc finger and BTB dom  81.8    0.43 1.5E-05   27.4   0.9   22  255-277     1-22  (29)
  6 1rik_A E6APC1 peptide; E6-bind  81.7    0.47 1.6E-05   27.5   1.0   22  255-277     1-22  (29)
  7 2m0e_A Zinc finger and BTB dom  81.1    0.54 1.9E-05   26.9   1.1   22  255-277     1-22  (29)
  8 1paa_A Yeast transcription fac  80.9    0.52 1.8E-05   27.5   1.0   21  255-276     1-21  (30)
  9 2lvu_A Zinc finger and BTB dom  80.7    0.37 1.3E-05   27.5   0.0   21  255-276     1-21  (26)
 10 2kvf_A Zinc finger and BTB dom  79.5    0.63 2.1E-05   26.8   1.0   22  255-277     2-23  (28)
 11 2kvh_A Zinc finger and BTB dom  78.7    0.77 2.6E-05   26.4   1.2   22  255-277     2-23  (27)
 12 2lvt_A Zinc finger and BTB dom  78.6     0.5 1.7E-05   27.6   0.0   22  255-277     1-22  (29)
 13 2elr_A Zinc finger protein 406  76.1     1.1 3.6E-05   27.4   1.4   24  253-277     6-29  (36)
 14 3eph_A TRNA isopentenyltransfe  75.8    0.82 2.8E-05   46.2   1.2   35  253-287   357-396 (409)
 15 1p7a_A BF3, BKLF, kruppel-like  75.1     1.1 3.6E-05   27.7   1.2   26  251-277     6-31  (37)
 16 2elv_A Zinc finger protein 406  75.0     1.2 4.1E-05   27.4   1.5   24  253-277     6-29  (36)
 17 3iuf_A Zinc finger protein UBI  74.7     1.1 3.6E-05   30.3   1.2   23  254-277     5-27  (48)
 18 1klr_A Zinc finger Y-chromosom  74.2     1.2   4E-05   25.6   1.2   22  255-277     1-22  (30)
 19 2elm_A Zinc finger protein 406  73.6     1.1 3.7E-05   28.1   1.0   25  251-276     4-28  (37)
 20 2kvg_A Zinc finger and BTB dom  73.3    0.81 2.8E-05   26.5   0.3   22  255-277     2-23  (27)
 21 2elt_A Zinc finger protein 406  72.2     1.5 5.2E-05   26.7   1.4   23  254-277     7-29  (36)
 22 2eov_A Zinc finger protein 484  71.4     1.4 4.7E-05   28.7   1.1   30  251-283     7-36  (46)
 23 1dxg_A Desulforedoxin; non-hem  70.9    0.78 2.7E-05   30.9  -0.2   14  254-267     4-17  (36)
 24 2lvr_A Zinc finger and BTB dom  73.5    0.87   3E-05   26.4   0.0   22  255-277     2-23  (30)
 25 2els_A Zinc finger protein 406  70.3     1.7 5.9E-05   26.6   1.4   23  254-277     7-29  (36)
 26 1ard_A Yeast transcription fac  69.1     1.7   6E-05   24.8   1.1   22  255-277     1-22  (29)
 27 2yte_A Zinc finger protein 473  68.3     1.6 5.6E-05   27.6   1.0   26  251-277     5-30  (42)
 28 2elx_A Zinc finger protein 406  67.9     2.1 7.3E-05   25.7   1.4   23  254-277     5-27  (35)
 29 2eos_A B-cell lymphoma 6 prote  66.1     2.6 8.9E-05   26.8   1.6   27  251-278     6-32  (42)
 30 2drp_A Protein (tramtrack DNA-  66.0       2 6.8E-05   30.1   1.1   24  254-278     8-31  (66)
 31 2elp_A Zinc finger protein 406  65.7     2.5 8.4E-05   26.0   1.4   26  251-277     4-30  (37)
 32 2kfq_A FP1; protein, de novo p  65.7     1.1 3.7E-05   27.2  -0.3   22  255-277     1-22  (32)
 33 2epv_A Zinc finger protein 268  65.6     1.8 6.1E-05   28.1   0.7   26  251-277     7-32  (44)
 34 2eoy_A Zinc finger protein 473  65.3     1.9 6.7E-05   28.1   0.9   26  251-277     7-32  (46)
 35 1rim_A E6APC2 peptide; E6-bind  64.8     2.5 8.5E-05   25.8   1.3   22  255-277     1-22  (33)
 36 1njq_A Superman protein; zinc-  64.2     2.5 8.5E-05   26.5   1.2   23  254-277     4-26  (39)
 37 2eme_A Zinc finger protein 473  64.0     2.5 8.5E-05   27.4   1.2   26  251-277     7-32  (46)
 38 2ytb_A Zinc finger protein 32;  64.0     2.8 9.5E-05   26.5   1.4   27  251-278     6-32  (42)
 39 2yts_A Zinc finger protein 484  63.5     2.8 9.4E-05   27.1   1.4   26  251-277     7-32  (46)
 40 2eoj_A Zinc finger protein 268  62.8     1.8 6.1E-05   27.8   0.3   26  251-277     7-32  (44)
 41 2emj_A Zinc finger protein 28   62.6     2.4 8.2E-05   27.6   0.9   26  251-277     7-32  (46)
 42 1bbo_A Human enhancer-binding   62.5     3.5 0.00012   27.8   1.8   28  249-277    22-49  (57)
 43 2epc_A Zinc finger protein 32;  62.4     2.4 8.3E-05   26.8   0.9   26  251-277     6-31  (42)
 44 2eox_A Zinc finger protein 473  61.8       2 6.7E-05   27.7   0.4   26  251-277     7-32  (44)
 45 2enf_A Zinc finger protein 347  61.7     2.8 9.6E-05   27.2   1.1   26  251-277     7-32  (46)
 46 2ept_A Zinc finger protein 32;  61.6     3.3 0.00011   26.1   1.5   26  251-277     5-30  (41)
 47 2yti_A Zinc finger protein 347  61.3     3.1 0.00011   26.9   1.3   26  251-277     7-32  (46)
 48 2emz_A ZFP-95, zinc finger pro  61.2     3.5 0.00012   26.8   1.6   26  251-277     7-32  (46)
 49 1yui_A GAGA-factor; complex (D  61.1     3.3 0.00011   28.1   1.5   28  249-277    17-44  (54)
 50 2ytj_A Zinc finger protein 484  61.0       3  0.0001   27.1   1.2   26  251-277     7-32  (46)
 51 2eoq_A Zinc finger protein 224  60.8     3.4 0.00012   26.7   1.5   26  251-277     7-32  (46)
 52 2em7_A Zinc finger protein 224  60.8     3.4 0.00012   26.8   1.4   26  251-277     7-32  (46)
 53 2emf_A Zinc finger protein 484  60.8     2.7 9.4E-05   27.3   1.0   27  251-278     7-33  (46)
 54 2en7_A Zinc finger protein 268  60.4     2.6 8.8E-05   27.0   0.8   26  251-277     7-32  (44)
 55 3uk3_C Zinc finger protein 217  60.4     3.1 0.00011   28.0   1.2   27  250-277    26-52  (57)
 56 2ep3_A Zinc finger protein 484  60.4     2.9 9.9E-05   27.1   1.0   26  251-277     7-32  (46)
 57 2emg_A Zinc finger protein 484  60.4     3.4 0.00012   26.8   1.4   27  251-278     7-33  (46)
 58 2ely_A Zinc finger protein 224  60.1     3.1 0.00011   27.1   1.1   26  251-277     7-32  (46)
 59 2eoo_A ZFP-95, zinc finger pro  60.1     2.9  0.0001   27.2   1.0   26  251-277     7-32  (46)
 60 2en2_A B-cell lymphoma 6 prote  60.1     3.1 0.00011   26.3   1.1   26  251-277     6-31  (42)
 61 2el4_A Zinc finger protein 268  60.0     2.9 9.9E-05   27.1   1.0   26  251-277     7-32  (46)
 62 2enh_A Zinc finger protein 28   59.8     3.4 0.00012   26.8   1.3   27  251-278     7-33  (46)
 63 2eof_A Zinc finger protein 268  59.0     2.8 9.6E-05   26.7   0.8   26  251-277     7-32  (44)
 64 2eon_A ZFP-95, zinc finger pro  59.0     4.1 0.00014   26.5   1.6   26  251-277     7-32  (46)
 65 2en1_A Zinc finger protein 224  59.0     2.5 8.6E-05   27.4   0.5   26  251-277     7-32  (46)
 66 2emi_A Zinc finger protein 484  58.9     3.8 0.00013   26.5   1.4   26  251-277     7-32  (46)
 67 2eoz_A Zinc finger protein 473  58.7     2.3   8E-05   27.7   0.3   26  251-277     7-32  (46)
 68 2ytq_A Zinc finger protein 268  58.7     3.5 0.00012   26.8   1.2   26  251-277     7-32  (46)
 69 2en3_A ZFP-95, zinc finger pro  58.6     3.8 0.00013   26.5   1.4   26  251-277     7-32  (46)
 70 2yu8_A Zinc finger protein 347  58.6     3.1  0.0001   27.0   0.9   26  251-277     7-32  (46)
 71 2eop_A Zinc finger protein 268  58.4     3.2 0.00011   26.8   1.0   26  251-277     7-32  (46)
 72 2eor_A Zinc finger protein 224  58.3       3  0.0001   26.9   0.8   26  251-277     7-32  (46)
 73 2eml_A Zinc finger protein 28   58.3     3.1 0.00011   26.9   0.9   27  251-278     7-33  (46)
 74 2elq_A Zinc finger protein 406  58.2     4.2 0.00014   24.7   1.5   24  253-277     6-29  (36)
 75 4gzn_C ZFP-57, zinc finger pro  58.1       3  0.0001   30.3   0.9   22  255-277     3-24  (60)
 76 1srk_A Zinc finger protein ZFP  57.9     4.5 0.00015   24.4   1.5   23  254-277     5-27  (35)
 77 2eow_A Zinc finger protein 347  57.6     3.9 0.00013   26.4   1.3   26  251-277     7-32  (46)
 78 2emp_A Zinc finger protein 347  57.5     3.4 0.00012   26.8   1.0   26  251-277     7-32  (46)
 79 2eoh_A Zinc finger protein 28   57.4     3.5 0.00012   26.8   1.0   26  251-277     7-32  (46)
 80 2ytk_A Zinc finger protein 347  57.3     4.1 0.00014   26.4   1.4   27  251-278     7-33  (46)
 81 2lce_A B-cell lymphoma 6 prote  57.1     4.2 0.00014   29.2   1.5   27  250-277    39-65  (74)
 82 2ene_A Zinc finger protein 347  57.1     3.5 0.00012   26.7   1.0   27  251-278     7-33  (46)
 83 2elo_A Zinc finger protein 406  57.1       3  0.0001   25.5   0.6   26  251-277     4-29  (37)
 84 2ytf_A Zinc finger protein 268  57.0     4.3 0.00015   26.2   1.4   26  251-277     7-32  (46)
 85 2el5_A Zinc finger protein 268  57.0     3.5 0.00012   26.0   1.0   26  251-277     5-30  (42)
 86 2eq3_A Zinc finger protein 347  56.8     2.6 8.9E-05   27.3   0.3   27  251-278     7-33  (46)
 87 2enc_A Zinc finger protein 224  56.8     3.5 0.00012   26.7   1.0   26  251-277     7-32  (46)
 88 2ytn_A Zinc finger protein 347  56.7     3.6 0.00012   26.7   1.0   26  251-277     7-32  (46)
 89 2ep2_A Zinc finger protein 484  56.1     4.6 0.00016   26.1   1.5   27  251-278     7-33  (46)
 90 2em5_A ZFP-95, zinc finger pro  56.0     4.4 0.00015   26.3   1.4   26  251-277     7-32  (46)
 91 2emm_A ZFP-95, zinc finger pro  56.0     3.8 0.00013   26.5   1.0   26  251-277     7-32  (46)
 92 2emy_A Zinc finger protein 268  55.8     3.6 0.00012   26.6   0.9   26  251-277     7-32  (46)
 93 2eom_A ZFP-95, zinc finger pro  55.8     4.9 0.00017   26.1   1.6   26  251-277     7-32  (46)
 94 2epx_A Zinc finger protein 28   55.8     4.1 0.00014   26.3   1.2   26  251-277     7-32  (47)
 95 2emx_A Zinc finger protein 268  55.7     3.8 0.00013   26.3   1.0   26  251-277     5-30  (44)
 96 2yto_A Zinc finger protein 484  55.7     3.7 0.00013   26.7   0.9   26  251-277     7-32  (46)
 97 2elz_A Zinc finger protein 224  55.7     5.1 0.00017   26.0   1.6   27  251-278     7-33  (46)
 98 2en9_A Zinc finger protein 28   55.6     3.7 0.00013   26.6   0.9   26  251-277     7-32  (46)
 99 2eq0_A Zinc finger protein 347  55.6     4.5 0.00016   26.1   1.4   26  251-277     7-32  (46)
100 2emb_A Zinc finger protein 473  55.4     3.5 0.00012   26.4   0.8   26  251-277     7-32  (44)
101 2em8_A Zinc finger protein 224  55.4     4.6 0.00016   26.2   1.4   26  251-277     7-32  (46)
102 2el6_A Zinc finger protein 268  55.2     4.8 0.00016   26.1   1.4   26  251-277     7-32  (46)
103 2eou_A Zinc finger protein 473  55.1     4.6 0.00016   25.9   1.3   26  251-277     7-32  (44)
104 2yu5_A Zinc finger protein 473  54.8     4.8 0.00017   25.7   1.4   26  251-277     7-32  (44)
105 2d9h_A Zinc finger protein 692  54.8     3.9 0.00013   29.6   1.0   23  254-277    36-58  (78)
106 2ysp_A Zinc finger protein 224  54.7     3.7 0.00013   26.6   0.8   27  251-278     7-33  (46)
107 1x6e_A Zinc finger protein 24;  54.6     5.2 0.00018   28.6   1.6   27  250-277    36-62  (72)
108 2adr_A ADR1; transcription reg  54.4     4.6 0.00016   27.5   1.3   26  251-277    25-50  (60)
109 2yrm_A B-cell lymphoma 6 prote  54.4     5.5 0.00019   25.6   1.6   26  251-277     5-30  (43)
110 2em3_A Zinc finger protein 28   54.4     4.9 0.00017   26.0   1.4   26  251-277     7-32  (46)
111 1f2i_G Fusion of N-terminal 17  54.3       4 0.00014   29.0   1.0   27  250-277    43-69  (73)
112 2ytg_A ZFP-95, zinc finger pro  53.9     3.7 0.00013   26.6   0.7   26  251-277     7-32  (46)
113 2em4_A Zinc finger protein 28   53.9     4.1 0.00014   26.5   0.9   26  251-277     7-32  (46)
114 2ytp_A Zinc finger protein 484  53.6     4.4 0.00015   26.3   1.0   27  251-278     7-33  (46)
115 2em6_A Zinc finger protein 224  53.4     4.8 0.00016   26.1   1.2   26  251-277     7-32  (46)
116 1zr9_A Zinc finger protein 593  53.3     1.6 5.4E-05   37.4  -1.5   47  242-291    38-84  (124)
117 2yt9_A Zinc finger-containing   53.1     5.1 0.00017   29.8   1.4   23  254-277    63-85  (95)
118 2em9_A Zinc finger protein 224  53.1     4.4 0.00015   26.1   1.0   26  251-277     7-32  (46)
119 2ema_A Zinc finger protein 347  53.0     4.4 0.00015   26.2   1.0   26  251-277     7-32  (46)
120 2ytt_A Zinc finger protein 473  52.9     5.3 0.00018   25.9   1.3   26  251-277     7-32  (46)
121 2ytd_A Zinc finger protein 473  52.8     4.5 0.00015   26.2   1.0   26  251-277     7-32  (46)
122 2ep1_A Zinc finger protein 484  52.6     4.7 0.00016   26.0   1.0   27  251-278     7-33  (46)
123 2ep0_A Zinc finger protein 28   52.5     4.6 0.00016   26.1   1.0   26  251-277     7-32  (46)
124 2en8_A Zinc finger protein 224  52.1     5.3 0.00018   25.7   1.2   26  251-277     7-32  (46)
125 2yso_A ZFP-95, zinc finger pro  51.6     4.5 0.00015   26.1   0.8   26  251-277     7-32  (46)
126 2epu_A Zinc finger protein 32;  51.5     4.4 0.00015   26.1   0.8   26  251-277     7-32  (45)
127 2ct1_A Transcriptional repress  51.5     5.5 0.00019   28.8   1.4   22  255-277    44-65  (77)
128 2eoe_A Zinc finger protein 347  51.5     4.4 0.00015   26.1   0.7   26  251-277     7-32  (46)
129 2ytr_A Zinc finger protein 347  51.4     5.1 0.00018   25.8   1.1   26  251-277     7-32  (46)
130 2epw_A Zinc finger protein 268  51.1     4.8 0.00016   25.9   0.9   26  251-277     7-32  (46)
131 1zu1_A DSRBP-ZFA, RNA binding   50.6     4.5 0.00015   33.9   0.8   60  229-289     5-64  (127)
132 2epr_A POZ-, at HOOK-, and zin  50.5     4.8 0.00016   26.5   0.8   26  251-277     7-32  (48)
133 2eq4_A Zinc finger protein 224  49.6     5.5 0.00019   25.6   1.0   26  251-277     7-32  (46)
134 2eq1_A Zinc finger protein 347  49.4     5.3 0.00018   25.8   0.9   27  251-278     7-33  (46)
135 2eq2_A Zinc finger protein 347  49.0     5.9  0.0002   25.6   1.1   26  251-277     7-32  (46)
136 2epz_A Zinc finger protein 28   48.9     5.8  0.0002   25.6   1.1   27  251-278     7-33  (46)
137 1x5w_A Zinc finger protein 64,  48.7     7.6 0.00026   27.4   1.7   27  250-277    31-57  (70)
138 2ab3_A ZNF29; zinc finger prot  47.9     5.3 0.00018   22.6   0.6   22  255-277     1-24  (29)
139 2yrj_A Zinc finger protein 473  47.7     5.4 0.00019   25.7   0.7   26  251-277     7-32  (46)
140 2yth_A Zinc finger protein 224  47.3     6.8 0.00023   25.3   1.2   26  251-277     7-32  (46)
141 2ytm_A Zinc finger protein 28   47.1     7.1 0.00024   25.3   1.3   26  251-277     7-32  (46)
142 2en6_A Zinc finger protein 268  47.0     4.6 0.00016   26.1   0.3   26  251-277     7-32  (46)
143 2ctd_A Zinc finger protein 512  46.8     8.2 0.00028   30.0   1.8   20  245-265    24-43  (96)
144 2cot_A Zinc finger protein 435  46.8     7.1 0.00024   28.1   1.3   28  250-278    40-67  (77)
145 2eps_A POZ-, at HOOK-, and zin  45.3     8.1 0.00028   26.2   1.4   25  252-277     8-32  (54)
146 2ee8_A Protein ODD-skipped-rel  45.0     8.2 0.00028   29.3   1.5   26  251-277    68-93  (106)
147 2lt7_A Transcriptional regulat  44.9       6  0.0002   32.8   0.7   26  255-283    21-46  (133)
148 2emk_A Zinc finger protein 28   44.6     9.1 0.00031   24.7   1.5   26  251-277     7-32  (46)
149 1x6h_A Transcriptional repress  44.6     8.3 0.00028   27.9   1.4   22  255-277    46-67  (86)
150 2kmk_A Zinc finger protein GFI  44.1     7.2 0.00025   27.9   1.0   26  251-277    52-77  (82)
151 2ebt_A Krueppel-like factor 5;  44.0      11 0.00038   28.0   2.1   27  251-278    40-68  (100)
152 1zfd_A SWI5; DNA binding motif  43.3     9.5 0.00033   22.3   1.3   22  255-277     2-25  (32)
153 2csh_A Zinc finger protein 297  41.5     9.6 0.00033   29.2   1.4   23  254-277    63-85  (110)
154 2em0_A Zinc finger protein 224  41.2     9.6 0.00033   24.5   1.2   26  251-277     7-32  (46)
155 2emh_A Zinc finger protein 484  40.8     8.5 0.00029   24.8   0.8   30  251-283     7-36  (46)
156 2dmi_A Teashirt homolog 3; zin  40.5     9.3 0.00032   29.5   1.2   27  251-278    75-101 (115)
157 1llm_C Chimera of ZIF23-GCN4;   39.6     9.3 0.00032   28.2   1.0   26  251-277    26-51  (88)
158 2em2_A Zinc finger protein 28   39.6     8.5 0.00029   24.8   0.7   26  251-277     7-32  (46)
159 2dlq_A GLI-kruppel family memb  38.9      12 0.00042   28.8   1.7   29  249-278    87-115 (124)
160 2epp_A POZ-, at HOOK-, and zin  38.6      11 0.00039   28.0   1.4   34  254-290    11-44  (66)
161 1a1h_A QGSR zinc finger peptid  38.5      10 0.00034   27.7   1.0   26  251-277    57-82  (90)
162 2epq_A POZ-, at HOOK-, and zin  38.4     6.7 0.00023   25.2   0.0   26  251-277     5-30  (45)
163 2wbt_A B-129; zinc finger; 2.7  37.9      12 0.00042   29.5   1.6   23  254-277    98-120 (129)
164 2wbs_A Krueppel-like factor 4;  37.4      12 0.00042   27.1   1.4   22  255-277    34-57  (89)
165 1zu1_A DSRBP-ZFA, RNA binding   36.0     7.7 0.00026   32.4   0.0   35  252-287    89-123 (127)
166 1va1_A Transcription factor SP  35.4      16 0.00054   22.4   1.5   23  254-277     6-30  (37)
167 2eod_A TNF receptor-associated  35.2      11 0.00037   26.5   0.7   22  254-277     8-29  (66)
168 1vzi_A Desulfoferrodoxin; ferr  35.2     7.4 0.00025   33.0  -0.2   14  254-267     5-18  (126)
169 1yk4_A Rubredoxin, RD; electro  35.2      10 0.00035   27.5   0.6   31  256-300     2-32  (52)
170 2dmd_A Zinc finger protein 64,  33.9      16 0.00056   26.9   1.6   27  251-278    31-57  (96)
171 2gqj_A Zinc finger protein KIA  33.0      17 0.00058   27.7   1.6   28  249-277    17-45  (98)
172 2dlq_A GLI-kruppel family memb  32.6      18 0.00063   27.7   1.7   28  250-278    29-56  (124)
173 2csh_A Zinc finger protein 297  32.6      17 0.00058   27.7   1.5   29  249-278    30-58  (110)
174 2jvx_A NF-kappa-B essential mo  32.2      10 0.00035   24.4   0.2   23  256-279     3-25  (28)
175 2kn9_A Rubredoxin; metalloprot  31.4      12  0.0004   29.8   0.4   32  255-300    26-57  (81)
176 2v3b_B Rubredoxin 2, rubredoxi  30.6      12 0.00042   27.4   0.4   31  256-300     3-33  (55)
177 1vd4_A Transcription initiatio  30.5      16 0.00055   25.6   1.0   17  249-265    32-48  (62)
178 1fv5_A First zinc finger of U-  30.2      11 0.00037   24.8   0.0   22  254-276     6-27  (36)
179 2lv2_A Insulinoma-associated p  30.2      17 0.00058   28.1   1.1   27  250-277    50-76  (85)
180 1e8j_A Rubredoxin; iron-sulfur  29.7      14 0.00049   26.7   0.6   31  256-300     3-33  (52)
181 1x6f_A Zinc finger protein 462  29.3      20  0.0007   27.6   1.5   26  251-277    20-45  (88)
182 4rxn_A Rubredoxin; electron tr  29.2      24 0.00082   25.9   1.7   32  255-300     2-33  (54)
183 2ghf_A ZHX1, zinc fingers and   29.1      18 0.00063   28.9   1.2   22  255-277    17-38  (102)
184 2ctd_A Zinc finger protein 512  28.6      26  0.0009   27.0   2.0   26  249-276    56-81  (96)
185 1wjp_A Zinc finger protein 295  27.9      18  0.0006   27.6   0.9   26  251-277    64-89  (107)
186 1sp2_A SP1F2; zinc finger, tra  27.4      24 0.00081   20.3   1.2   22  255-277     1-24  (31)
187 1yuz_A Nigerythrin; rubrythrin  27.2      16 0.00056   33.0   0.6   14  255-269   170-183 (202)
188 2dsm_A Hypothetical protein YQ  27.2      39  0.0013   26.3   2.7   36  228-274     2-37  (72)
189 1lko_A Rubrerythrin all-iron(I  25.1      14 0.00049   32.9  -0.1   15  255-270   154-168 (191)
190 2eln_A Zinc finger protein 406  25.1      25 0.00085   23.1   1.1   23  254-277     7-31  (38)
191 2epa_A Krueppel-like factor 10  25.0      32  0.0011   24.1   1.8   28  249-277    40-69  (72)
192 1s24_A Rubredoxin 2; electron   24.8      15 0.00053   29.5  -0.0   15  255-270    34-48  (87)
193 1bhi_A CRE-BP1, ATF-2; CRE bin  24.6      32  0.0011   20.7   1.5   23  254-277     4-28  (38)
194 1dx8_A Rubredoxin; electron tr  23.7      19 0.00066   27.6   0.3   15  255-270     6-20  (70)
195 1ubd_C Protein (YY1 zinc finge  23.6      29   0.001   26.8   1.4   27  250-278    29-55  (124)
196 2k16_A Transcription initiatio  23.4      14 0.00048   27.8  -0.5   35  256-294    18-53  (75)
197 2i13_A AART; DNA binding, zinc  23.1      25 0.00086   29.5   1.0   28  250-278   155-182 (190)
198 2gli_A Protein (five-finger GL  22.9      35  0.0012   27.3   1.9   28  251-278    29-60  (155)
199 1y07_A Desulfoferrodoxin (RBO)  22.8      18 0.00061   30.7  -0.0   13  255-267     6-19  (128)
200 2ent_A Krueppel-like factor 15  22.4      37  0.0013   21.6   1.5   26  251-277     7-34  (48)
201 2jp9_A Wilms tumor 1; DNA bind  22.3      27 0.00093   26.6   1.0   27  251-278    61-87  (119)
202 2czr_A TBP-interacting protein  22.3      17 0.00059   33.3  -0.2   29  240-278   146-174 (226)
203 2ej4_A Zinc finger protein ZIC  21.5      32  0.0011   25.3   1.2   21  256-277    25-45  (95)
204 2jmi_A Protein YNG1, ING1 homo  20.8      25 0.00084   28.2   0.4   11  284-294    52-62  (90)

No 1  
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae}
Probab=99.45  E-value=7.8e-15  Score=147.95  Aligned_cols=72  Identities=19%  Similarity=0.194  Sum_probs=64.5

Q ss_pred             HHHhhhhhcCCCC--CCChhhhhccCCCcccchhHHHHhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHhhcccchhhhhc
Q psy7416           4 ERAQRLFSTKGKT--ALDPSLLAKSKPDKGLKSKQQERQKEIAGLEAQIYKLAEQVSEQRSATKDNVQRKQARGEGERGD   81 (381)
Q Consensus         4 eraqrlf~tk~~~--~l~~~~~ak~~~~~~~~~~~~~k~k~IA~lE~~I~~Lae~L~~~R~~TkeNVERKqarT~~Ere~   81 (381)
                      .+|+|+|++.+++  ||+++.|.|+          ..+.|+||.+|++|++|+++|+++|++|++|||||||||++||++
T Consensus       296 ~~c~K~Fs~~~v~~~hL~GKkh~K~----------~~~~k~iA~~E~~I~~l~~~L~~~~~~Tk~nVERKqa~T~~Ere~  365 (402)
T 4dgw_A          296 PFCSRWFKTSSVFESHLVGKIHKKN----------ESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMA  365 (402)
T ss_dssp             TTTTBCBSSHHHHHTTSSSHHHHHH----------HHHSHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHTCCHHHHHH
T ss_pred             hhhhhhhccccccHHHhcccccchh----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccHHHHHH
Confidence            4799999999998  6888877764          345599999999999999999999999999999999999999999


Q ss_pred             cccc
Q psy7416          82 SEES   85 (381)
Q Consensus        82 E~e~   85 (381)
                      |.++
T Consensus       366 E~e~  369 (402)
T 4dgw_A          366 EMDI  369 (402)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            9763


No 2  
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae}
Probab=99.19  E-value=7.1e-12  Score=126.47  Aligned_cols=73  Identities=21%  Similarity=0.257  Sum_probs=64.1

Q ss_pred             HHHHhhhhccCCCCCChhhhcCCCCCcccchhHHHhhhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcchhhhcccc
Q psy7416         134 ERAQRLFSTKGKTALDPSLLAKSKPDKGLKSKQQERQKEIAGLEAQIYKLAEQVSEQRSATKDNVQRKQARGEGERGDSE  213 (381)
Q Consensus       134 eRA~RLf~~kg~~~ld~slFAK~~~gKs~~~~~~~~~k~~a~~E~~i~~~~~~L~~~~~~T~~~verk~~~t~~E~~~e~  213 (381)
                      .+|+|+|++.       ++|..|+.|| +|.+...+.+.||++|++|++|+++|+++|++|++||+||||||++||++|+
T Consensus       296 ~~c~K~Fs~~-------~v~~~hL~GK-kh~K~~~~~k~iA~~E~~I~~l~~~L~~~~~~Tk~nVERKqa~T~~Ere~E~  367 (402)
T 4dgw_A          296 PFCSRWFKTS-------SVFESHLVGK-IHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEM  367 (402)
T ss_dssp             TTTTBCBSSH-------HHHHTTSSSH-HHHHHHHHSHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHTCCHHHHHHHH
T ss_pred             hhhhhhhccc-------cccHHHhccc-ccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccHHHHHHHH
Confidence            4667777765       5667777777 6777888889999999999999999999999999999999999999999996


Q ss_pred             c
Q psy7416         214 E  214 (381)
Q Consensus       214 ~  214 (381)
                      +
T Consensus       368 e  368 (402)
T 4dgw_A          368 D  368 (402)
T ss_dssp             H
T ss_pred             H
Confidence            5


No 3  
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=82.29  E-value=0.44  Score=27.56  Aligned_cols=22  Identities=32%  Similarity=0.901  Sum_probs=17.6

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.+||. +|.-+..+.+|.
T Consensus         2 k~~~C~~C~~-~f~~~~~l~~H~   23 (30)
T 2m0d_A            2 KPYQCDYCGR-SFSDPTSKMRHL   23 (30)
T ss_dssp             CCEECTTTCC-EESCHHHHHHHH
T ss_pred             cCccCCCCCc-ccCCHHHHHHHH
Confidence            5799999995 566778888884


No 4  
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1
Probab=82.04  E-value=0.49  Score=27.00  Aligned_cols=21  Identities=29%  Similarity=0.743  Sum_probs=16.0

Q ss_pred             eecceeccCCcccChhhhhhhc
Q psy7416         256 SYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       256 ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      +|+|.+||. +|.-+..+.+|-
T Consensus         1 ~~~C~~C~k-~f~~~~~l~~H~   21 (27)
T 1znf_A            1 XYKCGLCER-SFVEKSALSRHQ   21 (27)
T ss_dssp             -CBCSSSCC-BCSSHHHHHHHG
T ss_pred             CccCCCCCC-cCCCHHHHHHHH
Confidence            489999985 455778888885


No 5  
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=81.80  E-value=0.43  Score=27.44  Aligned_cols=22  Identities=23%  Similarity=0.635  Sum_probs=17.1

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .+|.|.+||. +|.-+..+.+|-
T Consensus         1 ~~~~C~~C~k-~f~~~~~l~~H~   22 (29)
T 2m0f_A            1 GPLKCRECGK-QFTTSGNLKRHL   22 (29)
T ss_dssp             CCEECTTTSC-EESCHHHHHHHH
T ss_pred             CCccCCCCCC-ccCChhHHHHHH
Confidence            3699999985 566777888874


No 6  
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A
Probab=81.75  E-value=0.47  Score=27.48  Aligned_cols=22  Identities=14%  Similarity=0.481  Sum_probs=17.0

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|++||. .|.-+..+.+|-
T Consensus         1 k~~~C~~C~k-~f~~~~~l~~H~   22 (29)
T 1rik_A            1 YKFACPECPK-RFMRSDHLTLHI   22 (29)
T ss_dssp             CCEECSSSSC-EESCSHHHHHHH
T ss_pred             CCccCCCCCc-hhCCHHHHHHHH
Confidence            4699999996 455777888884


No 7  
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}
Probab=81.14  E-value=0.54  Score=26.91  Aligned_cols=22  Identities=14%  Similarity=0.427  Sum_probs=16.4

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.+||. +|.-+..+.+|-
T Consensus         1 k~~~C~~C~~-~f~~~~~l~~H~   22 (29)
T 2m0e_A            1 KEHKCPHCDK-KFNQVGNLKAHL   22 (29)
T ss_dssp             CCCCCSSCCC-CCCTTTHHHHHH
T ss_pred             CCCcCCCCCc-ccCCHHHHHHHH
Confidence            4699999995 455677777773


No 8  
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=80.88  E-value=0.52  Score=27.52  Aligned_cols=21  Identities=24%  Similarity=0.740  Sum_probs=16.4

Q ss_pred             ceecceeccCCcccChhhhhhh
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRH  276 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~H  276 (381)
                      ++|.|.+||. +|.-+..+.+|
T Consensus         1 k~~~C~~C~k-~f~~~~~l~~H   21 (30)
T 1paa_A            1 KAYACGLCNR-AFTRRDLLIRH   21 (30)
T ss_dssp             CCSBCTTTCC-BCSSSHHHHHH
T ss_pred             CCcCCcccCc-ccCChHHHHHH
Confidence            3699999986 55577788887


No 9  
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=80.74  E-value=0.37  Score=27.55  Aligned_cols=21  Identities=29%  Similarity=0.719  Sum_probs=14.4

Q ss_pred             ceecceeccCCcccChhhhhhh
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRH  276 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~H  276 (381)
                      ++|.|++||.. |.-+..+.+|
T Consensus         1 kp~~C~~C~k~-f~~~~~l~~H   21 (26)
T 2lvu_A            1 KPYVCERCGKR-FVQSSQLANH   21 (26)
Confidence            46999999863 4345566666


No 10 
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=79.47  E-value=0.63  Score=26.85  Aligned_cols=22  Identities=23%  Similarity=0.797  Sum_probs=17.1

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.+||.. |.-+..+.+|-
T Consensus         2 k~~~C~~C~k~-f~~~~~l~~H~   23 (28)
T 2kvf_A            2 RPYSCSVCGKR-FSLKHQMETHY   23 (28)
T ss_dssp             CSEECSSSCCE-ESCHHHHHHHH
T ss_pred             cCccCCCCCcc-cCCHHHHHHHH
Confidence            47999999864 55777888884


No 11 
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=78.67  E-value=0.77  Score=26.38  Aligned_cols=22  Identities=18%  Similarity=0.605  Sum_probs=16.6

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.+||. +|.-+..+.+|-
T Consensus         2 k~~~C~~C~k-~f~~~~~l~~H~   23 (27)
T 2kvh_A            2 KPFSCSLCPQ-RSRDFSAMTKHL   23 (27)
T ss_dssp             CCEECSSSSC-EESSHHHHHHHH
T ss_pred             cCccCCCcCh-hhCCHHHHHHHH
Confidence            5799999986 455677777773


No 12 
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}
Probab=78.58  E-value=0.5  Score=27.55  Aligned_cols=22  Identities=18%  Similarity=0.573  Sum_probs=15.2

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|++||.. |.-+..+.+|-
T Consensus         1 k~~~C~~C~k~-f~~~~~l~~H~   22 (29)
T 2lvt_A            1 KPCQCVMCGKA-FTQASSLIAHV   22 (29)
Confidence            36999999863 44556666663


No 13 
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=76.08  E-value=1.1  Score=27.45  Aligned_cols=24  Identities=21%  Similarity=0.580  Sum_probs=18.5

Q ss_pred             CCceecceeccCCcccChhhhhhhc
Q psy7416         253 LNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       253 L~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      -...|.|.+||. .|.-+..+.+|-
T Consensus         6 ~~~~~~C~~C~k-~f~~~~~l~~H~   29 (36)
T 2elr_A            6 SGKTHLCDMCGK-KFKSKGTLKSHK   29 (36)
T ss_dssp             CCSSCBCTTTCC-BCSSHHHHHHHH
T ss_pred             CCCCeecCcCCC-CcCchHHHHHHH
Confidence            356899999986 566788888884


No 14 
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*
Probab=75.78  E-value=0.82  Score=46.23  Aligned_cols=35  Identities=31%  Similarity=0.585  Sum_probs=30.7

Q ss_pred             CCceecceeccCC-----cccChhhhhhhcchhhhhhccc
Q psy7416         253 LNISYTCEICGNF-----VYKGPKAFQRHFAEWRHAHGMR  287 (381)
Q Consensus       253 L~~ey~CEICGn~-----~Y~GrkaFe~HF~E~rH~~Gmr  287 (381)
                      .-+.|.||||+..     +-.|-...+.|.+.-||.+.++
T Consensus       357 ~~~~~~Ce~C~~~~~~~~~~~ge~~W~~H~ksr~Hk~~~~  396 (409)
T 3eph_A          357 DWTHYTCNVCRNADGKNVVAIGEKYWKIHLGSRRHKSNLK  396 (409)
T ss_dssp             CCCEEEEEEEECTTSCEEEEESHHHHHHHHTSHHHHHHHH
T ss_pred             cccceeCCCCCCCCCCcceEEcHHHHHHHhhhhHHHHHHH
Confidence            4477999999984     7889999999999999998765


No 15 
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A
Probab=75.07  E-value=1.1  Score=27.73  Aligned_cols=26  Identities=12%  Similarity=0.254  Sum_probs=19.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.=.++|+|.+||. +|.-+..+.+|-
T Consensus         6 h~~~k~~~C~~C~k-~f~~~~~l~~H~   31 (37)
T 1p7a_A            6 STGIKPFQCPDCDR-SFSRSDHLALHR   31 (37)
T ss_dssp             TCCSSSBCCTTTCC-CBSSHHHHHHHH
T ss_pred             CCCCCCccCCCCCc-ccCcHHHHHHHH
Confidence            44457899999985 555677888883


No 16 
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=75.03  E-value=1.2  Score=27.37  Aligned_cols=24  Identities=29%  Similarity=0.664  Sum_probs=18.1

Q ss_pred             CCceecceeccCCcccChhhhhhhc
Q psy7416         253 LNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       253 L~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      -.++|+|.+||. +|.-+..+.+|-
T Consensus         6 ~~k~~~C~~C~k-~f~~~~~l~~H~   29 (36)
T 2elv_A            6 SGLLYDCHICER-KFKNELDRDRHM   29 (36)
T ss_dssp             CCCCEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCeECCCCCC-ccCCHHHHHHHH
Confidence            356899999986 455777777774


No 17 
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens}
Probab=74.72  E-value=1.1  Score=30.31  Aligned_cols=23  Identities=35%  Similarity=0.895  Sum_probs=18.7

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .+.|.|.+|| ..|.-+..+.+|.
T Consensus         5 ~kp~~C~~C~-k~F~~~~~L~~H~   27 (48)
T 3iuf_A            5 DKPYACDICG-KRYKNRPGLSYHY   27 (48)
T ss_dssp             TSCEECTTTC-CEESSHHHHHHHH
T ss_pred             CcCEECCCcC-cccCCHHHHHHHh
Confidence            5789999999 5677788888885


No 18 
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A
Probab=74.17  E-value=1.2  Score=25.60  Aligned_cols=22  Identities=18%  Similarity=0.492  Sum_probs=16.5

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      +.|.|.+||.. |.-+..+.+|-
T Consensus         1 k~~~C~~C~k~-f~~~~~l~~H~   22 (30)
T 1klr_A            1 KTYQCQYCEFR-SADSSNLKTHI   22 (30)
T ss_dssp             CCCCCSSSSCC-CSCSHHHHHHH
T ss_pred             CCccCCCCCCc-cCCHHHHHHHH
Confidence            36999999875 44677788773


No 19 
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=73.56  E-value=1.1  Score=28.12  Aligned_cols=25  Identities=20%  Similarity=0.351  Sum_probs=18.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhh
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRH  276 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~H  276 (381)
                      |.=.++|+|.+||. +|.-+..+.+|
T Consensus         4 H~~~k~~~C~~C~k-~f~~~~~L~~H   28 (37)
T 2elm_A            4 GSSGHLYYCSQCHY-SSITKNCLKRH   28 (37)
T ss_dssp             SSSSCEEECSSSSC-EEECHHHHHHH
T ss_pred             cCCCcCeECCCCCc-ccCCHHHHHHH
Confidence            44457899999985 45567777777


No 20 
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}
Probab=73.25  E-value=0.81  Score=26.54  Aligned_cols=22  Identities=23%  Similarity=0.531  Sum_probs=16.4

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.+||.. |.-+..+.+|-
T Consensus         2 k~~~C~~C~k~-f~~~~~l~~H~   23 (27)
T 2kvg_A            2 APYRCPLCRAG-CPSLASMQAHM   23 (27)
T ss_dssp             CTEEETTTTEE-ESCHHHHHHHH
T ss_pred             cCcCCCCCCcc-cCCHHHHHHHH
Confidence            57999999864 55677777773


No 21 
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=72.18  E-value=1.5  Score=26.69  Aligned_cols=23  Identities=17%  Similarity=0.391  Sum_probs=17.9

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .++|+|.+||. .|.-+..+.+|-
T Consensus         7 ~k~~~C~~C~k-~f~~~~~l~~H~   29 (36)
T 2elt_A            7 GKPYKCPQCSY-ASAIKANLNVHL   29 (36)
T ss_dssp             CCSEECSSSSC-EESSHHHHHHHH
T ss_pred             CCCCCCCCCCc-ccCCHHHHHHHH
Confidence            56899999985 555777888884


No 22 
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=71.43  E-value=1.4  Score=28.70  Aligned_cols=30  Identities=20%  Similarity=0.351  Sum_probs=22.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcchhhhh
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFAEWRHA  283 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~E~rH~  283 (381)
                      |.-..+|.|++||. +|.-+..+.+|.  ..|.
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~--~~H~   36 (46)
T 2eov_A            7 GTGEKPYKCSDCGK-SFTWKSRLRIHQ--KCHT   36 (46)
T ss_dssp             CSSCCSCBCSSSCC-BCSSHHHHHHHH--HHHS
T ss_pred             CCCCCCccCCccCh-hhCCHHHHHHHH--HhcC
Confidence            44457899999995 566889999995  3453


No 23 
>1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A
Probab=70.88  E-value=0.78  Score=30.89  Aligned_cols=14  Identities=43%  Similarity=0.990  Sum_probs=11.7

Q ss_pred             CceecceeccCCcc
Q psy7416         254 NISYTCEICGNFVY  267 (381)
Q Consensus       254 ~~ey~CEICGn~~Y  267 (381)
                      ..-|+|++|||.+-
T Consensus         4 ~~fY~C~~CGnive   17 (36)
T 1dxg_A            4 GDVYKCELCGQVVK   17 (36)
T ss_dssp             TCEEECTTTCCEEE
T ss_pred             ccEEEcCCCCcEEE
Confidence            46799999999875


No 24 
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}
Probab=73.46  E-value=0.87  Score=26.39  Aligned_cols=22  Identities=36%  Similarity=0.759  Sum_probs=15.9

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.+||.. |.-+..+.+|-
T Consensus         2 k~~~C~~C~k~-f~~~~~l~~H~   23 (30)
T 2lvr_A            2 KPYVCIHCQRQ-FADPGALQRHV   23 (30)
Confidence            47999999864 44566677764


No 25 
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=70.34  E-value=1.7  Score=26.62  Aligned_cols=23  Identities=30%  Similarity=0.690  Sum_probs=18.0

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ...|.|.+||.. |.-+..+.+|-
T Consensus         7 ~k~~~C~~C~k~-f~~~~~l~~H~   29 (36)
T 2els_A            7 GKIFTCEYCNKV-FKFKHSLQAHL   29 (36)
T ss_dssp             CCCEECTTTCCE-ESSHHHHHHHH
T ss_pred             CCCEECCCCCce-eCCHHHHHHHH
Confidence            467999999874 66778888884


No 26 
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A
Probab=69.14  E-value=1.7  Score=24.77  Aligned_cols=22  Identities=27%  Similarity=0.828  Sum_probs=16.6

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .+|.|++||.. |.-+..+.+|-
T Consensus         1 k~~~C~~C~~~-f~~~~~l~~H~   22 (29)
T 1ard_A            1 RSFVCEVCTRA-FARQEHLKRHY   22 (29)
T ss_dssp             CCCBCTTTCCB-CSSHHHHHHHH
T ss_pred             CCeECCCCCcc-cCCHHHHHHHH
Confidence            36999999864 55677788874


No 27 
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=68.27  E-value=1.6  Score=27.62  Aligned_cols=26  Identities=15%  Similarity=0.442  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|-
T Consensus         5 H~~~k~~~C~~C~k-~f~~~~~L~~H~   30 (42)
T 2yte_A            5 SSGEKPYSCAECKE-TFSDNNRLVQHQ   30 (42)
T ss_dssp             SCSCCSCBCTTTCC-BCSSHHHHHHHH
T ss_pred             cCCCCCeECCCCCC-ccCCHHHHHHHH
Confidence            44457899999986 566778888884


No 28 
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}
Probab=67.86  E-value=2.1  Score=25.72  Aligned_cols=23  Identities=17%  Similarity=0.574  Sum_probs=17.7

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .+.|.|.+||. .|.-+..+.+|-
T Consensus         5 ~k~~~C~~C~k-~f~~~~~L~~H~   27 (35)
T 2elx_A            5 SSGYVCALCLK-KFVSSIRLRSHI   27 (35)
T ss_dssp             CCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCeECCCCcc-hhCCHHHHHHHH
Confidence            46799999986 455677888874


No 29 
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=66.13  E-value=2.6  Score=26.80  Aligned_cols=27  Identities=30%  Similarity=0.762  Sum_probs=20.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |.-.++|.|++||. +|.-+..+.+|-.
T Consensus         6 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   32 (42)
T 2eos_A            6 SGGEKPYPCEICGT-RFRHLQTLKSHLR   32 (42)
T ss_dssp             CSSSCCBCCSSSCC-CBSSHHHHHHHTT
T ss_pred             cCCCCCEECCCCCC-ccCCHHHHHHHHH
Confidence            44467899999986 4667788888853


No 30 
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1
Probab=65.99  E-value=2  Score=30.07  Aligned_cols=24  Identities=33%  Similarity=0.880  Sum_probs=19.2

Q ss_pred             CceecceeccCCcccChhhhhhhcc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      ..+|.|++||. +|.-+..+.+|-.
T Consensus         8 ~k~~~C~~C~k-~f~~~~~l~~H~~   31 (66)
T 2drp_A            8 EHTYRCKVCSR-VYTHISNFCRHYV   31 (66)
T ss_dssp             TTEEECTTTCC-EESSHHHHHHHHH
T ss_pred             CcceECCCCcc-hhCCHHHHHHHHH
Confidence            57899999984 6778888888853


No 31 
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=65.75  E-value=2.5  Score=26.04  Aligned_cols=26  Identities=19%  Similarity=0.484  Sum_probs=18.5

Q ss_pred             hCCCceecceeccCCcccCh-hhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGP-KAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~Gr-kaFe~HF  277 (381)
                      |--..+|+|.+||.. |.-+ ..+.+|-
T Consensus         4 h~~~k~~~C~~C~k~-f~~~~~~L~~H~   30 (37)
T 2elp_A            4 GSSGRAMKCPYCDFY-FMKNGSDLQRHI   30 (37)
T ss_dssp             CCCCCCEECSSSSCE-ECSSCHHHHHHH
T ss_pred             CCCCCCeECCCCChh-hccCHHHHHHHH
Confidence            334578999999864 5455 6788874


No 32 
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic}
Probab=65.73  E-value=1.1  Score=27.24  Aligned_cols=22  Identities=18%  Similarity=0.632  Sum_probs=15.0

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.+||.. |.-+..+.+|-
T Consensus         1 kp~~C~~C~k~-f~~~~~L~~H~   22 (32)
T 2kfq_A            1 YAFACPACPKR-FMRSDALSKHI   22 (32)
T ss_dssp             CCSSSSSSCTT-HHHHHTTSSST
T ss_pred             CCCCCCCCCcc-cCCHHHHHHHH
Confidence            36999999864 44555666663


No 33 
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=65.56  E-value=1.8  Score=28.07  Aligned_cols=26  Identities=19%  Similarity=0.326  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=..+|.|++||.. |.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k~-F~~~~~L~~H~   32 (44)
T 2epv_A            7 GSGEKPYECNECGKA-FIWKSLLIVHE   32 (44)
T ss_dssp             CCCCCSEECSSSCCE-ESSHHHHHHHH
T ss_pred             cCCCcCeECCCCCcc-cCchHHHHHHH
Confidence            444578999999864 66788888884


No 34 
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=65.27  E-value=1.9  Score=28.09  Aligned_cols=26  Identities=15%  Similarity=0.406  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2eoy_A            7 GQKEKCFKCNKCEK-TFSCSKYLTQHE   32 (46)
T ss_dssp             CCCSCCEECSSSCC-EESSSHHHHHHH
T ss_pred             cCCCCCEECcCCCC-cCCCHHHHHHHH
Confidence            44457899999985 566788888884


No 35 
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1
Probab=64.82  E-value=2.5  Score=25.80  Aligned_cols=22  Identities=14%  Similarity=0.540  Sum_probs=17.0

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.+||.. |.....+.+|-
T Consensus         1 kp~~C~~C~k~-F~~~~~L~~H~   22 (33)
T 1rim_A            1 YKFACPECPKR-FMRSDHLSKHI   22 (33)
T ss_dssp             CCCCCSSSCCC-CSSHHHHHHHH
T ss_pred             CcccCCCCCch-hCCHHHHHHHH
Confidence            46999999974 55777888884


No 36 
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A
Probab=64.23  E-value=2.5  Score=26.52  Aligned_cols=23  Identities=30%  Similarity=0.706  Sum_probs=17.6

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .+.|.|.+||.. |.-+..+.+|-
T Consensus         4 ~k~~~C~~C~k~-f~~~~~L~~H~   26 (39)
T 1njq_A            4 PRSYTCSFCKRE-FRSAQALGGHM   26 (39)
T ss_dssp             SSSEECTTTCCE-ESSHHHHHHHH
T ss_pred             CCceECCCCCcc-cCCHHHHHHHH
Confidence            468999999864 55777788873


No 37 
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=64.01  E-value=2.5  Score=27.39  Aligned_cols=26  Identities=23%  Similarity=0.543  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--..+|.|++||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2eme_A            7 GSGEKPYVCDYCGK-AFGLSAELVRHQ   32 (46)
T ss_dssp             TCCCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCeECCCCCh-hhCCHHHHHHHH
Confidence            44467899999985 566788899885


No 38 
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=63.96  E-value=2.8  Score=26.48  Aligned_cols=27  Identities=22%  Similarity=0.596  Sum_probs=20.5

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |.-..+|.|.+||. +|.-+..+.+|..
T Consensus         6 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   32 (42)
T 2ytb_A            6 SGGEKPYRCDQCGK-AFSQKGSLIVHIR   32 (42)
T ss_dssp             CCSCCSBCCTTTTC-CBSSHHHHHTTGG
T ss_pred             cCCCCCeeCCCccc-hhCCHHHHHHHHH
Confidence            44457899999986 4667888888853


No 39 
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=63.46  E-value=2.8  Score=27.15  Aligned_cols=26  Identities=23%  Similarity=0.488  Sum_probs=20.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2yts_A            7 GTGEKPYICNECGK-SFIQKSHLNRHR   32 (46)
T ss_dssp             CCSCCSEECSSSCC-EESSHHHHHHHG
T ss_pred             CCCCcCEECCCCCh-hhCChHHHHHHH
Confidence            44467899999986 566888899985


No 40 
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=62.79  E-value=1.8  Score=27.81  Aligned_cols=26  Identities=23%  Similarity=0.450  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (44)
T 2eoj_A            7 GTGENPYECCECGK-VFSRKDQLVSHQ   32 (44)
T ss_dssp             SSSCCSCEETTTTE-ECSSHHHHHHHH
T ss_pred             cCCCcCeeCCCCCC-ccCCHHHHHHHH
Confidence            44467899999986 566788888884


No 41 
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A
Probab=62.65  E-value=2.4  Score=27.62  Aligned_cols=26  Identities=15%  Similarity=0.386  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. .|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2emj_A            7 GTGEKPFECAECGK-SFSISSQLATHQ   32 (46)
T ss_dssp             CCCCCSEECSSSSC-EESSHHHHHHHH
T ss_pred             CCCCCCEECCCCCc-ccCCHHHHHHHH
Confidence            44457899999985 566888899885


No 42 
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A
Probab=62.50  E-value=3.5  Score=27.78  Aligned_cols=28  Identities=21%  Similarity=0.496  Sum_probs=21.3

Q ss_pred             HhhCCCceecceeccCCcccChhhhhhhc
Q psy7416         249 KLHGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       249 KLhGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      +.|.-...|.|.+||. +|.-+..+.+|-
T Consensus        22 ~~h~~~~~~~C~~C~~-~f~~~~~l~~H~   49 (57)
T 1bbo_A           22 RTHTDVRPYHCTYCNF-SFKTKGNLTKHM   49 (57)
T ss_dssp             HHTSSCCCEECSSSSC-EESSHHHHHHHH
T ss_pred             HhcCCCCCccCCCCCc-hhcCHHHHHHHH
Confidence            3455567899999985 566788888884


No 43 
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A
Probab=62.43  E-value=2.4  Score=26.78  Aligned_cols=26  Identities=23%  Similarity=0.544  Sum_probs=19.8

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.=.++|.|.+||. +|.-+..+.+|-
T Consensus         6 H~~~~~~~C~~C~k-~f~~~~~l~~H~   31 (42)
T 2epc_A            6 SGGETPYLCGQCGK-SFTQRGSLAVHQ   31 (42)
T ss_dssp             CCSSCCEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCeECCCCCc-ccCCHHHHHHHh
Confidence            44467899999986 466788888884


No 44 
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=61.85  E-value=2  Score=27.71  Aligned_cols=26  Identities=27%  Similarity=0.502  Sum_probs=19.7

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--..+|.|++||. +|.-+..+.+|-
T Consensus         7 H~~~~~~~C~~C~k-~F~~~~~L~~H~   32 (44)
T 2eox_A            7 GTDSKSYNCNECGK-AFTRIFHLTRHQ   32 (44)
T ss_dssp             CCCCCCEEETTTTE-EESSSHHHHTTH
T ss_pred             CCCCCCeECcccCc-ccCCHHHHHHHH
Confidence            44457899999986 566778888884


No 45 
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=61.73  E-value=2.8  Score=27.20  Aligned_cols=26  Identities=27%  Similarity=0.549  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=...|+|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2enf_A            7 GTGEKPYKCNECGK-VFTQNSHLVRHR   32 (46)
T ss_dssp             CCCCCSCBCSSSCC-BCSSHHHHHHHH
T ss_pred             CCCCcCeECCCCCc-ccCCHHHHHHHH
Confidence            33457899999986 566788888884


No 46 
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=61.64  E-value=3.3  Score=26.13  Aligned_cols=26  Identities=19%  Similarity=0.479  Sum_probs=19.7

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.=.+.|.|.+||. +|.-+..+.+|-
T Consensus         5 h~~~k~~~C~~C~k-~f~~~~~L~~H~   30 (41)
T 2ept_A            5 SSGQRVYECQECGK-SFRQKGSLTLHE   30 (41)
T ss_dssp             CCCCCCEECSSSCC-EESSHHHHHHHG
T ss_pred             cCCCCCeECCCCCC-CcCCHHHHHHHH
Confidence            44467899999986 566778888884


No 47 
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=61.25  E-value=3.1  Score=26.95  Aligned_cols=26  Identities=27%  Similarity=0.566  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2yti_A            7 GTGEKPYKCNECGK-VFTQNSHLARHR   32 (46)
T ss_dssp             CSCCCTTCCSSSCC-CCSSHHHHHHHH
T ss_pred             CCCCcCeECCCCCc-ccCChhHHHHHh
Confidence            44457899999986 566788898884


No 48 
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=61.17  E-value=3.5  Score=26.78  Aligned_cols=26  Identities=15%  Similarity=0.440  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|+|.+||. .|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2emz_A            7 GSGERPFKCNECGK-GFGRRSHLAGHL   32 (46)
T ss_dssp             SSCCCSCCCSSSCC-CCSSHHHHHHHH
T ss_pred             CCCCCCeECCCCCc-ccCCHHHHHHHH
Confidence            44467899999986 466788888884


No 49 
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A*
Probab=61.10  E-value=3.3  Score=28.12  Aligned_cols=28  Identities=25%  Similarity=0.476  Sum_probs=21.2

Q ss_pred             HhhCCCceecceeccCCcccChhhhhhhc
Q psy7416         249 KLHGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       249 KLhGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      +.|.=...|.|.+||. +|.-+..+.+|.
T Consensus        17 ~~H~~~k~~~C~~C~k-~f~~~~~L~~H~   44 (54)
T 1yui_A           17 SRSQSEQPATCPICYA-VIRQSRNLRRHL   44 (54)
T ss_dssp             HHHTSSCCEECTTTCC-EESSHHHHHHHH
T ss_pred             HhcCCCCCccCCCCCc-ccCCHHHHHHHH
Confidence            3455568899999996 456778888885


No 50 
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=61.04  E-value=3  Score=27.07  Aligned_cols=26  Identities=19%  Similarity=0.425  Sum_probs=20.6

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|++||. .|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ytj_A            7 GTGEKPYICAECGK-AFTIRSNLIKHQ   32 (46)
T ss_dssp             TSSCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCcCeECCCCCh-hhCCHHHHHHHH
Confidence            44467899999986 566888899985


No 51 
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=60.81  E-value=3.4  Score=26.75  Aligned_cols=26  Identities=27%  Similarity=0.663  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|+|.+||. +|.-+..+.+|-
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2eoq_A            7 GTGEKPFKCDICGK-SFCGRSRLNRHS   32 (46)
T ss_dssp             SSSSCSCCCSSSCC-CCSSHHHHHHHH
T ss_pred             CCCCCCcCCCcCCc-hhCCHHHHHHHH
Confidence            44457899999986 466788899884


No 52 
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=60.80  E-value=3.4  Score=26.78  Aligned_cols=26  Identities=23%  Similarity=0.471  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|+|++||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2em7_A            7 GTGEKPYKCEECGK-GFICRRDLYTHH   32 (46)
T ss_dssp             SSCCCSEECSSSCC-EESCHHHHHHHG
T ss_pred             CCCCcCccCCCccc-hhCCHHHHHHHH
Confidence            44457899999986 577888999994


No 53 
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=60.76  E-value=2.7  Score=27.34  Aligned_cols=27  Identities=15%  Similarity=0.393  Sum_probs=20.7

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |-=.++|.|++||. +|.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~~   33 (46)
T 2emf_A            7 GTGGKHFECTECGK-AFTRKSTLSMHQK   33 (46)
T ss_dssp             SSSSCCEECSSSCC-EESCHHHHHHHGG
T ss_pred             cCCCCCeECCCCCc-hhCCHHHHHHHHH
Confidence            44457899999985 5667888999864


No 54 
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=60.44  E-value=2.6  Score=26.95  Aligned_cols=26  Identities=19%  Similarity=0.420  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|.|++||. .|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (44)
T 2en7_A            7 GTGMKPYVCNECGK-AFRSKSYLIIHT   32 (44)
T ss_dssp             SSSSSSSCCTTTCC-CCSSHHHHHHHH
T ss_pred             CCCCcCeECCCCCC-ccCCHHHHHHHh
Confidence            44457899999986 466788888885


No 55 
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}
Probab=60.42  E-value=3.1  Score=28.04  Aligned_cols=27  Identities=22%  Similarity=0.476  Sum_probs=19.8

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .|--.++|.|.+||. +|.-+..+.+|.
T Consensus        26 ~h~~~~~~~C~~C~~-~f~~~~~l~~H~   52 (57)
T 3uk3_C           26 THTGEKPYKCEFCEY-AAAQKTSLRYHL   52 (57)
T ss_dssp             HHHCCCCEECSSSSC-EESSHHHHHHHH
T ss_pred             HcCCCCCcCCCCCcc-hhCCHHHHHHHH
Confidence            455567899999974 566777888774


No 56 
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=60.40  E-value=2.9  Score=27.12  Aligned_cols=26  Identities=19%  Similarity=0.443  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ep3_A            7 GTGEKPYRCAECGK-AFTDRSNLFTHQ   32 (46)
T ss_dssp             SSCCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCeECCCCCc-hhCCHHHHHHHH
Confidence            44467899999986 566888898885


No 57 
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=60.40  E-value=3.4  Score=26.79  Aligned_cols=27  Identities=19%  Similarity=0.385  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--.+.|.|.+||. .|.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2emg_A            7 GTGENPFICSECGK-VFTHKTNLIIHQK   33 (46)
T ss_dssp             CCSCCSCBCTTTCC-BCSSHHHHHHHHT
T ss_pred             CCCCCCEECCccCc-ccCCHHHHHHHHH
Confidence            43456899999986 5667888999853


No 58 
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A
Probab=60.12  E-value=3.1  Score=27.08  Aligned_cols=26  Identities=19%  Similarity=0.416  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-.+.|.|.+||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ely_A            7 GTGEKPFKCVECGK-GFSRRSALNVHH   32 (46)
T ss_dssp             CCCCCSBCCSSSCC-CBSSTTHHHHHH
T ss_pred             CCCCCCcccCccCc-ccCCHHHHHHHH
Confidence            44467899999986 566788888884


No 59 
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=60.09  E-value=2.9  Score=27.19  Aligned_cols=26  Identities=19%  Similarity=0.466  Sum_probs=20.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-.++|.|++||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2eoo_A            7 GSGERPYGCNECGK-NFGRHSHLIEHL   32 (46)
T ss_dssp             CSCCCCEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCEEccccCc-ccCCHHHHHHHH
Confidence            44567899999986 566788888884


No 60 
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=60.06  E-value=3.1  Score=26.33  Aligned_cols=26  Identities=27%  Similarity=0.613  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-.++|.|++||. +|.-+..+.+|-
T Consensus         6 H~~~k~~~C~~C~k-~f~~~~~L~~H~   31 (42)
T 2en2_A            6 SGGEKPYKCETCGA-RFVQVAHLRAHV   31 (42)
T ss_dssp             CCSSCSEECTTTCC-EESSHHHHHHHT
T ss_pred             cCCCCCEeCCCcCh-hhCCHHHHHHHH
Confidence            33457899999986 566788888885


No 61 
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A
Probab=60.02  E-value=2.9  Score=27.05  Aligned_cols=26  Identities=15%  Similarity=0.259  Sum_probs=20.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2el4_A            7 GTGVKPYGCSQCAK-TFSLKSQLIVHQ   32 (46)
T ss_dssp             SCCCCSEECSSSSC-EESSHHHHHHHG
T ss_pred             CCCCCceECCCCCc-hhCCHHHHHHHH
Confidence            44467899999985 566788899985


No 62 
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=59.77  E-value=3.4  Score=26.84  Aligned_cols=27  Identities=15%  Similarity=0.475  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--.+.|.|.+||. .|.-+..+.+|..
T Consensus         7 h~~~k~~~C~~C~k-~F~~~~~L~~H~~   33 (46)
T 2enh_A            7 GTGEKPYECDVCRK-AFSHHASLTQHQR   33 (46)
T ss_dssp             CCCSSSCBCTTTCC-BCSSSHHHHHHGG
T ss_pred             cCCCCCcCCCCcCc-hhCCHHHHHHHHH
Confidence            33456899999986 5667788888853


No 63 
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=59.03  E-value=2.8  Score=26.74  Aligned_cols=26  Identities=15%  Similarity=0.354  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (44)
T 2eof_A            7 GTGEKPYECNECQK-AFNTKSNLMVHQ   32 (44)
T ss_dssp             CSCCCSEECTTTCC-EESCHHHHHHHH
T ss_pred             CCCCCCeECCCCCc-ccCCHhHHHHHH
Confidence            44467899999985 566788888885


No 64 
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=59.00  E-value=4.1  Score=26.54  Aligned_cols=26  Identities=19%  Similarity=0.611  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. .|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2eon_A            7 GTGEKPYKCQVCGK-AFRVSSHLVQHH   32 (46)
T ss_dssp             CSSCCSCBCSSSCC-BCSSHHHHHHHT
T ss_pred             CCCCcccCCCCCCc-ccCcHHHHHHHH
Confidence            44457899999986 466788888885


No 65 
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.99  E-value=2.5  Score=27.43  Aligned_cols=26  Identities=19%  Similarity=0.487  Sum_probs=20.5

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--..+|.|++||. +|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2en1_A            7 GSGEKPFKCEECGK-RFTQNSQLHSHQ   32 (46)
T ss_dssp             CCCCCSEEETTTTE-EESSHHHHHHHG
T ss_pred             CCCCCCeeCCCCCc-ccCCHHHHHHHH
Confidence            44467899999985 566888899885


No 66 
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.88  E-value=3.8  Score=26.51  Aligned_cols=26  Identities=19%  Similarity=0.425  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2emi_A            7 GTGERHYECSECGK-AFIQKSTLSMHQ   32 (46)
T ss_dssp             CSSCCCEECSSSCC-EESSHHHHHHHH
T ss_pred             cCCCCCCCCCCCCc-ccCCHHHHHHHH
Confidence            44467899999986 456788888884


No 67 
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.70  E-value=2.3  Score=27.69  Aligned_cols=26  Identities=19%  Similarity=0.597  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|.|++||. .|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2eoz_A            7 GTGEKPYSCNVCGK-AFVLSAHLNQHL   32 (46)
T ss_dssp             CSSCCSEEETTTTE-EESSHHHHHHHH
T ss_pred             CCCCCCeECcccCh-hhCCHHHHHHHH
Confidence            44457899999985 566788888884


No 68 
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.68  E-value=3.5  Score=26.81  Aligned_cols=26  Identities=19%  Similarity=0.473  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.+.|.|++||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ytq_A            7 GAGEKPYGCSECGK-AFSSKSYLIIHM   32 (46)
T ss_dssp             SSCCCSCBCSSSCC-BCSCHHHHHHHH
T ss_pred             cCCCCCcCCCccCh-hhCChHHHHHHH
Confidence            44457899999986 566788888884


No 69 
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.64  E-value=3.8  Score=26.54  Aligned_cols=26  Identities=15%  Similarity=0.400  Sum_probs=19.7

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.++|.|.+||. .|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2en3_A            7 GTGEKPFQCKECGM-NFSWSCSLFKHL   32 (46)
T ss_dssp             SCCCCSEECSSSCC-EESSSHHHHHHH
T ss_pred             cCCCCCeeCcccCh-hhCCHHHHHHHH
Confidence            44457899999986 455778888885


No 70 
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.59  E-value=3.1  Score=27.01  Aligned_cols=26  Identities=27%  Similarity=0.566  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|++||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2yu8_A            7 GTGEKPYKCNECGK-VFTQNSHLARHR   32 (46)
T ss_dssp             CCCCSSEECSSSCC-EESSSHHHHHHT
T ss_pred             CCCCCCeECCcCCc-hhCCHHHHHHHH
Confidence            44467899999985 566788999995


No 71 
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.44  E-value=3.2  Score=26.82  Aligned_cols=26  Identities=15%  Similarity=0.227  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=..+|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2eop_A            7 GTGEKPHECRECGK-SFSFNSQLIVHQ   32 (46)
T ss_dssp             CCCCCSCBCTTTCC-BCSSHHHHHHHH
T ss_pred             cCCCCCeeCCCCCc-hhCCHHHHHHHH
Confidence            44457899999985 566788898885


No 72 
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.34  E-value=3  Score=26.95  Aligned_cols=26  Identities=27%  Similarity=0.530  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-..+|.|.+||. .|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2eor_A            7 GTGEKPYNCEECGK-AFIHDSQLQEHQ   32 (46)
T ss_dssp             SSCCCSEECTTTCC-EESSHHHHHHHH
T ss_pred             cCCCcCccCCCCCC-CcCCHHHHHHHH
Confidence            44467899999986 466788888884


No 73 
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=58.28  E-value=3.1  Score=26.94  Aligned_cols=27  Identities=19%  Similarity=0.523  Sum_probs=20.7

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |.=..+|.|++||. +|.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2eml_A            7 GTGEKPYECSVCGK-AFSHRQSLSVHQR   33 (46)
T ss_dssp             CSSCCSEECSSSCC-EESSHHHHHHHHG
T ss_pred             cCCCCCeeCCCcCC-ccCCHHHHHHHHH
Confidence            44467899999986 5668888999853


No 74 
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=58.21  E-value=4.2  Score=24.73  Aligned_cols=24  Identities=13%  Similarity=0.476  Sum_probs=17.9

Q ss_pred             CCceecceeccCCcccChhhhhhhc
Q psy7416         253 LNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       253 L~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      -.++|+|.+||.. |.-+..+.+|-
T Consensus         6 ~~k~~~C~~C~k~-f~~~~~l~~H~   29 (36)
T 2elq_A            6 SGKPFKCSLCEYA-TRSKSNLKAHM   29 (36)
T ss_dssp             CCCSEECSSSSCE-ESCHHHHHHHH
T ss_pred             CCCCccCCCCCch-hCCHHHHHHHH
Confidence            3568999999764 55677888873


No 75 
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus}
Probab=58.10  E-value=3  Score=30.31  Aligned_cols=22  Identities=27%  Similarity=0.824  Sum_probs=16.6

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ++|+|.+||. +|.-+..+.+|-
T Consensus         3 Kpy~C~~C~k-~F~~~~~L~~H~   24 (60)
T 4gzn_C            3 RPFFCNFCGK-TYRDASGLSRHR   24 (60)
T ss_dssp             CCEECTTTCC-EESSHHHHHHHH
T ss_pred             CCccCCCCCC-EeCCHHHHHHHH
Confidence            5789999985 455777888884


No 76 
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1
Probab=57.88  E-value=4.5  Score=24.36  Aligned_cols=23  Identities=22%  Similarity=0.615  Sum_probs=18.2

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .+.|.|.+||. .|.-+..+.+|-
T Consensus         5 ~k~~~C~~C~k-~f~~~~~l~~H~   27 (35)
T 1srk_A            5 KRPFVCRICLS-AFTTKANCARHL   27 (35)
T ss_dssp             CSCEECSSSCC-EESSHHHHHHHH
T ss_pred             CcCeeCCCCCc-ccCCHHHHHHHH
Confidence            46899999976 555788888884


No 77 
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=57.64  E-value=3.9  Score=26.41  Aligned_cols=26  Identities=19%  Similarity=0.517  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-...|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2eow_A            7 GTGEKPYKCNECGK-AFRARSSLAIHQ   32 (46)
T ss_dssp             SCCCCCEECTTSCC-EESSHHHHHHHH
T ss_pred             CCCCCCeeccccCC-hhcCHHHHHHHH
Confidence            44467899999986 566888888885


No 78 
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=57.54  E-value=3.4  Score=26.77  Aligned_cols=26  Identities=19%  Similarity=0.390  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2emp_A            7 GTGVKPYMCNECGK-AFSVYSSLTTHQ   32 (46)
T ss_dssp             SSCCCSEECSSSCC-EESCHHHHHHHH
T ss_pred             cCCCcCeECCCCCc-hhCCHHHHHHHH
Confidence            44457899999986 566888899885


No 79 
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=57.42  E-value=3.5  Score=26.79  Aligned_cols=26  Identities=15%  Similarity=0.321  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|+|.+||.. |.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k~-f~~~~~L~~H~   32 (46)
T 2eoh_A            7 GSGKKPYECKECRKT-FIQIGHLNQHK   32 (46)
T ss_dssp             CCCSCSCCCSSSCCC-CSSHHHHHHHH
T ss_pred             cCCCCCcCCCCcCch-hCCHHHHHHHH
Confidence            444678999999864 55788888884


No 80 
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=57.35  E-value=4.1  Score=26.38  Aligned_cols=27  Identities=22%  Similarity=0.588  Sum_probs=20.8

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--...|.|.+||. +|.-+..+.+|..
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2ytk_A            7 GSGEKPYKCNECGK-VFTQNSHLTNHWR   33 (46)
T ss_dssp             SSSSCSEECSSSCC-EESSHHHHHHHHH
T ss_pred             CCCCCCEeCCcCCC-ccCCHHHHHHHHH
Confidence            44467899999986 5667888998853


No 81 
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=57.13  E-value=4.2  Score=29.16  Aligned_cols=27  Identities=30%  Similarity=0.749  Sum_probs=19.5

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .|-=...|+|.+||. +|.-+..+.+|-
T Consensus        39 ~H~~~~~~~C~~C~k-~f~~~~~L~~H~   65 (74)
T 2lce_A           39 VHTGEKPYRCNICGA-QFNRPANLKTHT   65 (74)
T ss_dssp             HHCCCCSEECTTTCC-EESCHHHHHHHH
T ss_pred             HcCCCCCEECCCCCc-hhCCHHHHHHHH
Confidence            454567799999985 566777888884


No 82 
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=57.06  E-value=3.5  Score=26.74  Aligned_cols=27  Identities=26%  Similarity=0.560  Sum_probs=20.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--.++|.|.+||. +|.-+..+.+|-.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2ene_A            7 GTGEKPYKCNECGK-VFRHNSYLSRHQR   33 (46)
T ss_dssp             CCCSSSEECSSSCC-EESSHHHHHHHHT
T ss_pred             CCCCCCeECCCCCc-hhCChHHHHHHHh
Confidence            44457899999985 5667888888853


No 83 
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=57.05  E-value=3  Score=25.53  Aligned_cols=26  Identities=19%  Similarity=0.561  Sum_probs=19.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.+.|.|.+||.. |.-+..+.+|.
T Consensus         4 h~~~k~~~C~~C~k~-f~~~~~l~~H~   29 (37)
T 2elo_A            4 GSSGRSYSCPVCEKS-FSEDRLIKSHI   29 (37)
T ss_dssp             CCCCCCCEETTTTEE-CSSHHHHHHHH
T ss_pred             CCCCCCcCCCCCCCc-cCCHHHHHHHH
Confidence            333578999999864 55777888884


No 84 
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=57.03  E-value=4.3  Score=26.17  Aligned_cols=26  Identities=12%  Similarity=0.299  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ytf_A            7 GTGEKPFECSECQK-AFNTKSNLIVHQ   32 (46)
T ss_dssp             SCCCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCcCCCCCCc-ccCCHHHHHHHH
Confidence            44467899999986 566888888885


No 85 
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A
Probab=57.01  E-value=3.5  Score=26.04  Aligned_cols=26  Identities=19%  Similarity=0.487  Sum_probs=19.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.=...|+|.+||. +|.-+..+.+|-
T Consensus         5 H~~~k~~~C~~C~k-~f~~~~~L~~H~   30 (42)
T 2el5_A            5 SSGENPYECSECGK-AFNRKDQLISHQ   30 (42)
T ss_dssp             SSSCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCccCCCcCh-hhCCHHHHHHHH
Confidence            44457899999986 466777888884


No 86 
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=56.78  E-value=2.6  Score=27.27  Aligned_cols=27  Identities=22%  Similarity=0.486  Sum_probs=20.5

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--.+.|.|.+||. .|.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2eq3_A            7 GTGEKPYECNQCGK-AFSVRSSLTTHQA   33 (46)
T ss_dssp             SCCCCSSEETTTTE-ECSSHHHHHHHHT
T ss_pred             CCCCCCeECCCCCh-hhCCHHHHHHHHH
Confidence            44467899999986 5667888888853


No 87 
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=56.75  E-value=3.5  Score=26.68  Aligned_cols=26  Identities=19%  Similarity=0.368  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2enc_A            7 GSGEKPFKCEECGK-GFYTNSQCYSHQ   32 (46)
T ss_dssp             CCCCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCcCCCCCCC-cCCChHHHHHHH
Confidence            44457899999986 466788888884


No 88 
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=56.67  E-value=3.6  Score=26.67  Aligned_cols=26  Identities=27%  Similarity=0.565  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2ytn_A            7 GTGKKPYKCNECGK-VFTQNSHLARHR   32 (46)
T ss_dssp             CSCCSSCBCTTTCC-BCSSHHHHHHHG
T ss_pred             CCCCcCeECCCCCC-eeCCHHHHHHHh
Confidence            44467899999985 566788899984


No 89 
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=56.06  E-value=4.6  Score=26.10  Aligned_cols=27  Identities=22%  Similarity=0.512  Sum_probs=20.7

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |-=..+|.|.+||. +|.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2ep2_A            7 GTGEKPYECSICGK-SFTKKSQLHVHQQ   33 (46)
T ss_dssp             SSCCCSEECSSSCC-EESSHHHHHHHHH
T ss_pred             CCCCcCcCCCCCCc-ccCCHHHHHHHHH
Confidence            44457899999986 5778889999853


No 90 
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=56.00  E-value=4.4  Score=26.27  Aligned_cols=26  Identities=19%  Similarity=0.344  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=..+|.|++||. +|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2em5_A            7 GSSTKSHQCHECGR-GFTLKSHLNQHQ   32 (46)
T ss_dssp             CCCSCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCeECCcCCC-ccCCHHHHHHHH
Confidence            33457899999985 566888899885


No 91 
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.96  E-value=3.8  Score=26.45  Aligned_cols=26  Identities=15%  Similarity=0.305  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.+.|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2emm_A            7 GTGERPHKCNECGK-SFIQSAHLIQHQ   32 (46)
T ss_dssp             SSCCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             cCCCCCeeCCCCCh-hhCCHHHHHHHH
Confidence            44457899999985 566788888884


No 92 
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.84  E-value=3.6  Score=26.65  Aligned_cols=26  Identities=19%  Similarity=0.413  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2emy_A            7 GTGENPYECHECGK-AFSRKYQLISHQ   32 (46)
T ss_dssp             CCSSCCEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCcCcCCCCCCc-ccCcHHHHHHHH
Confidence            44467899999986 466788888884


No 93 
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=55.80  E-value=4.9  Score=26.12  Aligned_cols=26  Identities=23%  Similarity=0.445  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|.|.+||.. |.-+..+.+|-
T Consensus         7 h~~~k~~~C~~C~k~-F~~~~~L~~H~   32 (46)
T 2eom_A            7 GHGERGHRCSDCGKF-FLQASNFIQHR   32 (46)
T ss_dssp             CCCCSSCCCSSSCCC-CSSHHHHHHHH
T ss_pred             CCCCCCcCCCCCCCe-eCChHHHHHHH
Confidence            444578999999864 66788888884


No 94 
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.79  E-value=4.1  Score=26.31  Aligned_cols=26  Identities=23%  Similarity=0.535  Sum_probs=19.8

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (47)
T 2epx_A            7 GTGKKPYECIECGK-AFIQNTSLIRHW   32 (47)
T ss_dssp             CCCCCSBCCSSSCC-CBSSHHHHHHHH
T ss_pred             cCCCCCEECCccCc-hhCChHHHHHHh
Confidence            44457899999986 466788888885


No 95 
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=55.72  E-value=3.8  Score=26.27  Aligned_cols=26  Identities=12%  Similarity=0.333  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|-
T Consensus         5 H~~~k~~~C~~C~k-~f~~~~~L~~H~   30 (44)
T 2emx_A            5 SSGEKPFGCSCCEK-AFSSKSYLLVHQ   30 (44)
T ss_dssp             CSSCCCEECSSSSC-EESSHHHHHHHH
T ss_pred             cCCCcCccCCCCCc-ccCCHHHHHHHH
Confidence            44457899999986 566788899884


No 96 
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.72  E-value=3.7  Score=26.66  Aligned_cols=26  Identities=19%  Similarity=0.456  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--..+|+|.+||. .|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2yto_A            7 GTGEKPYKCSDCGK-AFTRKSGLHIHQ   32 (46)
T ss_dssp             CCSCCCEECSSSCC-EESSHHHHHHHH
T ss_pred             cCCCCCEECcccCC-ccCCHhHHHHHH
Confidence            44457899999986 466788899985


No 97 
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.70  E-value=5.1  Score=25.97  Aligned_cols=27  Identities=26%  Similarity=0.533  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--.++|.|.+||. +|.-+..+.+|-.
T Consensus         7 h~~~k~~~C~~C~k-~F~~~~~L~~H~~   33 (46)
T 2elz_A            7 GSVEKPYKCEDCGK-GYNRRLNLDMHQR   33 (46)
T ss_dssp             CCCCSSCBCSSSCC-BCSSHHHHHHHGG
T ss_pred             CCCCCCeeCcccCc-hhCCHHHHHHHHH
Confidence            44457899999986 4667888888853


No 98 
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.62  E-value=3.7  Score=26.65  Aligned_cols=26  Identities=12%  Similarity=0.342  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-...|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2en9_A            7 GAGKKLFKCNECKK-TFTQSSSLTVHQ   32 (46)
T ss_dssp             CCSSCCCBCTTTCC-BCSSHHHHHHHH
T ss_pred             CCCCCCEECCccCc-ccCCHHHHHHHH
Confidence            44467899999986 466788888884


No 99 
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.57  E-value=4.5  Score=26.14  Aligned_cols=26  Identities=27%  Similarity=0.600  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2eq0_A            7 GTGEKPYKCHECGK-VFRRNSHLARHQ   32 (46)
T ss_dssp             TTCCCCEECTTTCC-EESSHHHHHHHH
T ss_pred             CCCCCCeECCCCCc-hhCCHHHHHHHH
Confidence            44467899999986 566888899885


No 100
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=55.41  E-value=3.5  Score=26.44  Aligned_cols=26  Identities=19%  Similarity=0.378  Sum_probs=19.8

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--..+|.|.+||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (44)
T 2emb_A            7 GHTRKRYECSKCQA-TFNLRKHLIQHQ   32 (44)
T ss_dssp             CCCCSSEECTTTCC-EESCHHHHHHHG
T ss_pred             cCCCCCeECCCCCC-ccCCHHHHHHHH
Confidence            44457899999986 566778888885


No 101
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=55.38  E-value=4.6  Score=26.19  Aligned_cols=26  Identities=27%  Similarity=0.437  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.=...|.|.+||. +|.-+..+.+|-
T Consensus         7 h~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2em8_A            7 GSGEKPYKCVECGK-GYKRRLDLDFHQ   32 (46)
T ss_dssp             CCSCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCeECcccCc-hhCCHHHHHHHH
Confidence            34457899999985 566788888885


No 102
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens}
Probab=55.21  E-value=4.8  Score=26.10  Aligned_cols=26  Identities=19%  Similarity=0.368  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|+|.+||. +|.-+..+.+|.
T Consensus         7 h~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2el6_A            7 GAGVNPYKCSQCEK-SFSGKLRLLVHQ   32 (46)
T ss_dssp             SCCCCSEECSSSSC-EESSHHHHHHHH
T ss_pred             CCCCCCeECCCCCc-ccCCHHHHHHHH
Confidence            33456799999986 566788899984


No 103
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=55.06  E-value=4.6  Score=25.94  Aligned_cols=26  Identities=15%  Similarity=0.510  Sum_probs=19.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|++||. +|.-+..+.+|-
T Consensus         7 h~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (44)
T 2eou_A            7 GAAKTTSECQECGK-IFRHSSLLIEHQ   32 (44)
T ss_dssp             CSSSCCCCCTTTCC-CCSSHHHHHHHH
T ss_pred             CCCCcCeECCCCCc-ccCCHHHHHHHH
Confidence            33457899999986 466777888884


No 104
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=54.84  E-value=4.8  Score=25.74  Aligned_cols=26  Identities=15%  Similarity=0.377  Sum_probs=19.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.++|+|.+||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (44)
T 2yu5_A            7 GAGENPFKCSKCDR-VFTQRNYLVQHE   32 (44)
T ss_dssp             CSCCCSEECSSSSC-EESSSHHHHHHH
T ss_pred             cCCCCCeECCCCCc-hhCCHHHHHHHh
Confidence            44457899999986 455777888884


No 105
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=54.81  E-value=3.9  Score=29.58  Aligned_cols=23  Identities=26%  Similarity=0.826  Sum_probs=18.5

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ...|.|++||. .|.-+..+.+|.
T Consensus        36 ~~~~~C~~C~k-~f~~~~~L~~H~   58 (78)
T 2d9h_A           36 ALRFPCEFCGK-RFEKPDSVAAHR   58 (78)
T ss_dssp             TCCEECTTTCC-EESSHHHHHHHH
T ss_pred             CcccCCCCCCc-hhCCHHHHHHHH
Confidence            57899999985 566788888884


No 106
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=54.68  E-value=3.7  Score=26.61  Aligned_cols=27  Identities=26%  Similarity=0.468  Sum_probs=20.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--.+.|+|++||. +|.-+..+.+|..
T Consensus         7 h~~~k~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2ysp_A            7 GTGEKPYKCEKCGK-GYNSKFNLDMHQK   33 (46)
T ss_dssp             CSSCCSEEETTTTE-EESCHHHHHHHHT
T ss_pred             CCCCCCeECCCCCC-ccCCHHHHHHHHH
Confidence            44457899999986 5667888888853


No 107
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=54.64  E-value=5.2  Score=28.60  Aligned_cols=27  Identities=22%  Similarity=0.521  Sum_probs=19.1

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .|-=...|.|.+||. .|.-+..+.+|.
T Consensus        36 ~h~~~~~~~C~~C~~-~f~~~~~L~~H~   62 (72)
T 1x6e_A           36 VHTGEKPYKCLECGK-AFSQNSGLINHQ   62 (72)
T ss_dssp             GGGCSCCEECSSSCC-EESSHHHHHHHH
T ss_pred             hcCCCCCeECCCCCc-ccCCHHHHHHHH
Confidence            454567788888875 566777888874


No 108
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1
Probab=54.44  E-value=4.6  Score=27.52  Aligned_cols=26  Identities=23%  Similarity=0.589  Sum_probs=19.6

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=...|.|.+||. +|.-+..+.+|.
T Consensus        25 h~~~~~~~C~~C~~-~f~~~~~l~~H~   50 (60)
T 2adr_A           25 HTNEKPYPCGLCNR-AFTRRDLLIRHA   50 (60)
T ss_dssp             TTSSCSEECTTTCC-EESSHHHHHHHH
T ss_pred             hCCCCCccCCCCCC-ccCCHHHHHHHH
Confidence            44456799999985 666788888885


No 109
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=54.44  E-value=5.5  Score=25.56  Aligned_cols=26  Identities=19%  Similarity=0.427  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|++||. .|.-+..+.+|.
T Consensus         5 h~~~k~~~C~~C~k-~f~~~~~L~~H~   30 (43)
T 2yrm_A            5 SSGNGAFFCNECDC-RFSEEASLKRHT   30 (43)
T ss_dssp             CSSSCCBCCSSSCC-CBSSHHHHHHHH
T ss_pred             cCCCCCEECCCCCC-eeCChHHHHHHH
Confidence            33457899999986 566788888885


No 110
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=54.41  E-value=4.9  Score=25.95  Aligned_cols=26  Identities=15%  Similarity=0.484  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=...|.|++||. +|.-+..+.+|-
T Consensus         7 H~~~~~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2em3_A            7 GTGEKPYECKVCSK-AFTQKAHLAQHQ   32 (46)
T ss_dssp             CSSCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCcCeECCCCCc-ccCCHHHHHHHH
Confidence            44467899999986 466788888885


No 111
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1
Probab=54.35  E-value=4  Score=29.03  Aligned_cols=27  Identities=19%  Similarity=0.525  Sum_probs=18.6

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .|.=...|.|.+||. +|.-+..+.+|-
T Consensus        43 ~h~~~~~~~C~~C~~-~f~~~~~l~~H~   69 (73)
T 1f2i_G           43 IHTGQKPFQCRICMR-NFSRSDHLTTHI   69 (73)
T ss_dssp             HHHCCCCEECTTTCC-EESCHHHHHHHH
T ss_pred             hhCCCCCeECCCCCc-hhCCHHHHHHHH
Confidence            344456788888875 466677777774


No 112
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=53.94  E-value=3.7  Score=26.59  Aligned_cols=26  Identities=19%  Similarity=0.443  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-..+|.|++||. +|.-+..+.+|-
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ytg_A            7 GTGEKPFKCGECGK-SYNQRVHLTQHQ   32 (46)
T ss_dssp             CSSCCSEECTTTCC-EESSSHHHHTTG
T ss_pred             CCCCCCeECCCCCc-ccCCHHHHHHHH
Confidence            44467899999986 566788899995


No 113
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=53.91  E-value=4.1  Score=26.46  Aligned_cols=26  Identities=23%  Similarity=0.425  Sum_probs=19.8

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|+|.+||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2em4_A            7 GTGQRPYECIECGK-AFKTKSSLICHR   32 (46)
T ss_dssp             CCCSSSEECSSSCC-EESSHHHHHHHH
T ss_pred             cCCCcCcCCCCCCC-ccCCHHHHHHHH
Confidence            44457899999986 456788888884


No 114
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=53.65  E-value=4.4  Score=26.29  Aligned_cols=27  Identities=19%  Similarity=0.397  Sum_probs=20.5

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |.=.+.|+|.+||. .|.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~~   33 (46)
T 2ytp_A            7 GTGERHYECSECGK-AFARKSTLIMHQR   33 (46)
T ss_dssp             SCCCCCEECSSSCC-EESSHHHHHHHHT
T ss_pred             cCCCCCeECCcCCc-ccCCHHHHHHHHH
Confidence            44467899999986 5667888888853


No 115
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=53.38  E-value=4.8  Score=26.11  Aligned_cols=26  Identities=23%  Similarity=0.534  Sum_probs=19.8

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||.. |.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k~-f~~~~~L~~H~   32 (46)
T 2em6_A            7 GMGEKCYKCDVCGKE-FSQSSHLQTHQ   32 (46)
T ss_dssp             CCCCCCCBCSSSCCB-CSSHHHHHHHH
T ss_pred             cCCCCCeECCCCCcc-cCCHHHHHHHH
Confidence            444678999999864 55788888884


No 116
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4
Probab=53.32  E-value=1.6  Score=37.36  Aligned_cols=47  Identities=17%  Similarity=0.278  Sum_probs=36.1

Q ss_pred             CchhHHHHhhCCCceecceeccCCcccChhhhhhhcchhhhhhcccccCC
Q psy7416         242 PIPYWLYKLHGLNISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGI  291 (381)
Q Consensus       242 PIPyWLYKLhGL~~ey~CEICGn~~Y~GrkaFe~HF~E~rH~~GmrcLGI  291 (381)
                      -+|.|.. +=|. ..|.|.+||. .|.-..++..|+.--.|..-++.|.-
T Consensus        38 ~~~~ded-~tGe-kpfyC~~C~K-~F~~~~~L~~H~rsK~HKrrvk~l~~   84 (124)
T 1zr9_A           38 NAEFDPD-LPGG-GLHRCLACAR-YFIDSTNLKTHFRSKDHKKRLKQLSV   84 (124)
T ss_dssp             SCSSCSS-SGGG-GCSEETTTTE-ECSSHHHHHHHTTCHHHHHHHHHHTS
T ss_pred             ccccccc-CCCC-cceEcccCcc-hhCCHHHHHHHHhhhhhhHHHHHhcc
Confidence            4566743 3344 4899999985 56689999999999999988777653


No 117
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=53.14  E-value=5.1  Score=29.77  Aligned_cols=23  Identities=26%  Similarity=0.710  Sum_probs=19.0

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ...|.|.+|| .+|.-+..+.+|.
T Consensus        63 ~~~~~C~~C~-~~f~~~~~L~~H~   85 (95)
T 2yt9_A           63 GKPYICQSCG-KGFSRPDHLNGHI   85 (95)
T ss_dssp             CSSBCCSSSC-CCBSSHHHHHHHH
T ss_pred             CCceECCCcc-chhCCHHHHHHHH
Confidence            3789999998 5677888888885


No 118
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A
Probab=53.09  E-value=4.4  Score=26.11  Aligned_cols=26  Identities=19%  Similarity=0.510  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2em9_A            7 GTGEKPYNCKECGK-SFRWASCLLKHQ   32 (46)
T ss_dssp             CCCCCSEECSSSCC-EESSHHHHHHHG
T ss_pred             CCCCcCeECCcccc-ccCChHHHHHHH
Confidence            44457899999986 566788899985


No 119
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A
Probab=52.98  E-value=4.4  Score=26.18  Aligned_cols=26  Identities=23%  Similarity=0.538  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ema_A            7 GTGEKRYKCNECGK-VFSRNSQLSQHQ   32 (46)
T ss_dssp             CTTSCCEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCcCcCCCCCcc-hhCCHHHHHHHH
Confidence            44457899999986 566788888885


No 120
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.92  E-value=5.3  Score=25.90  Aligned_cols=26  Identities=23%  Similarity=0.640  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.+.|.|.+||. +|.-+..+.+|.
T Consensus         7 h~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ytt_A            7 GEGEKPYQCSECGK-SFSGSYRLTQHW   32 (46)
T ss_dssp             CSCCCTTCCSSSCC-CCSSHHHHHHHH
T ss_pred             CCCCCCeeCCCCCc-ccCCHHHHHHHH
Confidence            44457799999986 566888999984


No 121
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.75  E-value=4.5  Score=26.17  Aligned_cols=26  Identities=19%  Similarity=0.494  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|+|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ytd_A            7 GSGEKPYKCSECGK-AFHRHTHLNEHR   32 (46)
T ss_dssp             SCCCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             cCCCcCeECCCCCC-eeCChHHHHHHH
Confidence            44467899999986 566788888884


No 122
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.57  E-value=4.7  Score=25.99  Aligned_cols=27  Identities=19%  Similarity=0.384  Sum_probs=20.5

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--...|.|.+||. +|.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2ep1_A            7 GTGEKPYECSDCGK-SFIKKSQLHVHQR   33 (46)
T ss_dssp             CSSCCSSCCSSSCC-CCSSHHHHHHHHG
T ss_pred             CCCCCCcCCCCCCc-hhCCHHHHHHHHH
Confidence            44457899999986 4668888998853


No 123
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=52.45  E-value=4.6  Score=26.12  Aligned_cols=26  Identities=15%  Similarity=0.439  Sum_probs=20.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|.|++||. +|.-+..+.+|-
T Consensus         7 h~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ep0_A            7 GTGEKPYKCDVCHK-SFRYGSSLTVHQ   32 (46)
T ss_dssp             STTCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCeeCcccCc-ccCChHHHHHHH
Confidence            44467899999986 566788888884


No 124
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=52.05  E-value=5.3  Score=25.73  Aligned_cols=26  Identities=27%  Similarity=0.345  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--..+|+|.+||. +|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2en8_A            7 GSGEKSHTCDECGK-NFCYISALRIHQ   32 (46)
T ss_dssp             CCCCSSEECTTTCC-EESSHHHHHHHH
T ss_pred             CCCCCCeECCCcCc-ccCCHHHHHHHH
Confidence            44467899999985 566788888885


No 125
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=51.57  E-value=4.5  Score=26.15  Aligned_cols=26  Identities=19%  Similarity=0.359  Sum_probs=19.6

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.=..+|.|++||. +|.-+..+.+|-
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2yso_A            7 GSREKSHQCRECGE-IFFQYVSLIEHQ   32 (46)
T ss_dssp             SSCCCCEECTTTCC-EESSHHHHHHHH
T ss_pred             cCCCCCEEccccCh-hhCCHHHHHHHH
Confidence            44457899999986 455778888884


No 126
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.55  E-value=4.4  Score=26.15  Aligned_cols=26  Identities=15%  Similarity=0.440  Sum_probs=19.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|.|.+||. .|.-+..+.+|-
T Consensus         7 h~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (45)
T 2epu_A            7 GTGQKPFECTHCGK-SFRAKGNLVTHQ   32 (45)
T ss_dssp             CCSCCSEEETTTTE-EESSHHHHHHHH
T ss_pred             CCCCcCccCCCCCC-ccCChHHHHHHH
Confidence            33457899999985 456778888884


No 127
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=51.54  E-value=5.5  Score=28.77  Aligned_cols=22  Identities=18%  Similarity=0.493  Sum_probs=17.1

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ..|+|.+||. +|.-+..+.+|.
T Consensus        44 ~~~~C~~C~~-~f~~~~~L~~H~   65 (77)
T 2ct1_A           44 AKFHCPHCDT-VIARKSDLGVHL   65 (77)
T ss_dssp             SSEECSSSSC-EESSHHHHHHHH
T ss_pred             CccCCCCCCC-ccCCHHHHHHHH
Confidence            6799999985 566777888874


No 128
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.48  E-value=4.4  Score=26.14  Aligned_cols=26  Identities=23%  Similarity=0.517  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--..+|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2eoe_A            7 GTGEKPYKCNECGK-VFTQNSHLANHQ   32 (46)
T ss_dssp             CCCCCSSEETTTTE-ECSSHHHHHHHH
T ss_pred             CCCCCCeECCCcCh-hhCCHHHHHHHH
Confidence            44457899999985 566888899885


No 129
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.42  E-value=5.1  Score=25.79  Aligned_cols=26  Identities=23%  Similarity=0.549  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2ytr_A            7 GTGEKPYKCNECGK-AFSQTSKLARHQ   32 (46)
T ss_dssp             CSSCCTTCCTTTCC-CCSSHHHHHHHH
T ss_pred             CCCCcCcCCCCCCC-ccCCHHHHHHHH
Confidence            44457899999996 466788889885


No 130
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=51.07  E-value=4.8  Score=25.94  Aligned_cols=26  Identities=15%  Similarity=0.245  Sum_probs=19.7

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2epw_A            7 GTGEKPCKCTECGK-AFCWKSQLIMHQ   32 (46)
T ss_dssp             CCCCCSEECSSSCC-EESSSHHHHHHH
T ss_pred             CCCCCCeeCCCCCC-ccCCHHHHHHHH
Confidence            44457899999986 465778888885


No 131
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4
Probab=50.55  E-value=4.5  Score=33.94  Aligned_cols=60  Identities=17%  Similarity=0.240  Sum_probs=44.5

Q ss_pred             CCCCCCCCCCCCCCchhHHHHhhCCCceecceeccCCcccChhhhhhhcchhhhhhccccc
Q psy7416         229 YNPKNLPLGWDGKPIPYWLYKLHGLNISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCL  289 (381)
Q Consensus       229 ynp~~lPlg~DGkPIPyWLYKLhGL~~ey~CEICGn~~Y~GrkaFe~HF~E~rH~~GmrcL  289 (381)
                      +|.-.|.+.-.-..|+-=.-.+..|...+.|.+|.= ++.....+..|++..+|..-||-+
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~C~~C~v-~~~S~s~~~~H~~gkkH~~~v~~~   64 (127)
T 1zu1_A            5 GNGDALDLPVGKDAVNSLIRENSHIFSDTQCKVCSA-VLISESQKLAHYQSRKHANKVRRY   64 (127)
T ss_dssp             CCCCCCCCCCSHHHHHHHHHHTTTTBCSSEETTTTE-ECCSHHHHHHHHHCHHHHHHHHHH
T ss_pred             ccCccCCcccchHHHhhhhccccccCCCCcCcCCCC-EeCCHHHHHHHHCcHHHHHHHHHH
Confidence            333333333334456666667888888999999976 888999999999999999987643


No 132
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=50.49  E-value=4.8  Score=26.52  Aligned_cols=26  Identities=27%  Similarity=0.623  Sum_probs=19.6

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-.+.|.|.+||. +|.-+..+.+|-
T Consensus         7 ~~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (48)
T 2epr_A            7 GRTRKQVACEICGK-IFRDVYHLNRHK   32 (48)
T ss_dssp             CCCCCSEEETTTTE-EESSHHHHHHHG
T ss_pred             CCCCcCeeCCCCCc-ccCCHHHHHHHH
Confidence            34457899999976 566788888884


No 133
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.63  E-value=5.5  Score=25.65  Aligned_cols=26  Identities=19%  Similarity=0.434  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|.|.+||.. |.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k~-f~~~~~L~~H~   32 (46)
T 2eq4_A            7 GTGEKLYNCKECGKS-FSRAPCLLKHE   32 (46)
T ss_dssp             SSCCCCCCBTTTTBC-CSCHHHHHHHH
T ss_pred             CCCCCCeECCCCCCc-cCchHHHHHHH
Confidence            444678999999864 55788888884


No 134
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=49.41  E-value=5.3  Score=25.79  Aligned_cols=27  Identities=19%  Similarity=0.509  Sum_probs=20.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--...|.|.+||. +|.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~~   33 (46)
T 2eq1_A            7 GTGEKPYKCNECGK-AFRAHSNLTTHQV   33 (46)
T ss_dssp             CCCSCCCCCTTTTC-CCSSHHHHHHHHT
T ss_pred             cCCCCCeECCcCCh-hhCCHHHHHHHHH
Confidence            44457899999986 4567888888853


No 135
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.99  E-value=5.9  Score=25.56  Aligned_cols=26  Identities=23%  Similarity=0.511  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+||.. |.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k~-f~~~~~L~~H~   32 (46)
T 2eq2_A            7 GTGGKPYQCNECGKA-FSQTSKLARHQ   32 (46)
T ss_dssp             SSSSCSSSCCSSCCC-CSSHHHHHHHG
T ss_pred             cCCCCCeECCCCCcc-cCCHHHHHHHH
Confidence            444578999999864 56788888885


No 136
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=48.95  E-value=5.8  Score=25.58  Aligned_cols=27  Identities=15%  Similarity=0.347  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--.++|.|++||.. |.-+..+.+|..
T Consensus         7 H~~~k~~~C~~C~k~-f~~~~~L~~H~~   33 (46)
T 2epz_A            7 GTGEKPFDCIDCGKA-FSDHIGLNQHRR   33 (46)
T ss_dssp             CCCCCSBCCTTTCCC-BSSHHHHHHHHT
T ss_pred             cCCCCCeECCCCCce-eCCHHHHHHHHH
Confidence            444578999999875 557888888853


No 137
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=48.70  E-value=7.6  Score=27.44  Aligned_cols=27  Identities=22%  Similarity=0.602  Sum_probs=19.4

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .|--...|.|.+||. .|.-+..+.+|.
T Consensus        31 ~H~~~~~~~C~~C~~-~f~~~~~L~~H~   57 (70)
T 1x5w_A           31 IHCTDRPFKCNYCSF-DTKQPSNLSKHM   57 (70)
T ss_dssp             GGCCSCSEECSSSSC-EESSHHHHHHHH
T ss_pred             HcCCCCCEeCCCCCC-ccCCHHHHHHHH
Confidence            354456789999975 466788888884


No 138
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A
Probab=47.95  E-value=5.3  Score=22.56  Aligned_cols=22  Identities=27%  Similarity=0.780  Sum_probs=16.6

Q ss_pred             ceecce--eccCCcccChhhhhhhc
Q psy7416         255 ISYTCE--ICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CE--ICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.  +||.. |.-+..+.+|-
T Consensus         1 k~~~C~~~~C~k~-f~~~~~l~~H~   24 (29)
T 2ab3_A            1 MVYVCHFENCGRS-FNDRRKLNRHK   24 (29)
T ss_dssp             CCEEECSTTTCEE-ESSHHHHHHHH
T ss_pred             CCCCCcCCcCcCc-cCCHHHHHHHH
Confidence            368999  99974 55777787773


No 139
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.75  E-value=5.4  Score=25.67  Aligned_cols=26  Identities=19%  Similarity=0.465  Sum_probs=20.0

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2yrj_A            7 GTGEKPYRCGECGK-AFAQKANLTQHQ   32 (46)
T ss_dssp             CCCCCCEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCeECCCCCC-ccCCHHHHHHHH
Confidence            44457899999986 466788888885


No 140
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.33  E-value=6.8  Score=25.33  Aligned_cols=26  Identities=19%  Similarity=0.462  Sum_probs=20.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--..+|.|.+||.. |.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k~-f~~~~~L~~H~   32 (46)
T 2yth_A            7 GSGEKPFQCEECGKR-FTQNSHLHSHQ   32 (46)
T ss_dssp             CCCSSSBCCSSSCCC-BSSHHHHHHHG
T ss_pred             CCCCcCCCCCCCCcc-cCCHHHHHHHH
Confidence            444578999999864 66788899985


No 141
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=47.11  E-value=7.1  Score=25.31  Aligned_cols=26  Identities=19%  Similarity=0.413  Sum_probs=19.6

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.++|.|++||.. |.-+..+.+|.
T Consensus         7 h~~~k~~~C~~C~k~-f~~~~~L~~H~   32 (46)
T 2ytm_A            7 GTGEKPYKCMECGKA-FGDNSSCTQHQ   32 (46)
T ss_dssp             CSSCCSSSBTTTTBC-CSSHHHHHHHH
T ss_pred             CCCCCCcCCCCCCch-hCCHHHHHHHH
Confidence            333567999999864 55788888885


No 142
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=46.98  E-value=4.6  Score=26.10  Aligned_cols=26  Identities=19%  Similarity=0.475  Sum_probs=19.8

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+||. +|.-+..+.+|.
T Consensus         7 H~~~~~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2en6_A            7 GSGEKPYGCNECGK-TFSQKSILSAHQ   32 (46)
T ss_dssp             CCSSCCEEETTTTE-EESSHHHHHHHH
T ss_pred             cCCCcCeECCCCCc-ccCchHHHHHHH
Confidence            44457899999985 566788888884


No 143
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=46.84  E-value=8.2  Score=29.99  Aligned_cols=20  Identities=20%  Similarity=0.571  Sum_probs=9.1

Q ss_pred             hHHHHhhCCCceecceeccCC
Q psy7416         245 YWLYKLHGLNISYTCEICGNF  265 (381)
Q Consensus       245 yWLYKLhGL~~ey~CEICGn~  265 (381)
                      .|.-..++ ...|.|++||..
T Consensus        24 ~~~~~~~~-~~~~~C~~C~k~   43 (96)
T 2ctd_A           24 QWYLEIVD-KGSVSCPTCQAV   43 (96)
T ss_dssp             HHHHHHHH-TSCEECTTTCSC
T ss_pred             HHHHHhcC-CCCcCCCCCCCC
Confidence            44433332 344555555543


No 144
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=46.78  E-value=7.1  Score=28.12  Aligned_cols=28  Identities=21%  Similarity=0.496  Sum_probs=20.9

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhcc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      .|--...|.|.+||. .|.-+..+.+|..
T Consensus        40 ~h~~~~~~~C~~C~~-~f~~~~~L~~H~~   67 (77)
T 2cot_A           40 THTGEKPYKCDECGK-AFIQRSHLIGHHR   67 (77)
T ss_dssp             TTCCSCSEECSSSCC-EESSHHHHHHHGG
T ss_pred             HcCCCcCeeCCCCCC-ccCCHHHHHHHHH
Confidence            344457899999985 5667888888863


No 145
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=45.27  E-value=8.1  Score=26.18  Aligned_cols=25  Identities=24%  Similarity=0.737  Sum_probs=18.1

Q ss_pred             CCCceecceeccCCcccChhhhhhhc
Q psy7416         252 GLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       252 GL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .-.++|.|++||. .|.-+..+.+|.
T Consensus         8 ~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (54)
T 2eps_A            8 SVGKPYICQSCGK-GFSRPDHLNGHI   32 (54)
T ss_dssp             CSSCCEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCeECCCCCc-ccCCHHHHHHHH
Confidence            3456799999986 455677777774


No 146
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1
Probab=44.95  E-value=8.2  Score=29.27  Aligned_cols=26  Identities=19%  Similarity=0.543  Sum_probs=18.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+||. .|.-+..+.+|.
T Consensus        68 h~~~~~~~C~~C~~-~f~~~~~L~~H~   93 (106)
T 2ee8_A           68 HSKEKPFKCQECGK-GFCQSRTLAVHK   93 (106)
T ss_dssp             SCCCCTTSCSSSCC-CCSSHHHHHHHH
T ss_pred             hCCCCCeECCCcCC-cccCHHHHHHHH
Confidence            44456688888875 566778888884


No 147
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A*
Probab=44.88  E-value=6  Score=32.84  Aligned_cols=26  Identities=31%  Similarity=0.706  Sum_probs=21.0

Q ss_pred             ceecceeccCCcccChhhhhhhcchhhhh
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHFAEWRHA  283 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF~E~rH~  283 (381)
                      +.|+|+||| .+|.-+..+.+|-.  .|.
T Consensus        21 k~y~C~~C~-k~F~~~~~L~~H~~--~H~   46 (133)
T 2lt7_A           21 VYYICIVCK-RSYVCLTSLRRHFN--IHS   46 (133)
T ss_dssp             EEEEETTTC-CEESCHHHHHHHHH--HHH
T ss_pred             cCeECCCCC-CCcCCHHHHHHHHH--HcC
Confidence            579999998 57888999999964  564


No 148
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A
Probab=44.64  E-value=9.1  Score=24.69  Aligned_cols=26  Identities=19%  Similarity=0.452  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.++|.|++||.. |.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k~-F~~~~~L~~H~   32 (46)
T 2emk_A            7 GTGEKPYECKECGKA-FSQTTHLIQHQ   32 (46)
T ss_dssp             CSSSCSCBCSSSCCB-CSCHHHHHHHH
T ss_pred             cCCCCceECCCCCch-hCCHHHHHHHH
Confidence            334578999999864 66788888885


No 149
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=44.63  E-value=8.3  Score=27.88  Aligned_cols=22  Identities=23%  Similarity=0.733  Sum_probs=17.4

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ..|.|.+||. .|.-+..+.+|.
T Consensus        46 ~~~~C~~C~~-~f~~~~~L~~H~   67 (86)
T 1x6h_A           46 AAFVCSKCGK-TFTRRNTMARHA   67 (86)
T ss_dssp             CCEECSSSCC-EESCHHHHHHHH
T ss_pred             cceECCCCCC-hhCCHHHHHHHH
Confidence            6799999985 566788888885


No 150
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus}
Probab=44.07  E-value=7.2  Score=27.86  Aligned_cols=26  Identities=19%  Similarity=0.466  Sum_probs=17.5

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+|| .+|.-+..+.+|-
T Consensus        52 h~~~~~~~C~~C~-~~f~~~~~l~~H~   77 (82)
T 2kmk_A           52 HTGEKPHKCQVCG-KAFSQSSNLITHS   77 (82)
T ss_dssp             HHTCCCEECTTTS-CEESSHHHHHHHH
T ss_pred             hcCCCCCcCCCcc-hhhCChHHHHHHH
Confidence            3335678888887 4566777777773


No 151
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens}
Probab=43.98  E-value=11  Score=28.02  Aligned_cols=27  Identities=22%  Similarity=0.523  Sum_probs=14.3

Q ss_pred             hCCCceecce--eccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCE--ICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CE--ICGn~~Y~GrkaFe~HF~  278 (381)
                      |--...|.|.  +||. .|..+..+.+|..
T Consensus        40 h~~~~~~~C~~~~C~~-~f~~~~~l~~H~~   68 (100)
T 2ebt_A           40 HTGEKPYKCTWEGCDW-RFARSDELTRHYR   68 (100)
T ss_dssp             HSCCCCEECCSSSCCC-EESSHHHHHHHHH
T ss_pred             hCCCCCeeCCCCCCCC-ccCCHHHHHHHHH
Confidence            3344556663  4653 4555566666663


No 152
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1
Probab=43.31  E-value=9.5  Score=22.28  Aligned_cols=22  Identities=23%  Similarity=0.588  Sum_probs=17.2

Q ss_pred             ceecce--eccCCcccChhhhhhhc
Q psy7416         255 ISYTCE--ICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CE--ICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.  +||. +|.-+..+.+|-
T Consensus         2 k~~~C~~~~C~k-~f~~~~~L~~H~   25 (32)
T 1zfd_A            2 RPYSCDHPGCDK-AFVRNHDLIRHK   25 (32)
T ss_dssp             CSBCCCCTTCCC-CBSSSHHHHHHH
T ss_pred             CCCcCcCCCCCC-ccCCHHHHHHHH
Confidence            579999  8986 466778888884


No 153
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=41.51  E-value=9.6  Score=29.15  Aligned_cols=23  Identities=30%  Similarity=0.722  Sum_probs=13.5

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ...|.|.+||. +|.-+..+.+|.
T Consensus        63 ~~~~~C~~C~~-~f~~~~~l~~H~   85 (110)
T 2csh_A           63 IKPYECNICAK-RFMWRDSFHRHV   85 (110)
T ss_dssp             CCCEECSSSCC-EESCHHHHHHHH
T ss_pred             CCCeeCCCCcc-hhcCHHHHHHHH
Confidence            34566666664 444566666664


No 154
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens}
Probab=41.20  E-value=9.6  Score=24.49  Aligned_cols=26  Identities=12%  Similarity=0.312  Sum_probs=19.9

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--.++|+|++||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~   32 (46)
T 2em0_A            7 GMGEKTWKCRECDM-CFSQASSLRLHQ   32 (46)
T ss_dssp             SCCCCCCCCSSSCC-CCSSHHHHHHHG
T ss_pred             cCCCcCeECCCCCc-ccCCHHHHHHHH
Confidence            44457899999986 466788888885


No 155
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=40.75  E-value=8.5  Score=24.76  Aligned_cols=30  Identities=20%  Similarity=0.522  Sum_probs=22.3

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcchhhhh
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFAEWRHA  283 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~E~rH~  283 (381)
                      |--.++|.|++||. +|.-+..+.+|-.  .|.
T Consensus         7 H~~~k~~~C~~C~k-~F~~~~~L~~H~~--~H~   36 (46)
T 2emh_A            7 GTGERPYICTVCGK-AFTDRSNLIKHQK--IHT   36 (46)
T ss_dssp             CSCCCSEECTTTCC-EESSHHHHHHHHH--HHH
T ss_pred             CCCCCCcCCCCCCc-hhCCHHHHHHHHH--hcC
Confidence            44467899999985 5667889999953  453


No 156
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=40.52  E-value=9.3  Score=29.50  Aligned_cols=27  Identities=15%  Similarity=0.454  Sum_probs=21.1

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--..+|.|++||. .|.-+..+.+|-.
T Consensus        75 H~~~~~~~C~~C~k-~f~~~~~L~~H~~  101 (115)
T 2dmi_A           75 EDAQKVLKCMYCGH-SFESLQDLSVHMI  101 (115)
T ss_dssp             CCCCSSCBCSSSCC-BCSSHHHHHHHHH
T ss_pred             cCCCcceECCCCCC-ccCCHHHHHHHHH
Confidence            44457799999995 5778899999964


No 157
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A
Probab=39.62  E-value=9.3  Score=28.24  Aligned_cols=26  Identities=27%  Similarity=0.650  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.=..+|.|.+||. +|.-+..+.+|-
T Consensus        26 H~~~~~~~C~~C~k-~f~~~~~L~~H~   51 (88)
T 1llm_C           26 HTGEKPFACDICGR-KFARSDERKRHR   51 (88)
T ss_dssp             HHCCCCEECTTTCC-EESSHHHHHHHH
T ss_pred             cCCCCCccCCCCCC-ccCCHHHHHHHH
Confidence            44457899999985 677888898884


No 158
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=39.61  E-value=8.5  Score=24.82  Aligned_cols=26  Identities=15%  Similarity=0.521  Sum_probs=19.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.+.|.|.+||. .|.-+..+.+|.
T Consensus         7 H~~~k~~~C~~C~k-~f~~~~~L~~H~   32 (46)
T 2em2_A            7 GSGEKPFKCKECGK-AFRQNIHLASHL   32 (46)
T ss_dssp             CCCCCSEECSSSCC-EESSHHHHHHHH
T ss_pred             CCCCCCEECCcCCc-hhCCHHHHHHHH
Confidence            44457899999986 455777888884


No 159
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1
Probab=38.86  E-value=12  Score=28.76  Aligned_cols=29  Identities=24%  Similarity=0.526  Sum_probs=21.1

Q ss_pred             HhhCCCceecceeccCCcccChhhhhhhcc
Q psy7416         249 KLHGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       249 KLhGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      +.|--..+|.|.+||. +|.-+..+.+|..
T Consensus        87 ~~h~~~~~~~C~~C~~-~f~~~~~l~~H~~  115 (124)
T 2dlq_A           87 VSHTGEMPYKCSSCSQ-QFMQKKDLQSHMI  115 (124)
T ss_dssp             HHHSSSCSEECSSSCC-EESSHHHHHHHHH
T ss_pred             HHcCCCCCccCCCccc-hhCCHHHHHHHHH
Confidence            4565567899999985 5667888888853


No 160
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=38.62  E-value=11  Score=28.00  Aligned_cols=34  Identities=24%  Similarity=0.472  Sum_probs=23.2

Q ss_pred             CceecceeccCCcccChhhhhhhcchhhhhhcccccC
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLG  290 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF~E~rH~~GmrcLG  290 (381)
                      .++|.|.+||. .|.-+..+.+|-  ..|.-+-.-++
T Consensus        11 ekpy~C~~CgK-~F~~~s~L~~H~--r~Htg~~~~~~   44 (66)
T 2epp_A           11 AGILPCGLCGK-VFTDANRLRQHE--AQHGVTSLQLG   44 (66)
T ss_dssp             CCCCCCTTTCC-CCSCHHHHHHHH--HHHTTTSCCCC
T ss_pred             ccCcCCCCCCC-ccCCHHHHHhhh--hhhCCCccccc
Confidence            46799999986 555778888884  35655433333


No 161
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C
Probab=38.46  E-value=10  Score=27.69  Aligned_cols=26  Identities=27%  Similarity=0.663  Sum_probs=18.5

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.-...|.|.+||. +|.-+..+.+|-
T Consensus        57 h~~~~~~~C~~C~~-~f~~~~~l~~H~   82 (90)
T 1a1h_A           57 HTGEKPFACDICGR-KFARSDERKRHT   82 (90)
T ss_dssp             HHCCCCEECTTTCC-EESSHHHHHHHH
T ss_pred             cCCCCCccCCCCCc-hhCCHHHHHHHH
Confidence            44456788888874 466777888874


No 162
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=38.44  E-value=6.7  Score=25.23  Aligned_cols=26  Identities=23%  Similarity=0.552  Sum_probs=19.6

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |-=.++|.|++||.. |.-+..+.+|-
T Consensus         5 h~~~k~~~C~~C~k~-f~~~~~l~~H~   30 (45)
T 2epq_A            5 SSGEKPYSCPVCGLR-FKRKDRMSYHV   30 (45)
T ss_dssp             CSSCCSSEETTTTEE-CSCHHHHHHHH
T ss_pred             cCCCCCCcCCCCCcc-cCCHHHHHHHH
Confidence            444578999999964 55788888884


No 163
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1}
Probab=37.95  E-value=12  Score=29.49  Aligned_cols=23  Identities=13%  Similarity=0.446  Sum_probs=18.1

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ..+|.|++||. .|.-+..+.+|-
T Consensus        98 ~~~~~C~~C~k-~f~~~~~l~~H~  120 (129)
T 2wbt_A           98 EHTKVCPVCKK-EFTSTDSALDHV  120 (129)
T ss_dssp             CCCCBCTTTCC-BCSSHHHHHHHH
T ss_pred             CCCCCCCCCCc-ccCCHHHHHHHH
Confidence            77899999985 566777788774


No 164
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A
Probab=37.39  E-value=12  Score=27.10  Aligned_cols=22  Identities=27%  Similarity=0.768  Sum_probs=9.6

Q ss_pred             ceecce--eccCCcccChhhhhhhc
Q psy7416         255 ISYTCE--ICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CE--ICGn~~Y~GrkaFe~HF  277 (381)
                      ..|.|.  +||. .|..+..+.+|.
T Consensus        34 ~~~~C~~~~C~~-~f~~~~~l~~H~   57 (89)
T 2wbs_A           34 KPYHCDWDGCGW-KFARSDELTRHY   57 (89)
T ss_dssp             CCEECCSTTTCC-EESSHHHHHHHH
T ss_pred             CCcCCCCCCCCC-ccCCHHHHHHHH
Confidence            345554  2542 333444444444


No 165
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4
Probab=35.97  E-value=7.7  Score=32.44  Aligned_cols=35  Identities=23%  Similarity=0.546  Sum_probs=30.0

Q ss_pred             CCCceecceeccCCcccChhhhhhhcchhhhhhccc
Q psy7416         252 GLNISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMR  287 (381)
Q Consensus       252 GL~~ey~CEICGn~~Y~GrkaFe~HF~E~rH~~Gmr  287 (381)
                      .=+..|.|+||.- +|.-...++.|+..-+|.--|+
T Consensus        89 ~~~~~~~C~~C~~-~f~s~~~~~~H~~gk~H~~~~~  123 (127)
T 1zu1_A           89 GEDRSKCCPVCNM-TFSSPVVAESHYIGKTHIKNLR  123 (127)
T ss_dssp             CCCTTTEETTTTE-ECSSHHHHHHHHTSHHHHHHHH
T ss_pred             CCCCCeEcCCCCC-EeCCHHHHHHHHCCHHHHHHHH
Confidence            3456789999976 9999999999999999987665


No 166
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens}
Probab=35.39  E-value=16  Score=22.41  Aligned_cols=23  Identities=30%  Similarity=0.727  Sum_probs=17.5

Q ss_pred             Cceeccee--ccCCcccChhhhhhhc
Q psy7416         254 NISYTCEI--CGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEI--CGn~~Y~GrkaFe~HF  277 (381)
                      ...|.|.+  ||. +|.-+..+.+|-
T Consensus         6 ~k~~~C~~~~C~k-~f~~~~~L~~H~   30 (37)
T 1va1_A            6 KKQHICHIQGCGK-VYGKTSHLRAHL   30 (37)
T ss_dssp             CCCEECCSTTCCC-EESCHHHHHHHH
T ss_pred             CCCCCCCCCCCCC-ccCCHHHHHHHH
Confidence            46799996  986 555777888884


No 167
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=35.21  E-value=11  Score=26.46  Aligned_cols=22  Identities=18%  Similarity=0.363  Sum_probs=16.9

Q ss_pred             CceecceeccCCcccChhhhhhhc
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      ..+|+|.+||.. |. +..+.+|-
T Consensus         8 ~~~~~C~~C~k~-f~-~~~L~~H~   29 (66)
T 2eod_A            8 KRTQPCTYCTKE-FV-FDTIQSHQ   29 (66)
T ss_dssp             CCEEECSSSCCE-EE-HHHHHHHH
T ss_pred             CCCeeccccCCc-cC-HHHHHHHH
Confidence            357999999865 54 88888884


No 168
>1vzi_A Desulfoferrodoxin; ferrocyanide, microspectrophotometry, redox states, photoreduction, dinuclear iron cluster, oxidoreductase; 1.15A {Desulfovibrio baarsii} SCOP: b.1.13.1 g.41.5.2 PDB: 1vzh_A* 1vzg_A 2ji1_A 2ji2_A 2ji3_A 1dfx_A
Probab=35.20  E-value=7.4  Score=32.96  Aligned_cols=14  Identities=50%  Similarity=1.042  Sum_probs=11.8

Q ss_pred             CceecceeccCCcc
Q psy7416         254 NISYTCEICGNFVY  267 (381)
Q Consensus       254 ~~ey~CEICGn~~Y  267 (381)
                      ..-|+|++|||.+-
T Consensus         5 ~~fYkC~~CGnive   18 (126)
T 1vzi_A            5 LQVYKCEVCGNIVE   18 (126)
T ss_dssp             TCEEECTTTCCEEE
T ss_pred             CcEEEcCCCCeEEE
Confidence            45799999999875


No 169
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ...
Probab=35.17  E-value=10  Score=27.52  Aligned_cols=31  Identities=29%  Similarity=0.747  Sum_probs=20.0

Q ss_pred             eecceeccCCcccChhhhhhhcchhhhhhcccccCCCCCcccccc
Q psy7416         256 SYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANV  300 (381)
Q Consensus       256 ey~CEICGn~~Y~GrkaFe~HF~E~rH~~GmrcLGI~nt~~F~~I  300 (381)
                      .|.|-+|| ++|-+-             .|----||++-..|.++
T Consensus         2 ~~~C~~CG-yvYd~~-------------~Gdp~~gi~pGt~f~~l   32 (52)
T 1yk4_A            2 KLSCKICG-YIYDED-------------EGDPDNGISPGTKFEDL   32 (52)
T ss_dssp             EEEESSSS-CEEETT-------------TCBGGGTBCTTCCGGGS
T ss_pred             cEEeCCCC-eEECCC-------------cCCcccCcCCCCCHhHC
Confidence            69999999 568653             34444566655556554


No 170
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=33.89  E-value=16  Score=26.90  Aligned_cols=27  Identities=19%  Similarity=0.560  Sum_probs=18.8

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |--...|.|.+|| .+|.-+..+.+|..
T Consensus        31 h~~~~~~~C~~C~-~~f~~~~~l~~H~~   57 (96)
T 2dmd_A           31 HTGVKPYKCKTCD-YAAADSSSLNKHLR   57 (96)
T ss_dssp             CCCCCSEECSSSC-CEESSHHHHHHHHH
T ss_pred             cCCCCCEeCCCCC-CccCCHHHHHHHHH
Confidence            3334678888887 45667778888864


No 171
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=32.95  E-value=17  Score=27.72  Aligned_cols=28  Identities=11%  Similarity=0.229  Sum_probs=22.0

Q ss_pred             HhhCCCceecceeccCCccc-Chhhhhhhc
Q psy7416         249 KLHGLNISYTCEICGNFVYK-GPKAFQRHF  277 (381)
Q Consensus       249 KLhGL~~ey~CEICGn~~Y~-GrkaFe~HF  277 (381)
                      +.|--...|.|.+||.. |. -+..+.+|.
T Consensus        17 ~~h~~~~~~~C~~C~k~-f~~~~~~L~~H~   45 (98)
T 2gqj_A           17 RAIHERGEAVCPTCNVV-TRKTLVGLKKHM   45 (98)
T ss_dssp             HTTTTTSCCCCTTTCCC-CSSCSHHHHHHH
T ss_pred             HHhccCCCcCCCCCCCC-hhhhHHHHHHHH
Confidence            45666788999999975 55 788899996


No 172
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1
Probab=32.58  E-value=18  Score=27.75  Aligned_cols=28  Identities=25%  Similarity=0.471  Sum_probs=18.5

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhcc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      .|--...|.|.+||. .|.-+..+.+|..
T Consensus        29 ~h~~~~~~~C~~C~~-~f~~~~~l~~H~~   56 (124)
T 2dlq_A           29 KHTGEKPFECPKCGK-CYFRKENLLEHEA   56 (124)
T ss_dssp             HHSSCCSCBCTTTCC-BCSSHHHHHHHHH
T ss_pred             hCCCCCCeECCCCCc-hhcCHHHHHHHHh
Confidence            344456788888874 4556777777753


No 173
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=32.56  E-value=17  Score=27.71  Aligned_cols=29  Identities=24%  Similarity=0.501  Sum_probs=22.5

Q ss_pred             HhhCCCceecceeccCCcccChhhhhhhcc
Q psy7416         249 KLHGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       249 KLhGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      +.|--...|.|.+||. .|.-+..+.+|..
T Consensus        30 ~~h~~~~~~~C~~C~~-~f~~~~~l~~H~~   58 (110)
T 2csh_A           30 SMHLGLRPYGCGVCGK-KFKMKHHLVGHMK   58 (110)
T ss_dssp             HHHSCCCSEECTTTSC-EESSSHHHHHHHT
T ss_pred             HHcCCCcCccCCCCCc-ccCCHHHHHHHHH
Confidence            3455567899999985 5678899999964


No 174
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A
Probab=32.18  E-value=10  Score=24.43  Aligned_cols=23  Identities=22%  Similarity=0.401  Sum_probs=18.9

Q ss_pred             eecceeccCCcccChhhhhhhcch
Q psy7416         256 SYTCEICGNFVYKGPKAFQRHFAE  279 (381)
Q Consensus       256 ey~CEICGn~~Y~GrkaFe~HF~E  279 (381)
                      .|.|.||..+.= ..+.+.-||.+
T Consensus         3 k~~CpvCk~q~P-d~kt~~~H~e~   25 (28)
T 2jvx_A            3 DFCCPKCQYQAP-DMDTLQIHVME   25 (28)
T ss_dssp             CEECTTSSCEES-SHHHHHHHHHH
T ss_pred             cccCccccccCc-ChHHHHHHHHH
Confidence            589999997765 88889999865


No 175
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis}
Probab=31.36  E-value=12  Score=29.83  Aligned_cols=32  Identities=25%  Similarity=0.558  Sum_probs=21.4

Q ss_pred             ceecceeccCCcccChhhhhhhcchhhhhhcccccCCCCCcccccc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANV  300 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF~E~rH~~GmrcLGI~nt~~F~~I  300 (381)
                      ..|.|-||| ++|-+-.             |-.--|||+-..|.++
T Consensus        26 ~~y~C~vCG-yvYD~~~-------------Gdp~~gI~pGT~fedl   57 (81)
T 2kn9_A           26 KLFRCIQCG-FEYDEAL-------------GWPEDGIAAGTRWDDI   57 (81)
T ss_dssp             CEEEETTTC-CEEETTT-------------CBTTTTBCTTCCTTTS
T ss_pred             ceEEeCCCC-EEEcCCc-------------CCcccCcCCCCChhHC
Confidence            579999999 6686632             4444567665556554


No 176
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa}
Probab=30.61  E-value=12  Score=27.39  Aligned_cols=31  Identities=29%  Similarity=0.866  Sum_probs=19.6

Q ss_pred             eecceeccCCcccChhhhhhhcchhhhhhcccccCCCCCcccccc
Q psy7416         256 SYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANV  300 (381)
Q Consensus       256 ey~CEICGn~~Y~GrkaFe~HF~E~rH~~GmrcLGI~nt~~F~~I  300 (381)
                      .|.|.+|| ++|-+-             .|-.--||++-..|.++
T Consensus         3 ~y~C~~CG-yvYd~~-------------~Gdp~~gi~pGt~f~~l   33 (55)
T 2v3b_B            3 KWQCVVCG-FIYDEA-------------LGLPEEGIPAGTRWEDI   33 (55)
T ss_dssp             EEEETTTC-CEEETT-------------TCBTTTTBCTTCCGGGS
T ss_pred             cEEeCCCC-eEECCC-------------cCCcccCcCCCCChhHC
Confidence            69999999 568653             24444566655555544


No 177
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1
Probab=30.49  E-value=16  Score=25.59  Aligned_cols=17  Identities=12%  Similarity=0.452  Sum_probs=13.8

Q ss_pred             HhhCCCceecceeccCC
Q psy7416         249 KLHGLNISYTCEICGNF  265 (381)
Q Consensus       249 KLhGL~~ey~CEICGn~  265 (381)
                      +.|-=..+|.|.+||..
T Consensus        32 ~~H~~~k~~~C~~C~k~   48 (62)
T 1vd4_A           32 LFDPMTGTFRCTFCHTE   48 (62)
T ss_dssp             HEETTTTEEBCSSSCCB
T ss_pred             hhcCCCCCEECCCCCCc
Confidence            56766789999999964


No 178
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B
Probab=30.17  E-value=11  Score=24.78  Aligned_cols=22  Identities=23%  Similarity=0.677  Sum_probs=15.2

Q ss_pred             CceecceeccCCcccChhhhhhh
Q psy7416         254 NISYTCEICGNFVYKGPKAFQRH  276 (381)
Q Consensus       254 ~~ey~CEICGn~~Y~GrkaFe~H  276 (381)
                      .++|+|.+||.. |.-+..+.+|
T Consensus         6 ekp~~C~~CgK~-F~~~s~L~~H   27 (36)
T 1fv5_A            6 PARFMCLPCGIA-FSSPSTLEAH   27 (36)
T ss_dssp             CCCCEETTTTEE-CSCHHHHHHH
T ss_pred             ccCeECCCCCCc-cCCHhHccCc
Confidence            368999999964 3345556666


No 179
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}
Probab=30.16  E-value=17  Score=28.08  Aligned_cols=27  Identities=19%  Similarity=0.501  Sum_probs=18.3

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .|--.++|+|++||. +|.-+..+.+|.
T Consensus        50 ~H~~~k~~~C~~C~k-~F~~~~~L~~H~   76 (85)
T 2lv2_A           50 LLHAAQVFPCKYCPA-TFYSSPGLTRHI   76 (85)
T ss_dssp             TTSCSSSEECTTSSC-EESSHHHHHHHH
T ss_pred             hccCCCccCCCCCCC-EeCCHHHHHHhC
Confidence            344467888888875 455677777774


No 180
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A
Probab=29.66  E-value=14  Score=26.73  Aligned_cols=31  Identities=29%  Similarity=0.720  Sum_probs=19.5

Q ss_pred             eecceeccCCcccChhhhhhhcchhhhhhcccccCCCCCcccccc
Q psy7416         256 SYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANV  300 (381)
Q Consensus       256 ey~CEICGn~~Y~GrkaFe~HF~E~rH~~GmrcLGI~nt~~F~~I  300 (381)
                      .|.|-+|| ++|-+-             .|----||++-..|.++
T Consensus         3 ~y~C~~CG-yvYd~~-------------~Gdp~~gi~pGt~f~~l   33 (52)
T 1e8j_A            3 IYVCTVCG-YEYDPA-------------KGDPDSGIKPGTKFEDL   33 (52)
T ss_dssp             CEECSSSC-CCCCTT-------------TCCTTTTCCSSCCTTSS
T ss_pred             cEEeCCCC-eEEcCC-------------cCCcccCcCCCCchHHC
Confidence            59999999 568542             23344566655556554


No 181
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=29.30  E-value=20  Score=27.57  Aligned_cols=26  Identities=19%  Similarity=0.496  Sum_probs=20.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |.=.++|.|.+||. +|.-+..+.+|-
T Consensus        20 H~~~kpy~C~~C~k-~F~~~~~L~~H~   45 (88)
T 1x6f_A           20 RLQNSTYQCKHCDS-KLQSTAELTSHL   45 (88)
T ss_dssp             CCCCSCEECSSSCC-EESSHHHHHHHH
T ss_pred             cCCCCCCcCCCCCC-EeCCHHHHHHHH
Confidence            44567899999986 566788888885


No 182
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ...
Probab=29.21  E-value=24  Score=25.89  Aligned_cols=32  Identities=28%  Similarity=0.744  Sum_probs=21.0

Q ss_pred             ceecceeccCCcccChhhhhhhcchhhhhhcccccCCCCCcccccc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANV  300 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF~E~rH~~GmrcLGI~nt~~F~~I  300 (381)
                      ..|.|.||| ++|-.             +.|----||++-..|.+|
T Consensus         2 ~~y~C~vCG-yvYd~-------------~~Gdp~~gi~pGt~fe~l   33 (54)
T 4rxn_A            2 KKYTCTVCG-YIYDP-------------EDGDPDDGVNPGTDFKDI   33 (54)
T ss_dssp             CCEEETTTC-CEECT-------------TTCBGGGTBCTTCCGGGS
T ss_pred             CceECCCCC-eEECC-------------CcCCcccCcCCCCChhHC
Confidence            368999998 67754             335555667666666554


No 183
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=29.11  E-value=18  Score=28.86  Aligned_cols=22  Identities=23%  Similarity=0.406  Sum_probs=16.6

Q ss_pred             ceecceeccCCcccChhhhhhhc
Q psy7416         255 ISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .+|.|.+||. +|.-+..+.+|-
T Consensus        17 kpy~C~~Cgk-~F~~~~~L~~H~   38 (102)
T 2ghf_A           17 GGYECKYCTF-QTPDLNMFTFHV   38 (102)
T ss_dssp             SSEECSSCSC-EESCHHHHHHHH
T ss_pred             cCcCCCCCCC-ccCCHHHHHHHH
Confidence            4699999985 455777888874


No 184
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1
Probab=28.57  E-value=26  Score=27.02  Aligned_cols=26  Identities=19%  Similarity=0.427  Sum_probs=20.1

Q ss_pred             HhhCCCceecceeccCCcccChhhhhhh
Q psy7416         249 KLHGLNISYTCEICGNFVYKGPKAFQRH  276 (381)
Q Consensus       249 KLhGL~~ey~CEICGn~~Y~GrkaFe~H  276 (381)
                      +.| =.+.|.|.+||.. |.-+..+.+|
T Consensus        56 ~~h-~~k~~~C~~Cgk~-F~~~~~L~~H   81 (96)
T 2ctd_A           56 ENC-KQEMFTCHHCGKQ-LRSLAGMKYH   81 (96)
T ss_dssp             HHH-CCCCCCCSSSCCC-CSSHHHHHHH
T ss_pred             HHH-CCCCeECCCCCCe-eCCHHHHHHH
Confidence            456 4689999999964 5577888888


No 185
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1
Probab=27.91  E-value=18  Score=27.62  Aligned_cols=26  Identities=23%  Similarity=0.290  Sum_probs=19.2

Q ss_pred             hCCCceecceeccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      |--...|.|.+||. .|.-+..+.+|-
T Consensus        64 H~~~~~~~C~~C~~-~f~~~~~L~~H~   89 (107)
T 1wjp_A           64 KCEYKKLTCLECMR-TFKSSFSIWRHQ   89 (107)
T ss_dssp             HCSTGGGEEGGGTE-ECSSHHHHHHHH
T ss_pred             cCCCCCccCccccc-hhCCHHHHHHHH
Confidence            55567799999985 566777888774


No 186
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A
Probab=27.36  E-value=24  Score=20.33  Aligned_cols=22  Identities=27%  Similarity=0.717  Sum_probs=15.8

Q ss_pred             ceecce--eccCCcccChhhhhhhc
Q psy7416         255 ISYTCE--ICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       255 ~ey~CE--ICGn~~Y~GrkaFe~HF  277 (381)
                      ++|.|.  +||. +|.-+..+.+|-
T Consensus         1 kp~~C~~~~C~k-~f~~~~~L~~H~   24 (31)
T 1sp2_A            1 RPFMCTWSYCGK-RFTRSDELQRHK   24 (31)
T ss_dssp             CCCBCCSTTCCC-BCSSHHHHHHHH
T ss_pred             CCcCCcCCCCCc-ccCCHhHHHHHH
Confidence            369998  9985 444677777774


No 187
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A
Probab=27.24  E-value=16  Score=33.03  Aligned_cols=14  Identities=43%  Similarity=0.809  Sum_probs=11.3

Q ss_pred             ceecceeccCCcccC
Q psy7416         255 ISYTCEICGNFVYKG  269 (381)
Q Consensus       255 ~ey~CEICGn~~Y~G  269 (381)
                      ..|.|.+||. +|.|
T Consensus       170 ~~~~C~~CG~-i~~g  183 (202)
T 1yuz_A          170 KFHLCPICGY-IHKG  183 (202)
T ss_dssp             CEEECSSSCC-EEES
T ss_pred             cEEEECCCCC-EEcC
Confidence            5689999995 5877


No 188
>2dsm_A Hypothetical protein YQAI; homodimer, domain swapped dimer, inter-domain beta sheet, structural genomics, PSI-2, protein structure initiative; NMR {Bacillus subtilis} SCOP: d.372.1.1
Probab=27.20  E-value=39  Score=26.34  Aligned_cols=36  Identities=14%  Similarity=-0.049  Sum_probs=29.0

Q ss_pred             CCCCCCCCCCCCCCCchhHHHHhhCCCceecceeccCCcccChhhhh
Q psy7416         228 PYNPKNLPLGWDGKPIPYWLYKLHGLNISYTCEICGNFVYKGPKAFQ  274 (381)
Q Consensus       228 ~ynp~~lPlg~DGkPIPyWLYKLhGL~~ey~CEICGn~~Y~GrkaFe  274 (381)
                      |-||.=+..-|||-|.|-     -+.+      +||+-+|.|-.-|+
T Consensus         2 IENPMv~~~~~~gy~~~e-----~~~D------~cG~EI~~gd~yl~   37 (72)
T 2dsm_A            2 VENPMVINNWHDKLTETD-----VQID------FYGDEVTPVDDYVI   37 (72)
T ss_dssp             CCCSSCCCCCCSCCCCSS-----CBCC------TTSSCBCTTSCEEE
T ss_pred             CcCcccccccccCCCCCc-----cccc------ccCCeeecCCeEEE
Confidence            569999999999999998     4444      99999998876543


No 189
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A
Probab=25.14  E-value=14  Score=32.90  Aligned_cols=15  Identities=33%  Similarity=0.851  Sum_probs=11.8

Q ss_pred             ceecceeccCCcccCh
Q psy7416         255 ISYTCEICGNFVYKGP  270 (381)
Q Consensus       255 ~ey~CEICGn~~Y~Gr  270 (381)
                      +.|.|.+||. +|-|.
T Consensus       154 ~~~~C~~CG~-~~~g~  168 (191)
T 1lko_A          154 TKWRCRNCGY-VHEGT  168 (191)
T ss_dssp             EEEEETTTCC-EEEEE
T ss_pred             ceEEECCCCC-EeeCC
Confidence            3589999994 58786


No 190
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=25.11  E-value=25  Score=23.07  Aligned_cols=23  Identities=22%  Similarity=0.416  Sum_probs=17.0

Q ss_pred             Cceeccee--ccCCcccChhhhhhhc
Q psy7416         254 NISYTCEI--CGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEI--CGn~~Y~GrkaFe~HF  277 (381)
                      .++|+|.+  ||. +|.-+..+.+|-
T Consensus         7 ekp~~C~~~~C~k-~F~~~~~L~~H~   31 (38)
T 2eln_A            7 GILLKCPTDGCDY-STPDKYKLQAHL   31 (38)
T ss_dssp             CCCEECSSSSCCC-EESCHHHHHHHH
T ss_pred             CCCCCCCCCCCCC-ccCCHHHHHHHH
Confidence            46899986  987 455677788873


No 191
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens}
Probab=25.01  E-value=32  Score=24.07  Aligned_cols=28  Identities=18%  Similarity=0.488  Sum_probs=18.9

Q ss_pred             HhhCCCceeccee--ccCCcccChhhhhhhc
Q psy7416         249 KLHGLNISYTCEI--CGNFVYKGPKAFQRHF  277 (381)
Q Consensus       249 KLhGL~~ey~CEI--CGn~~Y~GrkaFe~HF  277 (381)
                      +.|-=...|.|.+  ||. .|.-+..+.+|-
T Consensus        40 ~~H~~~~~~~C~~~~C~k-~f~~~~~l~~H~   69 (72)
T 2epa_A           40 RTHTGEKPFSCSWKGCER-RFARSDELSRHR   69 (72)
T ss_dssp             HHHSSSCSEECCCTTCCC-EESSHHHHHHHT
T ss_pred             HhcCCCCCccCCCCCCCc-ccCCHHHHHhHh
Confidence            4565567899966  984 465677777763


No 192
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1
Probab=24.78  E-value=15  Score=29.50  Aligned_cols=15  Identities=27%  Similarity=0.966  Sum_probs=11.8

Q ss_pred             ceecceeccCCcccCh
Q psy7416         255 ISYTCEICGNFVYKGP  270 (381)
Q Consensus       255 ~ey~CEICGn~~Y~Gr  270 (381)
                      ..|.|-+|| ++|-+-
T Consensus        34 ~~y~C~vCG-yvYD~~   48 (87)
T 1s24_A           34 LKWICITCG-HIYDEA   48 (87)
T ss_dssp             CEEEETTTT-EEEETT
T ss_pred             ceEECCCCC-eEecCC
Confidence            479999999 568653


No 193
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1
Probab=24.58  E-value=32  Score=20.74  Aligned_cols=23  Identities=17%  Similarity=0.566  Sum_probs=17.5

Q ss_pred             Cceeccee--ccCCcccChhhhhhhc
Q psy7416         254 NISYTCEI--CGNFVYKGPKAFQRHF  277 (381)
Q Consensus       254 ~~ey~CEI--CGn~~Y~GrkaFe~HF  277 (381)
                      .+.|.|.+  ||. +|.-+..+.+|-
T Consensus         4 ~k~~~C~~~~C~k-~f~~~~~L~~H~   28 (38)
T 1bhi_A            4 DKPFLCTAPGCGQ-RFTNEDHLAVHK   28 (38)
T ss_dssp             CCCEECCCTTTCC-EESSHHHHHHHH
T ss_pred             CcceECCCCCCCc-ccCCHHHHHHHH
Confidence            46799995  986 566778888884


No 194
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A
Probab=23.69  E-value=19  Score=27.64  Aligned_cols=15  Identities=40%  Similarity=1.127  Sum_probs=11.5

Q ss_pred             ceecceeccCCcccCh
Q psy7416         255 ISYTCEICGNFVYKGP  270 (381)
Q Consensus       255 ~ey~CEICGn~~Y~Gr  270 (381)
                      ..|.|-+|| ++|-+.
T Consensus         6 ~~y~C~vCG-yiYd~~   20 (70)
T 1dx8_A            6 GKYECEACG-YIYEPE   20 (70)
T ss_dssp             SCEEETTTC-CEECTT
T ss_pred             ceEEeCCCC-EEEcCC
Confidence            469999999 568653


No 195
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A*
Probab=23.60  E-value=29  Score=26.77  Aligned_cols=27  Identities=22%  Similarity=0.429  Sum_probs=20.5

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhcc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      .| -...|.|.+||. +|..+..+.+|..
T Consensus        29 ~h-~~~~~~C~~C~~-~f~~~~~l~~H~~   55 (124)
T 1ubd_C           29 TH-GPRVHVCAECGK-AFVESSKLKRHQL   55 (124)
T ss_dssp             GG-SCCCEECTTTCC-EESSHHHHHHHGG
T ss_pred             Hc-CCCCeECCCCCc-hhCCHHHHHHHHH
Confidence            45 356799999974 6778888999964


No 196
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A*
Probab=23.43  E-value=14  Score=27.81  Aligned_cols=35  Identities=20%  Similarity=0.390  Sum_probs=19.4

Q ss_pred             eecceeccCCcccCh-hhhhhhcchhhhhhcccccCCCCC
Q psy7416         256 SYTCEICGNFVYKGP-KAFQRHFAEWRHAHGMRCLGIPNT  294 (381)
Q Consensus       256 ey~CEICGn~~Y~Gr-kaFe~HF~E~rH~~GmrcLGI~nt  294 (381)
                      ...|.|||...+ |. -.+=-.=.+|   |++.||||+..
T Consensus        18 ~~~C~~C~~~~~-~~~mi~CD~C~~w---fH~~Cv~~~~~   53 (75)
T 2k16_A           18 IWICPGCNKPDD-GSPMIGCDDCDDW---YHWPCVGIMAA   53 (75)
T ss_dssp             EECBTTTTBCCS-SCCEEECSSSSSE---EEHHHHTCSSC
T ss_pred             CcCCCCCCCCCC-CCCEEEcCCCCcc---cccccCCCCcc
Confidence            356889987643 31 1111111334   56789999854


No 197
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C*
Probab=23.07  E-value=25  Score=29.52  Aligned_cols=28  Identities=25%  Similarity=0.503  Sum_probs=20.7

Q ss_pred             hhCCCceecceeccCCcccChhhhhhhcc
Q psy7416         250 LHGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       250 LhGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      .|.-..+|.|++||. +|.-+..+.+|..
T Consensus       155 ~H~~~~~~~C~~C~~-~f~~~~~L~~H~~  182 (190)
T 2i13_A          155 THTGEKPYKCPECGK-SFSRRDALNVHQR  182 (190)
T ss_dssp             HHHCCCCEECTTTCC-EESSHHHHHHHHT
T ss_pred             hcCCCCCeECCCCCC-ccCCHHHHHHHHH
Confidence            455567899999986 6668888888853


No 198
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1
Probab=22.87  E-value=35  Score=27.33  Aligned_cols=28  Identities=21%  Similarity=0.374  Sum_probs=21.1

Q ss_pred             hCCCceecceecc----CCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICG----NFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICG----n~~Y~GrkaFe~HF~  278 (381)
                      |+-..+|.|.+||    +.+|..+..+.+|..
T Consensus        29 h~~~~~~~C~~c~C~~c~~~f~~~~~l~~H~~   60 (155)
T 2gli_A           29 HGERKEFVCHWGGCSRELRPFKAQYMLVVHMR   60 (155)
T ss_dssp             SSCSSCCCCCBTTCTTTTCCCSSHHHHHHHTH
T ss_pred             CCCCcceeCCCCCccchhhhhhhHHHHHHHHH
Confidence            5556778888866    577888888888854


No 199
>1y07_A Desulfoferrodoxin (RBO); beta-sheet, iron binding, oxidoreductase; 1.55A {Treponema pallidum subsp}
Probab=22.84  E-value=18  Score=30.71  Aligned_cols=13  Identities=15%  Similarity=0.107  Sum_probs=7.0

Q ss_pred             ceeccee-ccCCcc
Q psy7416         255 ISYTCEI-CGNFVY  267 (381)
Q Consensus       255 ~ey~CEI-CGn~~Y  267 (381)
                      .-|+|++ |||.+-
T Consensus         6 ~fYkC~~~CGnive   19 (128)
T 1y07_A            6 SFFLQKESAGFFLG   19 (128)
T ss_dssp             EEECC-----CEEE
T ss_pred             cEEECCCCCCCEEE
Confidence            3599999 999885


No 200
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1
Probab=22.41  E-value=37  Score=21.60  Aligned_cols=26  Identities=19%  Similarity=0.414  Sum_probs=19.1

Q ss_pred             hCCCceecce--eccCCcccChhhhhhhc
Q psy7416         251 HGLNISYTCE--ICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       251 hGL~~ey~CE--ICGn~~Y~GrkaFe~HF  277 (381)
                      |--.+.|.|+  +||. +|.-+..+.+|-
T Consensus         7 H~~~k~~~C~~~~C~k-~f~~~~~L~~H~   34 (48)
T 2ent_A            7 GTGEKPFACTWPGCGW-RFSRSDELSRHR   34 (48)
T ss_dssp             SCCCCCEECCSSSCCC-EESSHHHHHHHH
T ss_pred             cCCCCCeECCCCCCCC-ccCCHHHHHHHH
Confidence            3345789998  8985 566778888884


No 201
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A*
Probab=22.35  E-value=27  Score=26.59  Aligned_cols=27  Identities=15%  Similarity=0.417  Sum_probs=19.4

Q ss_pred             hCCCceecceeccCCcccChhhhhhhcc
Q psy7416         251 HGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       251 hGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |-=...|.|.+||. +|.-+..+.+|-.
T Consensus        61 h~~~~~~~C~~C~~-~f~~~~~l~~H~~   87 (119)
T 2jp9_A           61 HTGVKPFQCKTCQR-KFSRSDHLKTHTR   87 (119)
T ss_dssp             HHCCCCEECTTTCC-EESCHHHHHHHHH
T ss_pred             cCCCCCccCCccCc-hhCCHHHHHHHHH
Confidence            44456788999874 5667788888864


No 202
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1
Probab=22.26  E-value=17  Score=33.32  Aligned_cols=29  Identities=31%  Similarity=0.865  Sum_probs=23.0

Q ss_pred             CCCchhHHHHhhCCCceecceeccCCcccChhhhhhhcc
Q psy7416         240 GKPIPYWLYKLHGLNISYTCEICGNFVYKGPKAFQRHFA  278 (381)
Q Consensus       240 GkPIPyWLYKLhGL~~ey~CEICGn~~Y~GrkaFe~HF~  278 (381)
                      |...-||        +=|+||-||.++  --..|.+|..
T Consensus       146 GqDyvFW--------QFYKCe~CgKYv--DId~~~~Hlk  174 (226)
T 2czr_A          146 GQDYIFW--------QFYKCEECGKYV--DIENLEAHLR  174 (226)
T ss_dssp             TTTEEEE--------EEEECTTTCCEE--EGGGHHHHHH
T ss_pred             CcceEEE--------EEEehhhcCcee--cHHHHHHHHH
Confidence            7888899        459999999865  5778888753


No 203
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=21.53  E-value=32  Score=25.27  Aligned_cols=21  Identities=14%  Similarity=0.282  Sum_probs=16.9

Q ss_pred             eecceeccCCcccChhhhhhhc
Q psy7416         256 SYTCEICGNFVYKGPKAFQRHF  277 (381)
Q Consensus       256 ey~CEICGn~~Y~GrkaFe~HF  277 (381)
                      .|+|.+||. +|.-+..+.+|-
T Consensus        25 ~~~C~~C~k-~f~~~~~L~~H~   45 (95)
T 2ej4_A           25 SRPKKSCDR-TFSTMHELVTHV   45 (95)
T ss_dssp             SSSCCCCCC-CCSSHHHHHHHH
T ss_pred             CCccccccc-ccCCHHHHHHHH
Confidence            578999984 667888888884


No 204
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A*
Probab=20.76  E-value=25  Score=28.24  Aligned_cols=11  Identities=18%  Similarity=0.628  Sum_probs=8.7

Q ss_pred             hcccccCCCCC
Q psy7416         284 HGMRCLGIPNT  294 (381)
Q Consensus       284 ~GmrcLGI~nt  294 (381)
                      |++.|+||+..
T Consensus        52 fH~~CVgl~~~   62 (90)
T 2jmi_A           52 FHYGCVGLKQA   62 (90)
T ss_dssp             EETTTSSCSSC
T ss_pred             CcCccCCCCcC
Confidence            67889999854


Done!