Diaphorina citri psyllid: psy7420


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------6
MQLYSIPDIRIFFSEDSGFLNQFRTEDVNQKIVFKFLLRELLLPRSYRPEIEERMKTGY
ccccccccEEEEECccccHHHccccccccccEEEEEccccccccccccHHHHHHHHHcc
MQLYSIPDIRIFFSEDSGFLNQFRTEDVNQKIVFKFLLRELLLPRSYRPEIEER*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLYSIPDIRIFFSEDSGFLNQFRTEDVNQKIVFKFLLRELLLPRSYRPEIEERMKTGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phenylalanine--tRNA ligase, mitochondrial Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins.confidentQ99M01
Phenylalanine--tRNA ligase, mitochondrial Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins.confidentQ6AYQ3
Phenylalanine--tRNA ligase, mitochondrial Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins.confidentO95363

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004826 [MF]phenylalanine-tRNA ligase activityprobableGO:0004812, GO:0003824, GO:0003674, GO:0016874, GO:0016875, GO:0016876
GO:0006432 [BP]phenylalanyl-tRNA aminoacylationprobableGO:0006139, GO:0019752, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0034645, GO:0034660, GO:1901360, GO:0044267, GO:0044710, GO:0044260, GO:0006520, GO:0071704, GO:0010467, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0016070, GO:0044238, GO:1901564, GO:0006082, GO:0019538, GO:0044237, GO:0043170, GO:0006399, GO:0043038, GO:0043039, GO:0006418, GO:0006412
GO:0000049 [MF]tRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008033 [BP]tRNA processingprobableGO:0016070, GO:0006139, GO:0044238, GO:0034470, GO:0044260, GO:0071704, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0006399, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0034660, GO:0006396, GO:0046483

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMQ, chain A
Confidence level:very confident
Coverage over the Query: 1-54
View the alignment between query and template
View the model in PyMOL