Query         psy7447
Match_columns 114
No_of_seqs    118 out of 1427
Neff          10.3
Searched_HMMs 46136
Date          Fri Aug 16 18:32:08 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7447.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7447hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.8 2.8E-22   6E-27  127.6   2.4   91   10-105   175-265 (279)
  2 KOG2462|consensus               99.8 5.7E-20 1.2E-24  117.2   1.9   96    6-106   140-238 (279)
  3 KOG3623|consensus               99.6 7.6E-16 1.7E-20  109.1   2.7   81   21-103   890-970 (1007)
  4 KOG3623|consensus               99.5 3.1E-15 6.8E-20  106.0   0.9   93   12-105   226-331 (1007)
  5 KOG1074|consensus               99.4 2.4E-14 5.1E-19  102.7   1.0   49   56-105   607-655 (958)
  6 KOG3576|consensus               99.3 8.8E-14 1.9E-18   85.8  -0.7   76   21-98    113-188 (267)
  7 KOG3576|consensus               99.3 2.8E-13   6E-18   83.7  -0.9   81   12-95    133-224 (267)
  8 KOG3608|consensus               99.1 1.9E-11 4.2E-16   81.1  -0.4   98    7-105   190-314 (467)
  9 KOG1074|consensus               99.1 2.3E-11   5E-16   87.8  -0.1   69    9-78    618-692 (958)
 10 KOG3608|consensus               99.0 1.9E-10 4.2E-15   76.4   2.1   89    6-96    273-365 (467)
 11 PHA02768 hypothetical protein;  98.9 8.8E-10 1.9E-14   54.8   2.6   39   54-95      5-43  (55)
 12 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.7E-09 3.8E-14   46.2   2.1   25   69-94      1-25  (26)
 13 PHA00733 hypothetical protein   98.9 1.1E-09 2.4E-14   64.2   1.8   74   21-98     36-114 (128)
 14 PHA00733 hypothetical protein   98.8 4.4E-09 9.6E-14   61.8   3.9   63   12-79     62-124 (128)
 15 PHA02768 hypothetical protein;  98.8 1.8E-09 3.9E-14   53.7   1.9   42   26-70      6-47  (55)
 16 PLN03086 PRLI-interacting fact  98.7 1.3E-08 2.8E-13   72.2   2.8   66   24-94    477-552 (567)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.6   6E-08 1.3E-12   41.3   2.5   25   40-65      1-25  (26)
 18 PHA00616 hypothetical protein   98.5 3.7E-08 7.9E-13   46.8   1.4   33   54-87      1-33  (44)
 19 PLN03086 PRLI-interacting fact  98.5 3.1E-07 6.8E-12   65.4   5.2   67   21-94    449-515 (567)
 20 PHA00616 hypothetical protein   98.5   1E-07 2.2E-12   45.3   1.7   33   25-58      1-33  (44)
 21 PHA00732 hypothetical protein   98.3 6.8E-07 1.5E-11   48.2   2.7   45   25-76      1-46  (79)
 22 PHA00732 hypothetical protein   98.1 1.9E-06 4.2E-11   46.4   2.1   40   54-96      1-40  (79)
 23 PF00096 zf-C2H2:  Zinc finger,  97.9 9.6E-06 2.1E-10   33.2   1.8   22   26-47      1-22  (23)
 24 PF05605 zf-Di19:  Drought indu  97.8 4.4E-05 9.5E-10   38.2   4.1   52   25-79      2-54  (54)
 25 PF00096 zf-C2H2:  Zinc finger,  97.8 1.9E-05 4.1E-10   32.3   2.1   23   55-77      1-23  (23)
 26 PF13894 zf-C2H2_4:  C2H2-type   97.5 0.00013 2.9E-09   29.7   2.3   22   56-77      2-23  (24)
 27 PF13912 zf-C2H2_6:  C2H2-type   97.5 6.5E-05 1.4E-09   31.9   1.3   23   26-48      2-24  (27)
 28 PF13912 zf-C2H2_6:  C2H2-type   97.4 7.3E-05 1.6E-09   31.7   1.2   26   54-79      1-26  (27)
 29 KOG3993|consensus               97.4 9.3E-05   2E-09   51.0   1.8   56   24-79    294-381 (500)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.4 0.00019 4.1E-09   29.2   2.0   23   26-48      1-23  (24)
 31 COG5189 SFP1 Putative transcri  97.3 8.3E-05 1.8E-09   49.5   0.8   66   23-99    347-414 (423)
 32 PF09237 GAGA:  GAGA factor;  I  97.3 0.00037   8E-09   34.0   2.7   31   52-82     22-52  (54)
 33 PRK04860 hypothetical protein;  97.3  0.0003 6.5E-09   42.9   2.9   38   54-96    119-156 (160)
 34 PF09237 GAGA:  GAGA factor;  I  97.2 0.00084 1.8E-08   32.8   3.5   44   10-54      9-52  (54)
 35 PF12756 zf-C2H2_2:  C2H2 type   97.1 0.00069 1.5E-08   37.6   2.9   25   54-78     50-74  (100)
 36 smart00355 ZnF_C2H2 zinc finge  96.8  0.0015 3.1E-08   26.8   2.3   20   56-75      2-21  (26)
 37 smart00355 ZnF_C2H2 zinc finge  96.8  0.0012 2.6E-08   27.1   2.0   24   26-49      1-24  (26)
 38 PRK04860 hypothetical protein;  96.7   0.002 4.2E-08   39.4   2.9   39   24-67    118-156 (160)
 39 COG5189 SFP1 Putative transcri  96.7  0.0013 2.7E-08   44.1   2.0   25   52-76    347-373 (423)
 40 PF05605 zf-Di19:  Drought indu  96.4  0.0058 1.2E-07   30.4   3.1   39   54-93      2-41  (54)
 41 PF12874 zf-met:  Zinc-finger o  96.3  0.0029 6.3E-08   26.1   1.4   21   26-46      1-21  (25)
 42 PF13909 zf-H2C2_5:  C2H2-type   96.2  0.0053 1.2E-07   25.1   2.0   23   55-78      1-23  (24)
 43 PF12874 zf-met:  Zinc-finger o  95.8  0.0062 1.4E-07   25.0   1.3   23   55-77      1-23  (25)
 44 KOG3993|consensus               94.9  0.0048   1E-07   42.9  -0.8   52   25-77    267-318 (500)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  94.1   0.013 2.7E-07   24.7  -0.2   21   26-46      2-22  (27)
 46 PF13913 zf-C2HC_2:  zinc-finge  94.1   0.056 1.2E-06   22.4   1.8   18   56-74      4-21  (25)
 47 cd00350 rubredoxin_like Rubred  94.1   0.051 1.1E-06   24.1   1.8   24   55-91      2-25  (33)
 48 COG5048 FOG: Zn-finger [Genera  92.6   0.025 5.5E-07   38.9  -0.6   63   24-88    288-356 (467)
 49 smart00451 ZnF_U1 U1-like zinc  92.3    0.12 2.5E-06   22.9   1.6   22   25-46      3-24  (35)
 50 KOG1146|consensus               91.3    0.17 3.6E-06   40.3   2.3   64   11-75    451-539 (1406)
 51 PF12756 zf-C2H2_2:  C2H2 type   90.0    0.28 6.1E-06   26.8   2.0   26   25-50     50-75  (100)
 52 PF13719 zinc_ribbon_5:  zinc-r  89.1    0.39 8.4E-06   21.8   1.8   10   84-93     26-35  (37)
 53 PF05290 Baculo_IE-1:  Baculovi  88.4     0.9   2E-05   26.9   3.3   60   21-97     76-135 (140)
 54 cd00729 rubredoxin_SM Rubredox  88.3    0.45 9.8E-06   21.2   1.7    8   84-91     19-26  (34)
 55 COG1592 Rubrerythrin [Energy p  88.1    0.33 7.1E-06   29.9   1.5   26   52-91    132-157 (166)
 56 PF09538 FYDLN_acid:  Protein o  87.8    0.47   1E-05   27.2   1.9   13   54-66     26-38  (108)
 57 PF09986 DUF2225:  Uncharacteri  87.8   0.076 1.6E-06   34.1  -1.5   13   84-96     49-61  (214)
 58 KOG4317|consensus               86.7    0.23   5E-06   33.6   0.2   30   84-113    20-49  (383)
 59 TIGR00373 conserved hypothetic  85.6     1.2 2.7E-05   27.2   3.0   33   52-94    107-139 (158)
 60 KOG2186|consensus               85.3    0.61 1.3E-05   30.7   1.6   50   26-79      4-53  (276)
 61 KOG2893|consensus               84.3    0.27 5.8E-06   32.1  -0.3   45   23-73      9-53  (341)
 62 PF13717 zinc_ribbon_4:  zinc-r  83.9     1.1 2.3E-05   20.3   1.7   10   84-93     26-35  (36)
 63 TIGR00622 ssl1 transcription f  82.4     4.3 9.3E-05   23.4   4.1   71   24-97     14-95  (112)
 64 COG1997 RPL43A Ribosomal prote  82.2    0.38 8.2E-06   26.3  -0.2   31   53-94     34-64  (89)
 65 KOG2186|consensus               82.1    0.79 1.7E-05   30.2   1.2   39   54-95      3-41  (276)
 66 COG4049 Uncharacterized protei  81.6     1.1 2.5E-05   22.3   1.4   31   20-50     12-42  (65)
 67 PRK06266 transcription initiat  81.0       2 4.4E-05   26.8   2.7   33   52-94    115-147 (178)
 68 TIGR02098 MJ0042_CXXC MJ0042 f  80.9     1.3 2.8E-05   19.9   1.4   10   84-93     26-35  (38)
 69 smart00659 RPOLCX RNA polymera  80.7     1.7 3.6E-05   20.6   1.8   11   84-94     20-30  (44)
 70 smart00531 TFIIE Transcription  80.1     3.9 8.5E-05   24.6   3.7   38   52-94     97-134 (147)
 71 PRK00398 rpoP DNA-directed RNA  79.6     1.2 2.7E-05   21.1   1.2   11   84-94     22-32  (46)
 72 COG0068 HypF Hydrogenase matur  78.4    0.27 5.8E-06   36.8  -2.0   62   27-96    125-186 (750)
 73 smart00834 CxxC_CXXC_SSSS Puta  77.9    0.89 1.9E-05   20.7   0.3   12   55-66      6-17  (41)
 74 PF05443 ROS_MUCR:  ROS/MUCR tr  77.0     1.6 3.4E-05   26.0   1.3   26   54-82     72-97  (132)
 75 TIGR02300 FYDLN_acid conserved  76.8     2.1 4.6E-05   25.2   1.7   30   26-67     10-39  (129)
 76 TIGR02605 CxxC_CxxC_SSSS putat  75.9     1.1 2.4E-05   21.8   0.4   12   55-66      6-17  (52)
 77 COG2888 Predicted Zn-ribbon RN  75.9     2.3   5E-05   21.6   1.5   34   52-91     25-58  (61)
 78 COG1996 RPC10 DNA-directed RNA  74.4     2.1 4.6E-05   20.8   1.1   11   25-35      6-16  (49)
 79 PF03604 DNA_RNApol_7kD:  DNA d  74.4     2.4 5.1E-05   18.7   1.2   11   84-94     18-28  (32)
 80 PF09845 DUF2072:  Zn-ribbon co  74.1       6 0.00013   23.5   3.2   15   25-39      1-15  (131)
 81 PF12013 DUF3505:  Protein of u  73.9     3.5 7.6E-05   23.3   2.2   26   54-79     80-109 (109)
 82 COG5048 FOG: Zn-finger [Genera  73.6     1.7 3.7E-05   29.9   1.0   45   53-98    288-338 (467)
 83 PF14353 CpXC:  CpXC protein     73.1     4.1 8.8E-05   23.8   2.4   10   27-36      3-12  (128)
 84 PF10571 UPF0547:  Uncharacteri  72.4     2.1 4.5E-05   17.9   0.7   11   84-94     15-25  (26)
 85 smart00734 ZnF_Rad18 Rad18-lik  72.2     4.6 9.9E-05   16.7   1.8   19   56-75      3-21  (26)
 86 PF04959 ARS2:  Arsenite-resist  70.5       3 6.6E-05   26.9   1.5   29   22-50     74-102 (214)
 87 KOG2231|consensus               69.1     1.2 2.6E-05   33.4  -0.6   30   56-90    184-213 (669)
 88 PRK14890 putative Zn-ribbon RN  68.9     5.4 0.00012   20.2   1.9   32   53-91     24-56  (59)
 89 PF04959 ARS2:  Arsenite-resist  67.9     1.9 4.2E-05   27.8   0.2   29   52-80     75-103 (214)
 90 KOG2593|consensus               66.3     6.6 0.00014   28.0   2.5   39   52-94    126-164 (436)
 91 TIGR00595 priA primosomal prot  64.5     3.5 7.7E-05   30.0   1.1   15   84-98    254-268 (505)
 92 COG1198 PriA Primosomal protei  63.2     2.1 4.6E-05   32.6  -0.3   23   83-107   475-497 (730)
 93 COG5236 Uncharacterized conser  60.9      11 0.00025   26.3   2.9   43    6-49    198-244 (493)
 94 KOG2893|consensus               60.4     4.4 9.5E-05   26.7   0.8   42   52-99      9-50  (341)
 95 KOG2785|consensus               60.3      17 0.00037   25.6   3.6   55   25-79    166-245 (390)
 96 PF09963 DUF2197:  Uncharacteri  60.3     3.7 7.9E-05   20.6   0.4   10   27-36      4-13  (56)
 97 PF07754 DUF1610:  Domain of un  60.0     4.3 9.4E-05   16.6   0.5    7   84-90     17-23  (24)
 98 PRK00464 nrdR transcriptional   59.9     1.9 4.1E-05   26.4  -0.8   11   26-36     29-39  (154)
 99 PF02892 zf-BED:  BED zinc fing  59.7     8.4 0.00018   17.8   1.6   13   24-36     15-27  (45)
100 KOG1146|consensus               58.7    0.87 1.9E-05   36.5  -2.9   74   29-104   440-539 (1406)
101 PF09723 Zn-ribbon_8:  Zinc rib  56.8     4.5 9.8E-05   18.8   0.4   18   84-101     6-23  (42)
102 COG3357 Predicted transcriptio  56.5     9.3  0.0002   21.2   1.5   14   53-66     57-70  (97)
103 TIGR03831 YgiT_finger YgiT-typ  56.2     5.9 0.00013   18.3   0.7   14   82-95     31-44  (46)
104 smart00154 ZnF_AN1 AN1-like Zi  54.6     6.1 0.00013   18.1   0.6   14   84-97     13-26  (39)
105 PHA00626 hypothetical protein   54.4     6.3 0.00014   19.8   0.6   14   83-96     23-36  (59)
106 PRK00432 30S ribosomal protein  54.2     8.1 0.00017   18.8   1.0   10   84-93     38-47  (50)
107 PRK03824 hypA hydrogenase nick  53.8     5.9 0.00013   23.6   0.6   15   53-67     69-83  (135)
108 KOG4167|consensus               53.7     3.9 8.5E-05   31.2  -0.2   28   23-50    790-817 (907)
109 smart00614 ZnF_BED BED zinc fi  53.6      19 0.00041   17.2   2.3    8   68-75     37-44  (50)
110 COG4957 Predicted transcriptio  53.4     8.3 0.00018   23.1   1.1   24   56-82     78-101 (148)
111 COG3364 Zn-ribbon containing p  53.1      10 0.00023   21.5   1.4   15   25-39      2-16  (112)
112 PF10263 SprT-like:  SprT-like   53.0     4.2 9.2E-05   24.4  -0.1   33   54-95    123-155 (157)
113 PF02176 zf-TRAF:  TRAF-type zi  51.4     8.9 0.00019   18.9   1.0   20   39-59     24-43  (60)
114 PF06524 NOA36:  NOA36 protein;  51.0      24 0.00051   23.7   3.0   72   20-94    137-220 (314)
115 COG3091 SprT Zn-dependent meta  49.1     7.5 0.00016   23.7   0.5   36   53-94    116-151 (156)
116 PRK14873 primosome assembly pr  49.0      19 0.00042   27.4   2.7   55   27-100   385-439 (665)
117 TIGR00100 hypA hydrogenase nic  48.4      12 0.00025   21.6   1.2   27   54-93     70-96  (115)
118 PRK05580 primosome assembly pr  48.2     8.5 0.00018   29.2   0.8   13   84-96    422-434 (679)
119 PRK12380 hydrogenase nickel in  48.1     9.2  0.0002   22.0   0.8   26   54-92     70-95  (113)
120 PF13878 zf-C2H2_3:  zinc-finge  48.1      25 0.00054   16.2   2.1   22   56-77     15-38  (41)
121 PF10276 zf-CHCC:  Zinc-finger   47.7     6.7 0.00015   18.2   0.1   10   84-93     30-39  (40)
122 KOG2231|consensus               47.5      22 0.00048   27.1   2.7   48   26-78    183-236 (669)
123 PRK03681 hypA hydrogenase nick  46.9     8.8 0.00019   22.1   0.6   28   54-93     70-97  (114)
124 KOG3507|consensus               46.9      13 0.00028   18.8   1.1   27   25-63     20-46  (62)
125 smart00440 ZnF_C2C2 C2C2 Zinc   46.6       2 4.3E-05   19.8  -1.8    8   84-91     29-36  (40)
126 PF01428 zf-AN1:  AN1-like Zinc  46.6     6.4 0.00014   18.3  -0.0   15   83-97     13-27  (43)
127 KOG3362|consensus               45.5     8.1 0.00018   23.3   0.3   20   84-103   130-149 (156)
128 PF05191 ADK_lid:  Adenylate ki  45.4      24 0.00051   15.9   1.8   10   84-93     22-31  (36)
129 PF01363 FYVE:  FYVE zinc finge  45.3      11 0.00025   19.2   0.8   11   84-94     26-36  (69)
130 KOG2482|consensus               44.0      15 0.00032   25.7   1.3   24   25-48    195-218 (423)
131 cd00924 Cyt_c_Oxidase_Vb Cytoc  43.1      12 0.00025   21.1   0.6   14   24-37     78-91  (97)
132 PRK00564 hypA hydrogenase nick  41.8      19 0.00041   20.8   1.4   29   54-94     71-99  (117)
133 KOG4167|consensus               41.7     5.4 0.00012   30.5  -1.0   26   54-79    792-817 (907)
134 PF01155 HypA:  Hydrogenase exp  41.7     7.3 0.00016   22.4  -0.3   28   54-94     70-97  (113)
135 PLN02294 cytochrome c oxidase   41.6      13 0.00028   23.2   0.7   15   23-37    139-153 (174)
136 COG1655 Uncharacterized protei  41.6     3.6 7.8E-05   26.9  -1.7   10   84-93     63-72  (267)
137 KOG3408|consensus               40.6      23 0.00051   20.8   1.6   26   21-46     53-78  (129)
138 PF15269 zf-C2H2_7:  Zinc-finge  40.4      23 0.00049   16.9   1.3   21   55-75     21-41  (54)
139 COG3677 Transposase and inacti  40.3      18 0.00038   21.4   1.2   17   84-100    54-70  (129)
140 PF13451 zf-trcl:  Probable zin  39.9      11 0.00024   18.3   0.2   15   84-98      5-19  (49)
141 PF04423 Rad50_zn_hook:  Rad50   39.5      11 0.00024   18.4   0.2   11   85-95     22-32  (54)
142 COG1998 RPS31 Ribosomal protei  38.8      13 0.00029   18.1   0.4    9   84-92     38-46  (51)
143 PRK09678 DNA-binding transcrip  38.7      12 0.00025   19.9   0.2    8   27-34      3-10  (72)
144 PF10013 DUF2256:  Uncharacteri  38.6      16 0.00035   17.2   0.6   11   84-94      9-19  (42)
145 COG1571 Predicted DNA-binding   38.5      24 0.00052   25.3   1.7   13   54-66    367-379 (421)
146 PF14311 DUF4379:  Domain of un  37.5      36 0.00078   16.6   1.9   12   55-66     29-40  (55)
147 smart00064 FYVE Protein presen  36.4      30 0.00064   17.5   1.5   10   27-36     12-21  (68)
148 COG1675 TFA1 Transcription ini  35.9      63  0.0014   20.3   3.1   33   52-94    111-143 (176)
149 TIGR03829 YokU_near_AblA uncha  35.9      19 0.00041   19.9   0.8   17   80-96     32-48  (89)
150 COG1773 Rubredoxin [Energy pro  35.9      20 0.00043   17.9   0.8   13   54-66      3-15  (55)
151 cd00065 FYVE FYVE domain; Zinc  35.8      36 0.00078   16.4   1.8    9   28-36      5-13  (57)
152 PRK12496 hypothetical protein;  35.0      29 0.00064   21.4   1.6   12   25-36    127-138 (164)
153 PF04216 FdhE:  Protein involve  34.8       4 8.7E-05   27.4  -2.4    9   26-34    173-181 (290)
154 PF06397 Desulfoferrod_N:  Desu  34.8      15 0.00032   16.6   0.2   13   84-96      7-19  (36)
155 smart00731 SprT SprT homologue  34.0      25 0.00054   21.0   1.2   10   84-93    134-143 (146)
156 PF07282 OrfB_Zn_ribbon:  Putat  34.0      33 0.00071   17.4   1.5   15   52-66     44-58  (69)
157 COG4391 Uncharacterized protei  33.3      19 0.00041   18.4   0.4   11   84-94     49-59  (62)
158 KOG2071|consensus               33.3      31 0.00067   25.8   1.7   28   52-79    416-443 (579)
159 TIGR00143 hypF [NiFe] hydrogen  33.0     2.3   5E-05   32.3  -4.1   60   27-94     92-151 (711)
160 PF10537 WAC_Acf1_DNA_bd:  ATP-  32.8      78  0.0017   17.9   2.9   38   24-63      2-39  (102)
161 TIGR00515 accD acetyl-CoA carb  32.6      26 0.00057   23.7   1.2   32   26-67     27-58  (285)
162 PRK04351 hypothetical protein;  32.5      19 0.00042   21.9   0.5   34   54-96    112-145 (149)
163 KOG2636|consensus               32.3      37  0.0008   24.7   1.8   27   20-46    396-423 (497)
164 PF02591 DUF164:  Putative zinc  32.1      59  0.0013   15.9   2.2   13   78-91     42-54  (56)
165 PF06220 zf-U1:  U1 zinc finger  32.0      24 0.00052   16.0   0.7   11   84-94      4-14  (38)
166 PF14255 Cys_rich_CPXG:  Cystei  31.7      26 0.00055   17.3   0.8   13   84-96      1-13  (52)
167 COG4888 Uncharacterized Zn rib  31.2     7.9 0.00017   21.9  -1.2   15   22-36     19-33  (104)
168 PF08274 PhnA_Zn_Ribbon:  PhnA   30.6      28 0.00061   15.0   0.7    8   54-61     19-26  (30)
169 PF14369 zf-RING_3:  zinc-finge  30.1      27 0.00059   15.5   0.7   10   85-94     23-32  (35)
170 COG4306 Uncharacterized protei  29.9      18  0.0004   21.3   0.1   14   53-66     67-80  (160)
171 PRK05452 anaerobic nitric oxid  29.5      15 0.00031   26.8  -0.4   15   52-66    423-437 (479)
172 PF11672 DUF3268:  Protein of u  29.4      21 0.00045   20.3   0.2   11   24-34      1-11  (102)
173 cd00730 rubredoxin Rubredoxin;  29.2      30 0.00065   16.8   0.8   15   84-98      2-16  (50)
174 COG2331 Uncharacterized protei  28.9      19 0.00041   19.3   0.0   32   54-93     12-43  (82)
175 PRK04023 DNA polymerase II lar  28.6      59  0.0013   26.3   2.5   10   25-34    626-635 (1121)
176 PRK11823 DNA repair protein Ra  28.4      54  0.0012   23.7   2.2   13   23-35      5-17  (446)
177 PF00301 Rubredoxin:  Rubredoxi  28.4      26 0.00056   16.8   0.5   15   84-98      2-16  (47)
178 TIGR00416 sms DNA repair prote  28.3      54  0.0012   23.8   2.2   23   24-61      6-28  (454)
179 PF13824 zf-Mss51:  Zinc-finger  28.0      61  0.0013   16.2   1.7   14   52-65     12-25  (55)
180 KOG4173|consensus               27.6      41  0.0009   21.8   1.4   68   25-96     79-159 (253)
181 PRK00762 hypA hydrogenase nick  27.6      25 0.00053   20.6   0.4   34   54-94     70-103 (124)
182 PF04438 zf-HIT:  HIT zinc fing  27.4      20 0.00044   15.3  -0.0   13   84-96     14-26  (30)
183 PHA02998 RNA polymerase subuni  27.1      12 0.00026   23.5  -1.0   11   84-94    172-182 (195)
184 CHL00174 accD acetyl-CoA carbo  26.5      35 0.00076   23.3   1.0   14   54-67     57-70  (296)
185 TIGR00686 phnA alkylphosphonat  26.3      42 0.00092   19.3   1.1   13   54-66     19-31  (109)
186 cd00974 DSRD Desulforedoxin (D  26.3      36 0.00077   14.8   0.7   15   84-98      5-19  (34)
187 PF07295 DUF1451:  Protein of u  26.2      52  0.0011   20.0   1.6    8   85-92    132-139 (146)
188 PRK05978 hypothetical protein;  26.1      42 0.00091   20.5   1.2   13   84-96     53-65  (148)
189 KOG1842|consensus               26.1      39 0.00084   24.6   1.1   27   24-50     14-40  (505)
190 PRK14714 DNA polymerase II lar  26.0      62  0.0013   26.9   2.3   11   84-94    710-720 (1337)
191 TIGR00319 desulf_FeS4 desulfof  25.8      36 0.00077   14.8   0.7   14   84-97      8-21  (34)
192 KOG1280|consensus               25.5      75  0.0016   22.4   2.4   26   54-79     79-104 (381)
193 COG1594 RPB9 DNA-directed RNA   25.2      16 0.00034   21.1  -0.7   11   84-94    101-111 (113)
194 PF01927 Mut7-C:  Mut7-C RNAse   24.5      70  0.0015   19.2   2.0   47   26-72     92-142 (147)
195 PF14787 zf-CCHC_5:  GAG-polypr  24.0      41 0.00088   15.2   0.6   13   84-96      3-15  (36)
196 PF09855 DUF2082:  Nucleic-acid  24.0      43 0.00093   17.2   0.8    9   84-92      1-9   (64)
197 PF01780 Ribosomal_L37ae:  Ribo  23.8      27 0.00059   19.4   0.0   31   53-94     34-64  (90)
198 PF07503 zf-HYPF:  HypF finger;  23.7      11 0.00024   16.9  -1.2    6   56-61     23-28  (35)
199 PF03811 Zn_Tnp_IS1:  InsA N-te  23.3      83  0.0018   14.1   1.6   14   46-60     22-35  (36)
200 TIGR01562 FdhE formate dehydro  23.0      96  0.0021   21.4   2.5   10   25-34    184-193 (305)
201 PRK05654 acetyl-CoA carboxylas  22.5      47   0.001   22.6   1.0   31   27-67     29-59  (292)
202 PF01215 COX5B:  Cytochrome c o  22.4      32 0.00069   20.7   0.2   16   23-38    110-125 (136)
203 COG5151 SSL1 RNA polymerase II  22.3      75  0.0016   22.1   1.9   12   84-95    389-400 (421)
204 PF08209 Sgf11:  Sgf11 (transcr  22.0      37 0.00081   15.0   0.3   11   84-94      5-15  (33)
205 PF10071 DUF2310:  Zn-ribbon-co  22.0      44 0.00095   22.4   0.8   27   56-90    222-248 (258)
206 PF07975 C1_4:  TFIIH C1-like d  21.9      41 0.00088   16.5   0.5   15   84-98     22-36  (51)
207 PF01286 XPA_N:  XPA protein N-  21.6      38 0.00082   15.1   0.3   13   84-96      4-16  (34)
208 PTZ00043 cytochrome c oxidase   21.3      43 0.00093   22.1   0.6   17   22-38    178-194 (268)
209 TIGR01385 TFSII transcription   21.3      18  0.0004   24.6  -1.1   10   84-93    287-296 (299)
210 PF08792 A2L_zn_ribbon:  A2L zi  21.2      41 0.00088   14.8   0.3   10   84-93     22-31  (33)
211 COG0675 Transposase and inacti  21.0   1E+02  0.0022   20.6   2.4   16   52-67    320-335 (364)
212 smart00661 RPOL9 RNA polymeras  21.0      44 0.00094   15.8   0.5   12   84-95     21-32  (52)
213 cd01121 Sms Sms (bacterial rad  20.6      70  0.0015   22.6   1.6   10   24-33     13-22  (372)
214 PF02891 zf-MIZ:  MIZ/SP-RING z  20.5      53  0.0011   15.8   0.7    8   84-91     42-49  (50)
215 TIGR00280 L37a ribosomal prote  20.4      44 0.00095   18.6   0.4   31   53-94     34-64  (91)
216 PF02748 PyrI_C:  Aspartate car  20.2      40 0.00086   16.5   0.2   16   21-36     31-46  (52)

No 1  
>KOG2462|consensus
Probab=99.85  E-value=2.8e-22  Score=127.61  Aligned_cols=91  Identities=20%  Similarity=0.302  Sum_probs=79.8

Q ss_pred             cCCCCccccCCCCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCC
Q psy7447          10 FNLPPHTLFNPLLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQ   89 (114)
Q Consensus        10 ~~l~~h~~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C   89 (114)
                      -.|+.|+++ |+  -+..|.+||+.|..++-|+.|+++|+| +|||.|..|+++|...++|+.|+++|.+.|+ |.|..|
T Consensus       175 pALkMHirT-H~--l~c~C~iCGKaFSRPWLLQGHiRTHTG-EKPF~C~hC~kAFADRSNLRAHmQTHS~~K~-~qC~~C  249 (279)
T KOG2462|consen  175 PALKMHIRT-HT--LPCECGICGKAFSRPWLLQGHIRTHTG-EKPFSCPHCGKAFADRSNLRAHMQTHSDVKK-HQCPRC  249 (279)
T ss_pred             HHHhhHhhc-cC--CCcccccccccccchHHhhcccccccC-CCCccCCcccchhcchHHHHHHHHhhcCCcc-ccCcch
Confidence            356788888 75  688999999999999999999999999 9999999999999999999999999999998 999999


Q ss_pred             CcccccccccCCCccc
Q psy7447          90 GPEMLSIKHQGPETLS  105 (114)
Q Consensus        90 ~~~f~~~~~~~~~~~~  105 (114)
                      ++.|.-.+=...|..+
T Consensus       250 ~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  250 GKSFALKSYLNKHSES  265 (279)
T ss_pred             hhHHHHHHHHHHhhhh
Confidence            9999855444444433


No 2  
>KOG2462|consensus
Probab=99.78  E-value=5.7e-20  Score=117.16  Aligned_cols=96  Identities=19%  Similarity=0.213  Sum_probs=82.8

Q ss_pred             ccCccCCCCccccCC---CCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCC
Q psy7447           6 RFSEFNLPPHTLFNP---LLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPE   82 (114)
Q Consensus         6 ~~~~~~l~~h~~~~h---~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p   82 (114)
                      ..+.++|..|.-+ |   ...+.+.|.+|++.+..-..|..|+++|+.   +++|.+||+.|.+..-|+.|+|+||||||
T Consensus       140 ysT~snLsrHkQ~-H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l---~c~C~iCGKaFSRPWLLQGHiRTHTGEKP  215 (279)
T KOG2462|consen  140 YSTSSNLSRHKQT-HRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTL---PCECGICGKAFSRPWLLQGHIRTHTGEKP  215 (279)
T ss_pred             cccccccchhhcc-cccccccccccCCCCCceeeehHHHhhHhhccCC---CcccccccccccchHHhhcccccccCCCC
Confidence            3456677777655 4   335778999999999999999999999954   78999999999999999999999999999


Q ss_pred             cccccCCCcccccccccCCCcccc
Q psy7447          83 MLSVKHQGPEMLSIKHQGPETLSI  106 (114)
Q Consensus        83 ~~~C~~C~~~f~~~~~~~~~~~~~  106 (114)
                       |.|..|++.|++.++..+|+..+
T Consensus       216 -F~C~hC~kAFADRSNLRAHmQTH  238 (279)
T KOG2462|consen  216 -FSCPHCGKAFADRSNLRAHMQTH  238 (279)
T ss_pred             -ccCCcccchhcchHHHHHHHHhh
Confidence             99999999999998877776654


No 3  
>KOG3623|consensus
Probab=99.58  E-value=7.6e-16  Score=109.08  Aligned_cols=81  Identities=23%  Similarity=0.354  Sum_probs=73.3

Q ss_pred             CCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccccccccC
Q psy7447          21 LLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSIKHQG  100 (114)
Q Consensus        21 ~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~~~~~  100 (114)
                      +.+..|.|..|.+.|...++|.+|.-.|+| .+||+|.+|.++|..+.+|..|+|+|.|+|| |.|++|++.|.-...+.
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsG-qRPyqC~iCkKAFKHKHHLtEHkRLHSGEKP-fQCdKClKRFSHSGSYS  967 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSG-QRPYQCIICKKAFKHKHHLTEHKRLHSGEKP-FQCDKCLKRFSHSGSYS  967 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcC-CCCcccchhhHhhhhhhhhhhhhhhccCCCc-chhhhhhhhcccccchH
Confidence            456789999999999999999999999999 9999999999999999999999999999999 99999999998654444


Q ss_pred             CCc
Q psy7447         101 PET  103 (114)
Q Consensus       101 ~~~  103 (114)
                      .|+
T Consensus       968 QHM  970 (1007)
T KOG3623|consen  968 QHM  970 (1007)
T ss_pred             hhh
Confidence            443


No 4  
>KOG3623|consensus
Probab=99.51  E-value=3.1e-15  Score=106.04  Aligned_cols=93  Identities=19%  Similarity=0.290  Sum_probs=79.0

Q ss_pred             CCCccccCC-CCCCceecCcchhhcCCchHHHHHHHHhcCC------------CCCeeCCCCCcccCCchHHHHHHHHhc
Q psy7447          12 LPPHTLFNP-LLQFRYTCDSCGKVYKLKRSLYRHRTLECGK------------EPRYQCPHCPYRGKQKVHLKTHVAIKH   78 (114)
Q Consensus        12 l~~h~~~~h-~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~------------~k~~~C~~c~~~~~~~~~l~~h~~~~~   78 (114)
                      |+.|++..| ..+..|.|..|..+|.....|.+|+..|...            .+.|.|.+|+++|..+.+|..|+|+|.
T Consensus       226 lkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHS  305 (1007)
T KOG3623|consen  226 LKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHS  305 (1007)
T ss_pred             HHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeec
Confidence            466776655 3456789999999999999999999998532            467899999999999999999999999


Q ss_pred             CCCCcccccCCCcccccccccCCCccc
Q psy7447          79 QGPEMLSVKHQGPEMLSIKHQGPETLS  105 (114)
Q Consensus        79 ~~~p~~~C~~C~~~f~~~~~~~~~~~~  105 (114)
                      |+|| |.|+.|++.|.-...+..|+.+
T Consensus       306 GEKP-feCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  306 GEKP-FECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             CCCC-cCCcccccccccCCcccccccc
Confidence            9999 9999999999876556666654


No 5  
>KOG1074|consensus
Probab=99.43  E-value=2.4e-14  Score=102.74  Aligned_cols=49  Identities=14%  Similarity=0.083  Sum_probs=26.2

Q ss_pred             eCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccccccccCCCccc
Q psy7447          56 QCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSIKHQGPETLS  105 (114)
Q Consensus        56 ~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~~~~~~~~~~  105 (114)
                      +|.+|.+...-.++|+.|.|+|+||+| |+|.+||+.|..+-+...|+.-
T Consensus       607 qCiiC~rVlSC~saLqmHyrtHtGERP-FkCKiCgRAFtTkGNLkaH~~v  655 (958)
T KOG1074|consen  607 QCIICLRVLSCPSALQMHYRTHTGERP-FKCKICGRAFTTKGNLKAHMSV  655 (958)
T ss_pred             ceeeeeecccchhhhhhhhhcccCcCc-cccccccchhccccchhhcccc
Confidence            455555555555555555555555555 5555555555554444444433


No 6  
>KOG3576|consensus
Probab=99.34  E-value=8.8e-14  Score=85.84  Aligned_cols=76  Identities=22%  Similarity=0.274  Sum_probs=64.7

Q ss_pred             CCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccccccc
Q psy7447          21 LLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSIKH   98 (114)
Q Consensus        21 ~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~~~   98 (114)
                      +..-.+.|.+|++.|....-|.+|++-|.. .+.+.|..||+.|...-.|.+|.++|+|-+| |+|..|++.|+..-.
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch~~-vkr~lct~cgkgfndtfdlkrh~rthtgvrp-ykc~~c~kaftqrcs  188 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCHSD-VKRHLCTFCGKGFNDTFDLKRHTRTHTGVRP-YKCSLCEKAFTQRCS  188 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhccH-HHHHHHhhccCcccchhhhhhhhccccCccc-cchhhhhHHHHhhcc
Confidence            334567899999999888888899998888 8888999999999998899999999999888 999999998886543


No 7  
>KOG3576|consensus
Probab=99.29  E-value=2.8e-13  Score=83.67  Aligned_cols=81  Identities=23%  Similarity=0.275  Sum_probs=72.1

Q ss_pred             CCCccccCCCCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCC-----------
Q psy7447          12 LPPHTLFNPLLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQG-----------   80 (114)
Q Consensus        12 l~~h~~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~-----------   80 (114)
                      |..|++. |..-|.+.|.-||+.|.....|.+|+++|+| .+||.|..|+++|.+...|..|.+..+|.           
T Consensus       133 lnrh~kc-h~~vkr~lct~cgkgfndtfdlkrh~rthtg-vrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~  210 (267)
T KOG3576|consen  133 LNRHLKC-HSDVKRHLCTFCGKGFNDTFDLKRHTRTHTG-VRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRA  210 (267)
T ss_pred             HHHHhhh-ccHHHHHHHhhccCcccchhhhhhhhccccC-ccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhh
Confidence            4678888 9889999999999999999999999999999 99999999999999999999999887773           


Q ss_pred             CCcccccCCCccccc
Q psy7447          81 PEMLSVKHQGPEMLS   95 (114)
Q Consensus        81 ~p~~~C~~C~~~f~~   95 (114)
                      +- |.|..||..-..
T Consensus       211 kl-~vcedcg~t~~~  224 (267)
T KOG3576|consen  211 KL-YVCEDCGYTSER  224 (267)
T ss_pred             he-eeecccCCCCCC
Confidence            34 899999975443


No 8  
>KOG3608|consensus
Probab=99.06  E-value=1.9e-11  Score=81.07  Aligned_cols=98  Identities=16%  Similarity=0.308  Sum_probs=71.4

Q ss_pred             cCccCCCCccccCCCCCCceecCcchhhcCCchHHHHHHHHhcCC---------------------------CCCeeCCC
Q psy7447           7 FSEFNLPPHTLFNPLLQFRYTCDSCGKVYKLKRSLYRHRTLECGK---------------------------EPRYQCPH   59 (114)
Q Consensus         7 ~~~~~l~~h~~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~---------------------------~k~~~C~~   59 (114)
                      -++..|+.|+++ |+++|...|..||..|.....|..|.+..+.-                           ..-|.|+.
T Consensus       190 ~~k~~LreH~r~-Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCpl  268 (467)
T KOG3608|consen  190 GNKYRLREHIRT-HSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPL  268 (467)
T ss_pred             ccHHHHHHHHHh-cCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccc
Confidence            456778889998 99988777777777776666666665543211                           34567888


Q ss_pred             CCcccCCchHHHHHHHHhcCCCCcccccCCCcccccccccCCCccc
Q psy7447          60 CPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSIKHQGPETLS  105 (114)
Q Consensus        60 c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~~~~~~~~~~  105 (114)
                      |.......+.|..|++.-+...+||+|+.|+..+........|...
T Consensus       269 Cdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~  314 (467)
T KOG3608|consen  269 CDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQV  314 (467)
T ss_pred             cccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHh
Confidence            8888888999999999776655559999999998877765555443


No 9  
>KOG1074|consensus
Probab=99.06  E-value=2.3e-11  Score=87.80  Aligned_cols=69  Identities=23%  Similarity=0.430  Sum_probs=45.1

Q ss_pred             ccCCCCccccCCCCCCceecCcchhhcCCchHHHHHHHHhcCC---CCCeeCC---CCCcccCCchHHHHHHHHhc
Q psy7447           9 EFNLPPHTLFNPLLQFRYTCDSCGKVYKLKRSLYRHRTLECGK---EPRYQCP---HCPYRGKQKVHLKTHVAIKH   78 (114)
Q Consensus         9 ~~~l~~h~~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~---~k~~~C~---~c~~~~~~~~~l~~h~~~~~   78 (114)
                      +++|+.|+++ |+|++||+|.+||+.|..+.+|+.|+..|...   ...+.|+   +|-+.|...-.+..|+++|.
T Consensus       618 ~saLqmHyrt-HtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lpQhIriH~  692 (958)
T KOG1074|consen  618 PSALQMHYRT-HTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLPQHIRIHL  692 (958)
T ss_pred             hhhhhhhhhc-ccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccccceEEeec
Confidence            3556677777 77777777777777777777777776666541   1234566   66666776666777777665


No 10 
>KOG3608|consensus
Probab=98.99  E-value=1.9e-10  Score=76.42  Aligned_cols=89  Identities=19%  Similarity=0.323  Sum_probs=76.9

Q ss_pred             ccCccCCCCccccCCCCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCC--CCcccCCchHHHHHHHHhc-CCCC
Q psy7447           6 RFSEFNLPPHTLFNPLLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPH--CPYRGKQKVHLKTHVAIKH-QGPE   82 (114)
Q Consensus         6 ~~~~~~l~~h~~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~--c~~~~~~~~~l~~h~~~~~-~~~p   82 (114)
                      +...++|..|++..|+..|||+|..|.+.+...+.|.+|...|+  +..|.|.-  |..++.+...+..|.+-++ |..|
T Consensus       273 c~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS--~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np  350 (467)
T KOG3608|consen  273 CSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS--KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNP  350 (467)
T ss_pred             CCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc--ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCC
Confidence            45678899999999999999999999999999999999999887  56789976  9999999999999988776 5443


Q ss_pred             -cccccCCCcccccc
Q psy7447          83 -MLSVKHQGPEMLSI   96 (114)
Q Consensus        83 -~~~C~~C~~~f~~~   96 (114)
                       +|.|-.|++-|.+=
T Consensus       351 ~~Y~CH~Cdr~ft~G  365 (467)
T KOG3608|consen  351 ILYACHCCDRFFTSG  365 (467)
T ss_pred             Cceeeecchhhhccc
Confidence             49999999988754


No 11 
>PHA02768 hypothetical protein; Provisional
Probab=98.93  E-value=8.8e-10  Score=54.77  Aligned_cols=39  Identities=21%  Similarity=0.343  Sum_probs=31.0

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLS   95 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~   95 (114)
                      .|+|+.||+.|...++|..|+++|+  ++ +.|..|++.|..
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~-~kc~~C~k~f~~   43 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TN-LKLSNCKRISLR   43 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--Cc-ccCCcccceecc
Confidence            4678888888888888888888887  45 888888887763


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.86  E-value=1.7e-09  Score=46.15  Aligned_cols=25  Identities=12%  Similarity=0.163  Sum_probs=19.5

Q ss_pred             HHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          69 HLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        69 ~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      +|..|+++|+|++| |.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~-~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKP-YKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSS-EEESSSSEEES
T ss_pred             CHHHHhhhcCCCCC-CCCCCCcCeeC
Confidence            46778888888887 88888888775


No 13 
>PHA00733 hypothetical protein
Probab=98.86  E-value=1.1e-09  Score=64.24  Aligned_cols=74  Identities=18%  Similarity=0.118  Sum_probs=54.7

Q ss_pred             CCCCceecCcchhhcCCchHHHHH--H---HHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccccc
Q psy7447          21 LLQFRYTCDSCGKVYKLKRSLYRH--R---TLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLS   95 (114)
Q Consensus        21 ~~~k~~~C~~C~~~f~~~~~l~~h--~---~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~   95 (114)
                      +.++++.|.+|...|..+..|..+  .   ..+.+ .++|.|..|++.|.....|..|++.+  +.+ |.|..|++.|..
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~-~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~-~~C~~CgK~F~~  111 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKA-VSPYVCPLCLMPFSSSVSLKQHIRYT--EHS-KVCPVCGKEFRN  111 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCC-CCCccCCCCCCcCCCHHHHHHHHhcC--CcC-ccCCCCCCccCC
Confidence            346788899988887766555444  1   12234 67899999999999999999998875  345 899999999886


Q ss_pred             ccc
Q psy7447          96 IKH   98 (114)
Q Consensus        96 ~~~   98 (114)
                      ...
T Consensus       112 ~~s  114 (128)
T PHA00733        112 TDS  114 (128)
T ss_pred             HHH
Confidence            544


No 14 
>PHA00733 hypothetical protein
Probab=98.84  E-value=4.4e-09  Score=61.75  Aligned_cols=63  Identities=24%  Similarity=0.258  Sum_probs=52.5

Q ss_pred             CCCccccCCCCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcC
Q psy7447          12 LPPHTLFNPLLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        12 l~~h~~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~   79 (114)
                      |..|+..  .+.+||.|..|++.|.....|..|++.+   ..++.|..|++.|.....|..|+...++
T Consensus        62 l~~~~~~--~~~kPy~C~~Cgk~Fss~s~L~~H~r~h---~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         62 LYKLLTS--KAVSPYVCPLCLMPFSSSVSLKQHIRYT---EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             HHhhccc--CCCCCccCCCCCCcCCCHHHHHHHHhcC---CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            3444333  3579999999999999999999999876   3468999999999999999999887765


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.84  E-value=1.8e-09  Score=53.68  Aligned_cols=42  Identities=19%  Similarity=0.461  Sum_probs=37.6

Q ss_pred             eecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHH
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHL   70 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l   70 (114)
                      |.|..||+.|...+.|..|++.|.   +++.|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~---k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN---TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC---CcccCCcccceeccccee
Confidence            689999999999999999999995   578899999999877655


No 16 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.68  E-value=1.3e-08  Score=72.24  Aligned_cols=66  Identities=18%  Similarity=0.318  Sum_probs=30.3

Q ss_pred             CceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCC----------chHHHHHHHHhcCCCCcccccCCCccc
Q psy7447          24 FRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQ----------KVHLKTHVAIKHQGPEMLSVKHQGPEM   93 (114)
Q Consensus        24 k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~----------~~~l~~h~~~~~~~~p~~~C~~C~~~f   93 (114)
                      +++.|. |+..+ ....|..|+..|.. .+++.|..|+..+..          ...|..|.... |.++ +.|..||+.+
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp-~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt-~~C~~Cgk~V  551 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCP-LRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRT-APCDSCGRSV  551 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCC-CCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcc-eEccccCCee
Confidence            444554 55332 33445555555544 455555555544421          12444444442 4444 5555555444


Q ss_pred             c
Q psy7447          94 L   94 (114)
Q Consensus        94 ~   94 (114)
                      +
T Consensus       552 r  552 (567)
T PLN03086        552 M  552 (567)
T ss_pred             e
Confidence            4


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.58  E-value=6e-08  Score=41.32  Aligned_cols=25  Identities=36%  Similarity=0.639  Sum_probs=18.0

Q ss_pred             HHHHHHHHhcCCCCCeeCCCCCcccC
Q psy7447          40 SLYRHRTLECGKEPRYQCPHCPYRGK   65 (114)
Q Consensus        40 ~l~~h~~~h~~~~k~~~C~~c~~~~~   65 (114)
                      +|..|++.|++ ++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~-~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTG-EKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSS-SSSEEESSSSEEES
T ss_pred             CHHHHhhhcCC-CCCCCCCCCcCeeC
Confidence            35677777777 77777777777664


No 18 
>PHA00616 hypothetical protein
Probab=98.54  E-value=3.7e-08  Score=46.77  Aligned_cols=33  Identities=24%  Similarity=0.415  Sum_probs=19.8

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCccccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVK   87 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~   87 (114)
                      ||+|..||+.|...+.+..|++.++|+++ +.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~-~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNK-LTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCc-ccee
Confidence            35566666666666666666666666655 5554


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.47  E-value=3.1e-07  Score=65.37  Aligned_cols=67  Identities=18%  Similarity=0.354  Sum_probs=56.6

Q ss_pred             CCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          21 LLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        21 ~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ..++++.|..|++.|. ...+..|+..++   +++.|+ |+..+ ....|..|+..+.+.++ +.|.+|+..|.
T Consensus       449 el~~H~~C~~Cgk~f~-~s~LekH~~~~H---kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kp-i~C~fC~~~v~  515 (567)
T PLN03086        449 EAKNHVHCEKCGQAFQ-QGEMEKHMKVFH---EPLQCP-CGVVL-EKEQMVQHQASTCPLRL-ITCRFCGDMVQ  515 (567)
T ss_pred             ccccCccCCCCCCccc-hHHHHHHHHhcC---CCccCC-CCCCc-chhHHHhhhhccCCCCc-eeCCCCCCccc
Confidence            3456789999999996 577999999873   578999 99765 55889999999999988 99999999883


No 20 
>PHA00616 hypothetical protein
Probab=98.46  E-value=1e-07  Score=45.27  Aligned_cols=33  Identities=18%  Similarity=0.449  Sum_probs=30.8

Q ss_pred             ceecCcchhhcCCchHHHHHHHHhcCCCCCeeCC
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCP   58 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~   58 (114)
                      ||+|..||+.|...+.|..|++.|++ ++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg-~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHK-QNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcC-CCcccee
Confidence            68999999999999999999999999 8988875


No 21 
>PHA00732 hypothetical protein
Probab=98.29  E-value=6.8e-07  Score=48.17  Aligned_cols=45  Identities=22%  Similarity=0.388  Sum_probs=30.0

Q ss_pred             ceecCcchhhcCCchHHHHHHHH-hcCCCCCeeCCCCCcccCCchHHHHHHHH
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRTL-ECGKEPRYQCPHCPYRGKQKVHLKTHVAI   76 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~~-h~~~~k~~~C~~c~~~~~~~~~l~~h~~~   76 (114)
                      ||.|..|++.|.....|..|++. |.+    +.|+.|++.|.+   +..|...
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~----~~C~~CgKsF~~---l~~H~~~   46 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL----TKCPVCNKSYRR---LNQHFYS   46 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC----CccCCCCCEeCC---hhhhhcc
Confidence            46777787777777777777763 433    367777777763   5556543


No 22 
>PHA00732 hypothetical protein
Probab=98.11  E-value=1.9e-06  Score=46.40  Aligned_cols=40  Identities=18%  Similarity=0.329  Sum_probs=33.8

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSI   96 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~   96 (114)
                      ||.|..|++.|.....|..|++.++.  + +.|+.||+.|..+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~--~-~~C~~CgKsF~~l   40 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT--L-TKCPVCNKSYRRL   40 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC--C-CccCCCCCEeCCh
Confidence            57899999999999999999985332  3 7899999999865


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.89  E-value=9.6e-06  Score=33.21  Aligned_cols=22  Identities=41%  Similarity=0.798  Sum_probs=10.9

Q ss_pred             eecCcchhhcCCchHHHHHHHH
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTL   47 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~   47 (114)
                      |.|..|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            3455555555555555555443


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.85  E-value=4.4e-05  Score=38.15  Aligned_cols=52  Identities=29%  Similarity=0.491  Sum_probs=37.1

Q ss_pred             ceecCcchhhcCCchHHHHHHH-HhcCCCCCeeCCCCCcccCCchHHHHHHHHhcC
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRT-LECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~-~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~   79 (114)
                      .|.|+.|++. .....|..|.. .|....+.+.|++|...+.  .+|..|+...++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            4789999994 44677888855 4554245789999987544  478888887654


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.81  E-value=1.9e-05  Score=32.30  Aligned_cols=23  Identities=35%  Similarity=0.645  Sum_probs=20.9

Q ss_pred             eeCCCCCcccCCchHHHHHHHHh
Q psy7447          55 YQCPHCPYRGKQKVHLKTHVAIK   77 (114)
Q Consensus        55 ~~C~~c~~~~~~~~~l~~h~~~~   77 (114)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            67999999999999999999874


No 26 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.48  E-value=0.00013  Score=29.67  Aligned_cols=22  Identities=32%  Similarity=0.625  Sum_probs=9.7

Q ss_pred             eCCCCCcccCCchHHHHHHHHh
Q psy7447          56 QCPHCPYRGKQKVHLKTHVAIK   77 (114)
Q Consensus        56 ~C~~c~~~~~~~~~l~~h~~~~   77 (114)
                      .|+.|+..|.....|..|+..+
T Consensus         2 ~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    2 QCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             E-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCcCCCCcCCcHHHHHHHHHhh
Confidence            4444555555555555554443


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.47  E-value=6.5e-05  Score=31.91  Aligned_cols=23  Identities=30%  Similarity=0.782  Sum_probs=12.1

Q ss_pred             eecCcchhhcCCchHHHHHHHHh
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTLE   48 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~h   48 (114)
                      |.|..|++.|.....|..|++.|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCccCCccCChhHHHHHhHHh
Confidence            45555555555555555555443


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.44  E-value=7.3e-05  Score=31.75  Aligned_cols=26  Identities=15%  Similarity=0.308  Sum_probs=22.6

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcC
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~   79 (114)
                      +++|..|++.|.....|..|++.|.+
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            57899999999999999999987653


No 29 
>KOG3993|consensus
Probab=97.38  E-value=9.3e-05  Score=50.97  Aligned_cols=56  Identities=21%  Similarity=0.501  Sum_probs=41.8

Q ss_pred             CceecCcchhhcCCchHHHHHHHHhcCC-------C-------------------------CCeeCCCCCcccCCchHHH
Q psy7447          24 FRYTCDSCGKVYKLKRSLYRHRTLECGK-------E-------------------------PRYQCPHCPYRGKQKVHLK   71 (114)
Q Consensus        24 k~~~C~~C~~~f~~~~~l~~h~~~h~~~-------~-------------------------k~~~C~~c~~~~~~~~~l~   71 (114)
                      --|+|.+|+|.|+-..+|..|.+=|.-.       .                         -.|.|..|++.|.++..|+
T Consensus       294 vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLr  373 (500)
T KOG3993|consen  294 VEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLR  373 (500)
T ss_pred             eeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHH
Confidence            4578999999999999998888766211       1                         1367888888888888888


Q ss_pred             HHHHHhcC
Q psy7447          72 THVAIKHQ   79 (114)
Q Consensus        72 ~h~~~~~~   79 (114)
                      .|+-+|+.
T Consensus       374 KHqlthq~  381 (500)
T KOG3993|consen  374 KHQLTHQR  381 (500)
T ss_pred             HhHHhhhc
Confidence            88777754


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.36  E-value=0.00019  Score=29.22  Aligned_cols=23  Identities=30%  Similarity=0.728  Sum_probs=19.2

Q ss_pred             eecCcchhhcCCchHHHHHHHHh
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTLE   48 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~h   48 (114)
                      |.|..|+..|.....|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999999875


No 31 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.29  E-value=8.3e-05  Score=49.55  Aligned_cols=66  Identities=14%  Similarity=0.145  Sum_probs=36.5

Q ss_pred             CCceecCc--chhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccccccccc
Q psy7447          23 QFRYTCDS--CGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSIKHQ   99 (114)
Q Consensus        23 ~k~~~C~~--C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~~~~   99 (114)
                      +|||.|++  |.+.++..-.|..|+..-.-..+..+-+       ..  . .+.-.....|| |.|.+|++.+-.+.|.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p-------~p--~-~~~~F~~~~KP-YrCevC~KRYKNlNGL  414 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENP-------SP--E-KMNIFSAKDKP-YRCEVCDKRYKNLNGL  414 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCC-------Cc--c-ccccccccCCc-eeccccchhhccCccc
Confidence            48899875  8888888888888866322101111111       00  0 00011223455 8888888887777663


No 32 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.27  E-value=0.00037  Score=33.99  Aligned_cols=31  Identities=29%  Similarity=0.488  Sum_probs=17.8

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCC
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPE   82 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p   82 (114)
                      +.|..|++|+..+.+.-+|.+|+.+.++.+|
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            5566777777777777777777777766655


No 33 
>PRK04860 hypothetical protein; Provisional
Probab=97.26  E-value=0.0003  Score=42.91  Aligned_cols=38  Identities=13%  Similarity=0.392  Sum_probs=31.7

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSI   96 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~   96 (114)
                      +|.|. |+.   ....+.+|.++++++++ |.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~-YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAV-YRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCcc-EECCCCCceeEEe
Confidence            58887 876   55667899999999998 9999999988754


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.20  E-value=0.00084  Score=32.77  Aligned_cols=44  Identities=20%  Similarity=0.215  Sum_probs=26.1

Q ss_pred             cCCCCccccCCCCCCceecCcchhhcCCchHHHHHHHHhcCCCCC
Q psy7447          10 FNLPPHTLFNPLLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPR   54 (114)
Q Consensus        10 ~~l~~h~~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~   54 (114)
                      .....+.+..+..+.|-.|.+|+..+....+|.+|+..+.+ .+|
T Consensus         9 ~~~~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~-~k~   52 (54)
T PF09237_consen    9 KPSTKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHF-KKP   52 (54)
T ss_dssp             SS-----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTT-TS-
T ss_pred             chhhhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhc-ccC
Confidence            33344555544556889999999999999999999988776 554


No 35 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.06  E-value=0.00069  Score=37.56  Aligned_cols=25  Identities=28%  Similarity=0.655  Sum_probs=20.1

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKH   78 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~   78 (114)
                      .+.|..|+..|.+...|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            5889999999999899999988654


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.84  E-value=0.0015  Score=26.81  Aligned_cols=20  Identities=40%  Similarity=0.675  Sum_probs=9.7

Q ss_pred             eCCCCCcccCCchHHHHHHH
Q psy7447          56 QCPHCPYRGKQKVHLKTHVA   75 (114)
Q Consensus        56 ~C~~c~~~~~~~~~l~~h~~   75 (114)
                      .|..|++.|.....+..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHH
Confidence            34445555555444544444


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.82  E-value=0.0012  Score=27.10  Aligned_cols=24  Identities=42%  Similarity=0.818  Sum_probs=21.2

Q ss_pred             eecCcchhhcCCchHHHHHHHHhc
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTLEC   49 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~h~   49 (114)
                      |.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            579999999999999999998664


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=96.70  E-value=0.002  Score=39.40  Aligned_cols=39  Identities=31%  Similarity=0.644  Sum_probs=33.3

Q ss_pred             CceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCc
Q psy7447          24 FRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQK   67 (114)
Q Consensus        24 k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~   67 (114)
                      -+|.|. |+.   ....+..|.+++.+ .++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g-~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRG-EAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcC-CccEECCCCCceeEEe
Confidence            479998 987   56778999999999 9999999999887654


No 39 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.65  E-value=0.0013  Score=44.12  Aligned_cols=25  Identities=32%  Similarity=0.568  Sum_probs=21.3

Q ss_pred             CCCeeCCC--CCcccCCchHHHHHHHH
Q psy7447          52 EPRYQCPH--CPYRGKQKVHLKTHVAI   76 (114)
Q Consensus        52 ~k~~~C~~--c~~~~~~~~~l~~h~~~   76 (114)
                      +|||.|++  |.+.+.+...|+.|+..
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lh  373 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLH  373 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhc
Confidence            68999986  88999999999988653


No 40 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=96.42  E-value=0.0058  Score=30.39  Aligned_cols=39  Identities=15%  Similarity=0.308  Sum_probs=29.5

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCC-CcccccCCCccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGP-EMLSVKHQGPEM   93 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~-p~~~C~~C~~~f   93 (114)
                      .|.|+.|++. .....|..|....+... ..+.|+.|...+
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~   41 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRV   41 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhh
Confidence            4789999994 55678999988776543 349999998743


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.28  E-value=0.0029  Score=26.09  Aligned_cols=21  Identities=33%  Similarity=0.727  Sum_probs=11.8

Q ss_pred             eecCcchhhcCCchHHHHHHH
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRT   46 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~   46 (114)
                      |.|..|+..|.....+..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            345555555555555555554


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.21  E-value=0.0053  Score=25.07  Aligned_cols=23  Identities=48%  Similarity=1.084  Sum_probs=11.9

Q ss_pred             eeCCCCCcccCCchHHHHHHHHhc
Q psy7447          55 YQCPHCPYRGKQKVHLKTHVAIKH   78 (114)
Q Consensus        55 ~~C~~c~~~~~~~~~l~~h~~~~~   78 (114)
                      |.|..|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            34566665555 556666665544


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.81  E-value=0.0062  Score=25.04  Aligned_cols=23  Identities=22%  Similarity=0.428  Sum_probs=19.2

Q ss_pred             eeCCCCCcccCCchHHHHHHHHh
Q psy7447          55 YQCPHCPYRGKQKVHLKTHVAIK   77 (114)
Q Consensus        55 ~~C~~c~~~~~~~~~l~~h~~~~   77 (114)
                      |.|.+|+..|.+...+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            57899999999999998887643


No 44 
>KOG3993|consensus
Probab=94.90  E-value=0.0048  Score=42.89  Aligned_cols=52  Identities=25%  Similarity=0.461  Sum_probs=43.8

Q ss_pred             ceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHh
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIK   77 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~   77 (114)
                      -|.|..|...|.....|.+|.-...- ...|.|++|++.|+-..+|..|.|=|
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV-~vEYrCPEC~KVFsCPANLASHRRWH  318 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIV-HVEYRCPECDKVFSCPANLASHRRWH  318 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeE-EeeecCCcccccccCchhhhhhhccc
Confidence            37899999888888888888765555 56799999999999999999998755


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.08  E-value=0.013  Score=24.73  Aligned_cols=21  Identities=29%  Similarity=0.743  Sum_probs=12.7

Q ss_pred             eecCcchhhcCCchHHHHHHH
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRT   46 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~   46 (114)
                      |.|..|++.|.....+..|+.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            456666666666666655544


No 46 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.07  E-value=0.056  Score=22.41  Aligned_cols=18  Identities=28%  Similarity=0.547  Sum_probs=8.0

Q ss_pred             eCCCCCcccCCchHHHHHH
Q psy7447          56 QCPHCPYRGKQKVHLKTHV   74 (114)
Q Consensus        56 ~C~~c~~~~~~~~~l~~h~   74 (114)
                      .|+.||+.| ....|..|.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            345555555 223344443


No 47 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.06  E-value=0.051  Score=24.11  Aligned_cols=24  Identities=25%  Similarity=0.466  Sum_probs=14.5

Q ss_pred             eeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCc
Q psy7447          55 YQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGP   91 (114)
Q Consensus        55 ~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~   91 (114)
                      |.|.+||..+....            .+ +.|+.||.
T Consensus         2 ~~C~~CGy~y~~~~------------~~-~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------AP-WVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CC-CcCcCCCC
Confidence            56777776554332            33 77777775


No 48 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.64  E-value=0.025  Score=38.87  Aligned_cols=63  Identities=21%  Similarity=0.337  Sum_probs=53.7

Q ss_pred             CceecCcchhhcCCchHHHHHHH--HhcCCC--CCeeCC--CCCcccCCchHHHHHHHHhcCCCCcccccC
Q psy7447          24 FRYTCDSCGKVYKLKRSLYRHRT--LECGKE--PRYQCP--HCPYRGKQKVHLKTHVAIKHQGPEMLSVKH   88 (114)
Q Consensus        24 k~~~C~~C~~~f~~~~~l~~h~~--~h~~~~--k~~~C~--~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~   88 (114)
                      .++.|..|...|.....+..|.+  .|.+ +  +++.|+  .|++.|.+...+..|...+++..+ ..+..
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~-~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~  356 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSG-ESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISP-AKEKL  356 (467)
T ss_pred             cCCCCccccCCcccccccccccccccccc-ccCCceeeeccCCCccccccccccCCcccccCCCc-ccccc
Confidence            46788999999999999999999  7888 7  899998  799999999999999999988776 55554


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=92.32  E-value=0.12  Score=22.89  Aligned_cols=22  Identities=18%  Similarity=0.409  Sum_probs=12.8

Q ss_pred             ceecCcchhhcCCchHHHHHHH
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRT   46 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~   46 (114)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4556666666665555555544


No 50 
>KOG1146|consensus
Probab=91.28  E-value=0.17  Score=40.25  Aligned_cols=64  Identities=25%  Similarity=0.450  Sum_probs=50.5

Q ss_pred             CCCCccccCCCCCCceecCcchhhcCCchHHHHHHHHh-------------------------cCCCCCeeCCCCCcccC
Q psy7447          11 NLPPHTLFNPLLQFRYTCDSCGKVYKLKRSLYRHRTLE-------------------------CGKEPRYQCPHCPYRGK   65 (114)
Q Consensus        11 ~l~~h~~~~h~~~k~~~C~~C~~~f~~~~~l~~h~~~h-------------------------~~~~k~~~C~~c~~~~~   65 (114)
                      .+-.++...++..+.+.|..|+..++....|..||+.-                         .+ .++|.|..|..++.
T Consensus       451 ~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~-~~p~~C~~C~~stt  529 (1406)
T KOG1146|consen  451 SLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCP-GKPYPCRACNYSTT  529 (1406)
T ss_pred             ccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCC-CCcccceeeeeeee
Confidence            33456666678889999999999999999999999971                         11 57788888888888


Q ss_pred             CchHHHHHHH
Q psy7447          66 QKVHLKTHVA   75 (114)
Q Consensus        66 ~~~~l~~h~~   75 (114)
                      ...+|.+|+.
T Consensus       530 tng~Lsihlq  539 (1406)
T KOG1146|consen  530 TNGNLSIHLQ  539 (1406)
T ss_pred             cchHHHHHHH
Confidence            8788887765


No 51 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=90.00  E-value=0.28  Score=26.84  Aligned_cols=26  Identities=19%  Similarity=0.537  Sum_probs=22.2

Q ss_pred             ceecCcchhhcCCchHHHHHHHHhcC
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRTLECG   50 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~~h~~   50 (114)
                      .+.|..|++.|.....|..|++.+..
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~H   75 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKHH   75 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCccC
Confidence            68999999999999999999997543


No 52 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.11  E-value=0.39  Score=21.84  Aligned_cols=10  Identities=10%  Similarity=0.149  Sum_probs=5.3

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      ..|..|+..|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            4555555544


No 53 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=88.43  E-value=0.9  Score=26.95  Aligned_cols=60  Identities=15%  Similarity=0.105  Sum_probs=33.6

Q ss_pred             CCCCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccccccc
Q psy7447          21 LLQFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSIK   97 (114)
Q Consensus        21 ~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~~   97 (114)
                      ...+-|+|.+|..+......           -||-+|  ||...-..-  -.....+....|  .|+.|..+|.+.+
T Consensus        76 ~d~~lYeCnIC~etS~ee~F-----------LKPneC--CgY~iCn~C--ya~LWK~~~~yp--vCPvCkTSFKss~  135 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERF-----------LKPNEC--CGYSICNAC--YANLWKFCNLYP--VCPVCKTSFKSSS  135 (140)
T ss_pred             cCCCceeccCcccccchhhc-----------CCcccc--cchHHHHHH--HHHHHHHcccCC--CCCcccccccccc
Confidence            44588999999877553322           344444  554322211  112222333445  8999999998654


No 54 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=88.28  E-value=0.45  Score=21.21  Aligned_cols=8  Identities=13%  Similarity=-0.039  Sum_probs=4.5

Q ss_pred             ccccCCCc
Q psy7447          84 LSVKHQGP   91 (114)
Q Consensus        84 ~~C~~C~~   91 (114)
                      ..|+.||.
T Consensus        19 ~~CP~Cg~   26 (34)
T cd00729          19 EKCPICGA   26 (34)
T ss_pred             CcCcCCCC
Confidence            55666654


No 55 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=88.09  E-value=0.33  Score=29.94  Aligned_cols=26  Identities=19%  Similarity=0.370  Sum_probs=18.8

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCc
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGP   91 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~   91 (114)
                      ++.|.|.+||..             +.| .+|-.|+.||-
T Consensus       132 ~~~~vC~vCGy~-------------~~g-e~P~~CPiCga  157 (166)
T COG1592         132 GKVWVCPVCGYT-------------HEG-EAPEVCPICGA  157 (166)
T ss_pred             CCEEEcCCCCCc-------------ccC-CCCCcCCCCCC
Confidence            346999999863             345 44599999994


No 56 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=87.81  E-value=0.47  Score=27.15  Aligned_cols=13  Identities=23%  Similarity=0.488  Sum_probs=5.8

Q ss_pred             CeeCCCCCcccCC
Q psy7447          54 RYQCPHCPYRGKQ   66 (114)
Q Consensus        54 ~~~C~~c~~~~~~   66 (114)
                      |..|+.||..|..
T Consensus        26 PivCP~CG~~~~~   38 (108)
T PF09538_consen   26 PIVCPKCGTEFPP   38 (108)
T ss_pred             CccCCCCCCccCc
Confidence            4444444444443


No 57 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=87.78  E-value=0.076  Score=34.05  Aligned_cols=13  Identities=15%  Similarity=0.095  Sum_probs=10.5

Q ss_pred             ccccCCCcccccc
Q psy7447          84 LSVKHQGPEMLSI   96 (114)
Q Consensus        84 ~~C~~C~~~f~~~   96 (114)
                      +.|+.||.+|...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            6899999888744


No 58 
>KOG4317|consensus
Probab=86.68  E-value=0.23  Score=33.60  Aligned_cols=30  Identities=17%  Similarity=0.102  Sum_probs=24.7

Q ss_pred             ccccCCCcccccccccCCCccccccccccC
Q psy7447          84 LSVKHQGPEMLSIKHQGPETLSIKHQFSQD  113 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~~~~~~~~~~~~~~~~  113 (114)
                      |.|+.|+..+.+++.+..|..++.+.+=.|
T Consensus        20 YtCPRCn~~YCsl~CYr~h~~~CsE~Fyrd   49 (383)
T KOG4317|consen   20 YTCPRCNLLYCSLKCYRNHKHSCSEKFYRD   49 (383)
T ss_pred             ccCCCCCccceeeeeecCCCccchHHHHHH
Confidence            899999999999999888888887765443


No 59 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.62  E-value=1.2  Score=27.19  Aligned_cols=33  Identities=12%  Similarity=0.165  Sum_probs=26.3

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ..-|.|+.|+..|+...++.         .. |.|+.||....
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~-F~Cp~Cg~~L~  139 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LN-FTCPRCGAMLD  139 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cC-CcCCCCCCEee
Confidence            56789999999888887774         13 99999997644


No 60 
>KOG2186|consensus
Probab=85.35  E-value=0.61  Score=30.67  Aligned_cols=50  Identities=20%  Similarity=0.418  Sum_probs=34.0

Q ss_pred             eecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcC
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~   79 (114)
                      |.|..||....-+ .+..|+..-.+  .-|.|..|+..|... ....|...-+-
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn--~~fSCIDC~k~F~~~-sYknH~kCITE   53 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN--AYFSCIDCGKTFERV-SYKNHTKCITE   53 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC--CeeEEeecccccccc-hhhhhhhhcch
Confidence            6789999887654 45667665443  458888999999884 44566554443


No 61 
>KOG2893|consensus
Probab=84.32  E-value=0.27  Score=32.08  Aligned_cols=45  Identities=18%  Similarity=0.427  Sum_probs=32.5

Q ss_pred             CCceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHH
Q psy7447          23 QFRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTH   73 (114)
Q Consensus        23 ~k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h   73 (114)
                      .|+| |=+|++.|.....|.+|++     .|.|.|-+|-+.+.+...|..|
T Consensus         9 ~kpw-cwycnrefddekiliqhqk-----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQK-----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhh-----hccceeeeehhhhccCCCceee
Confidence            4666 5688889988888888887     6678898888765554445444


No 62 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=83.91  E-value=1.1  Score=20.28  Aligned_cols=10  Identities=10%  Similarity=0.172  Sum_probs=4.8

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      ..|..|+..|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            4455554443


No 63 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=82.43  E-value=4.3  Score=23.42  Aligned_cols=71  Identities=13%  Similarity=-0.016  Sum_probs=36.8

Q ss_pred             CceecCcchhhcCCchHHHHHHH---HhcCC-CCC-------eeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcc
Q psy7447          24 FRYTCDSCGKVYKLKRSLYRHRT---LECGK-EPR-------YQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPE   92 (114)
Q Consensus        24 k~~~C~~C~~~f~~~~~l~~h~~---~h~~~-~k~-------~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~   92 (114)
                      -|..|..|+-+......|.+.--   ..... +.+       ..|-.|...|.......  ......... |.|+.|...
T Consensus        14 LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~--~~~~~~~~~-y~C~~C~~~   90 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSP--FDELKDSHR-YVCAVCKNV   90 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCccccc--ccccccccc-eeCCCCCCc
Confidence            46788889887776666654211   00000 111       13667777776532111  000111224 889999988


Q ss_pred             ccccc
Q psy7447          93 MLSIK   97 (114)
Q Consensus        93 f~~~~   97 (114)
                      |-..-
T Consensus        91 FC~dC   95 (112)
T TIGR00622        91 FCVDC   95 (112)
T ss_pred             ccccc
Confidence            87443


No 64 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=82.24  E-value=0.38  Score=26.31  Aligned_cols=31  Identities=19%  Similarity=0.354  Sum_probs=20.9

Q ss_pred             CCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          53 PRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        53 k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ..+.|+.|++.        ...+.-+|  - |.|..||..|+
T Consensus        34 ~~~~Cp~C~~~--------~VkR~a~G--I-W~C~kCg~~fA   64 (89)
T COG1997          34 AKHVCPFCGRT--------TVKRIATG--I-WKCRKCGAKFA   64 (89)
T ss_pred             cCCcCCCCCCc--------ceeeeccC--e-EEcCCCCCeec
Confidence            46789999863        12233333  3 89999999887


No 65 
>KOG2186|consensus
Probab=82.12  E-value=0.79  Score=30.15  Aligned_cols=39  Identities=15%  Similarity=0.255  Sum_probs=31.2

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLS   95 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~   95 (114)
                      -|.|.+||....-+ .+.+|+-..++ .- |.|.-|+..|-.
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn-~~-fSCIDC~k~F~~   41 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN-AY-FSCIDCGKTFER   41 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC-Ce-eEEeeccccccc
Confidence            36899999887764 46678887777 44 999999999986


No 66 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=81.59  E-value=1.1  Score=22.35  Aligned_cols=31  Identities=23%  Similarity=0.420  Sum_probs=22.3

Q ss_pred             CCCCCceecCcchhhcCCchHHHHHHHHhcC
Q psy7447          20 PLLQFRYTCDSCGKVYKLKRSLYRHRTLECG   50 (114)
Q Consensus        20 h~~~k~~~C~~C~~~f~~~~~l~~h~~~h~~   50 (114)
                      ..++.-+.|+.|+..|....++..|..-..+
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            4577778888888888877777777554333


No 67 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=81.00  E-value=2  Score=26.81  Aligned_cols=33  Identities=15%  Similarity=0.272  Sum_probs=25.2

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ..-|.|+.|+..|....++.         .. |.|+.||....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~-F~Cp~Cg~~L~  147 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YG-FRCPQCGEMLE  147 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cC-CcCCCCCCCCe
Confidence            46789999998888876653         23 99999997655


No 68 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=80.88  E-value=1.3  Score=19.94  Aligned_cols=10  Identities=10%  Similarity=0.046  Sum_probs=4.9

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4555555444


No 69 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=80.72  E-value=1.7  Score=20.63  Aligned_cols=11  Identities=18%  Similarity=0.386  Sum_probs=6.3

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      ..|+.||...+
T Consensus        20 irC~~CG~rIl   30 (44)
T smart00659       20 VRCRECGYRIL   30 (44)
T ss_pred             eECCCCCceEE
Confidence            56666665444


No 70 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=80.12  E-value=3.9  Score=24.61  Aligned_cols=38  Identities=16%  Similarity=0.331  Sum_probs=25.7

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ...|.|+.|+..|.....+.    ....... |.|+.||....
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~----~~d~~~~-f~Cp~Cg~~l~  134 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQ----LLDMDGT-FTCPRCGEELE  134 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHH----hcCCCCc-EECCCCCCEEE
Confidence            56789999998888654432    1112333 99999998664


No 71 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=79.55  E-value=1.2  Score=21.07  Aligned_cols=11  Identities=18%  Similarity=0.208  Sum_probs=6.4

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      ..|++||..+.
T Consensus        22 ~~Cp~CG~~~~   32 (46)
T PRK00398         22 VRCPYCGYRIL   32 (46)
T ss_pred             eECCCCCCeEE
Confidence            56666665444


No 72 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=78.41  E-value=0.27  Score=36.84  Aligned_cols=62  Identities=19%  Similarity=0.436  Sum_probs=40.2

Q ss_pred             ecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccccc
Q psy7447          27 TCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSI   96 (114)
Q Consensus        27 ~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~   96 (114)
                      .|..||-+|+....|-.-+..-+. ..--.|+.|.+.+....+.+.|.      +| ..|+.||....-.
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM-~~F~lC~~C~~EY~dP~nRRfHA------Qp-~aCp~CGP~~~l~  186 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSM-ADFPLCPFCDKEYKDPLNRRFHA------QP-IACPKCGPHLFLV  186 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCcc-ccCcCCHHHHHHhcCcccccccc------cc-ccCcccCCCeEEE
Confidence            588999998876655443332233 33447888888787776554332      24 8999999865533


No 73 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=77.86  E-value=0.89  Score=20.73  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=6.1

Q ss_pred             eeCCCCCcccCC
Q psy7447          55 YQCPHCPYRGKQ   66 (114)
Q Consensus        55 ~~C~~c~~~~~~   66 (114)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (41)
T smart00834        6 YRCEDCGHTFEV   17 (41)
T ss_pred             EEcCCCCCEEEE
Confidence            455555554443


No 74 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=77.03  E-value=1.6  Score=25.98  Aligned_cols=26  Identities=27%  Similarity=0.361  Sum_probs=15.5

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCC
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPE   82 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p   82 (114)
                      -..|-+||+.|..   |.+|.+.|+|.-|
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             eeEEccCCcccch---HHHHHHHccCCCH
Confidence            4578888888877   5788888877654


No 75 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=76.80  E-value=2.1  Score=25.20  Aligned_cols=30  Identities=10%  Similarity=0.047  Sum_probs=17.6

Q ss_pred             eecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCc
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQK   67 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~   67 (114)
                      ..|..||+.|--           .+ ..|..|+.||..|...
T Consensus        10 r~Cp~cg~kFYD-----------Ln-k~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYD-----------LN-RRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCccccc-----------cC-CCCccCCCcCCccCcc
Confidence            357777766531           12 4566777777766554


No 76 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=75.88  E-value=1.1  Score=21.75  Aligned_cols=12  Identities=33%  Similarity=0.750  Sum_probs=6.0

Q ss_pred             eeCCCCCcccCC
Q psy7447          55 YQCPHCPYRGKQ   66 (114)
Q Consensus        55 ~~C~~c~~~~~~   66 (114)
                      |.|..|+..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            455555554443


No 77 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=75.87  E-value=2.3  Score=21.55  Aligned_cols=34  Identities=15%  Similarity=0.271  Sum_probs=18.7

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCc
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGP   91 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~   91 (114)
                      ...|.|+.||+.-.....--   |  ....+ |.|+.||.
T Consensus        25 ~v~F~CPnCGe~~I~Rc~~C---R--k~g~~-Y~Cp~CGF   58 (61)
T COG2888          25 AVKFPCPNCGEVEIYRCAKC---R--KLGNP-YRCPKCGF   58 (61)
T ss_pred             eeEeeCCCCCceeeehhhhH---H--HcCCc-eECCCcCc
Confidence            44578888885444322111   1  12234 88888885


No 78 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=74.45  E-value=2.1  Score=20.84  Aligned_cols=11  Identities=36%  Similarity=1.123  Sum_probs=5.5

Q ss_pred             ceecCcchhhc
Q psy7447          25 RYTCDSCGKVY   35 (114)
Q Consensus        25 ~~~C~~C~~~f   35 (114)
                      .|.|..||+.+
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            34555555444


No 79 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=74.44  E-value=2.4  Score=18.68  Aligned_cols=11  Identities=18%  Similarity=0.377  Sum_probs=5.1

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      ..|+.||..-+
T Consensus        18 irC~~CG~RIl   28 (32)
T PF03604_consen   18 IRCPECGHRIL   28 (32)
T ss_dssp             SSBSSSS-SEE
T ss_pred             EECCcCCCeEE
Confidence            55555554433


No 80 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=74.11  E-value=6  Score=23.47  Aligned_cols=15  Identities=27%  Similarity=0.749  Sum_probs=9.2

Q ss_pred             ceecCcchhhcCCch
Q psy7447          25 RYTCDSCGKVYKLKR   39 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~   39 (114)
                      |.+|..||+.|...+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            456777777766543


No 81 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=73.91  E-value=3.5  Score=23.35  Aligned_cols=26  Identities=35%  Similarity=0.823  Sum_probs=22.2

Q ss_pred             CeeC----CCCCcccCCchHHHHHHHHhcC
Q psy7447          54 RYQC----PHCPYRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        54 ~~~C----~~c~~~~~~~~~l~~h~~~~~~   79 (114)
                      .|.|    ..|+....+...+..|++.++|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            4688    8899999999999999988775


No 82 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=73.60  E-value=1.7  Score=29.88  Aligned_cols=45  Identities=11%  Similarity=0.053  Sum_probs=38.8

Q ss_pred             CCeeCCCCCcccCCchHHHHHHH--HhcCC--CCccccc--CCCcccccccc
Q psy7447          53 PRYQCPHCPYRGKQKVHLKTHVA--IKHQG--PEMLSVK--HQGPEMLSIKH   98 (114)
Q Consensus        53 k~~~C~~c~~~~~~~~~l~~h~~--~~~~~--~p~~~C~--~C~~~f~~~~~   98 (114)
                      .++.|..|...|.....+..|.+  .|.++  ++ +.|+  .|+..|....-
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~-~~~p~~~~~~~~~~~~~  338 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKP-FSCPYSLCGKLFSRNDA  338 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCc-eeeeccCCCcccccccc
Confidence            46788899999999999999999  79998  77 9999  79998886553


No 83 
>PF14353 CpXC:  CpXC protein
Probab=73.08  E-value=4.1  Score=23.77  Aligned_cols=10  Identities=40%  Similarity=1.205  Sum_probs=5.4

Q ss_pred             ecCcchhhcC
Q psy7447          27 TCDSCGKVYK   36 (114)
Q Consensus        27 ~C~~C~~~f~   36 (114)
                      .|+.|+..|.
T Consensus         3 tCP~C~~~~~   12 (128)
T PF14353_consen    3 TCPHCGHEFE   12 (128)
T ss_pred             CCCCCCCeeE
Confidence            4666665543


No 84 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=72.42  E-value=2.1  Score=17.88  Aligned_cols=11  Identities=18%  Similarity=0.096  Sum_probs=7.2

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            46777777663


No 85 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=72.18  E-value=4.6  Score=16.73  Aligned_cols=19  Identities=26%  Similarity=0.567  Sum_probs=10.9

Q ss_pred             eCCCCCcccCCchHHHHHHH
Q psy7447          56 QCPHCPYRGKQKVHLKTHVA   75 (114)
Q Consensus        56 ~C~~c~~~~~~~~~l~~h~~   75 (114)
                      .|++|++.+ ....++.|..
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466776666 3345555554


No 86 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=70.54  E-value=3  Score=26.89  Aligned_cols=29  Identities=21%  Similarity=0.368  Sum_probs=21.9

Q ss_pred             CCCceecCcchhhcCCchHHHHHHHHhcC
Q psy7447          22 LQFRYTCDSCGKVYKLKRSLYRHRTLECG   50 (114)
Q Consensus        22 ~~k~~~C~~C~~~f~~~~~l~~h~~~h~~   50 (114)
                      .+..|.|..|+|.|.....+..|+..-+.
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            45679999999999999999999886543


No 87 
>KOG2231|consensus
Probab=69.06  E-value=1.2  Score=33.40  Aligned_cols=30  Identities=20%  Similarity=0.248  Sum_probs=15.7

Q ss_pred             eCCCCCcccCCchHHHHHHHHhcCCCCcccccCCC
Q psy7447          56 QCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQG   90 (114)
Q Consensus        56 ~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~   90 (114)
                      .|..|...|.....+..|++.++     |-|.+|+
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h-----~~chfC~  213 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH-----EFCHFCD  213 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce-----eheeecC
Confidence            45555555555555555555433     4455553


No 88 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=68.93  E-value=5.4  Score=20.20  Aligned_cols=32  Identities=16%  Similarity=0.211  Sum_probs=17.1

Q ss_pred             CCeeCCCCCcc-cCCchHHHHHHHHhcCCCCcccccCCCc
Q psy7447          53 PRYQCPHCPYR-GKQKVHLKTHVAIKHQGPEMLSVKHQGP   91 (114)
Q Consensus        53 k~~~C~~c~~~-~~~~~~l~~h~~~~~~~~p~~~C~~C~~   91 (114)
                      ..|.|+.||.. ..+-..-    |.  ...+ |.|+.||.
T Consensus        24 ~~F~CPnCG~~~I~RC~~C----Rk--~~~~-Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCEKC----RK--QSNP-YTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeechhH----Hh--cCCc-eECCCCCC
Confidence            45778888765 2222111    11  1133 88888875


No 89 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=67.87  E-value=1.9  Score=27.76  Aligned_cols=29  Identities=28%  Similarity=0.520  Sum_probs=22.6

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCC
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQG   80 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~   80 (114)
                      +..|.|..|++.|.-......|+..-|.+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            44689999999999999999999987765


No 90 
>KOG2593|consensus
Probab=66.27  E-value=6.6  Score=28.01  Aligned_cols=39  Identities=18%  Similarity=0.396  Sum_probs=27.4

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ...|.|+.|.+.|.....++    +...+.-.|.|..|+....
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~----L~~~~~~~F~C~~C~gelv  164 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQ----LLDNETGEFHCENCGGELV  164 (436)
T ss_pred             cccccCCccccchhhhHHHH----hhcccCceEEEecCCCchh
Confidence            56799999999998876553    3332222399999997654


No 91 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=64.47  E-value=3.5  Score=30.01  Aligned_cols=15  Identities=27%  Similarity=0.208  Sum_probs=9.1

Q ss_pred             ccccCCCcccccccc
Q psy7447          84 LSVKHQGPEMLSIKH   98 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~   98 (114)
                      ..|+.|+...+...+
T Consensus       254 ~~Cp~C~s~~l~~~g  268 (505)
T TIGR00595       254 KTCPQCGSEDLVYKG  268 (505)
T ss_pred             CCCCCCCCCeeEeec
Confidence            778888765444333


No 92 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=63.21  E-value=2.1  Score=32.60  Aligned_cols=23  Identities=30%  Similarity=0.397  Sum_probs=14.4

Q ss_pred             cccccCCCcccccccccCCCccccc
Q psy7447          83 MLSVKHQGPEMLSIKHQGPETLSIK  107 (114)
Q Consensus        83 ~~~C~~C~~~f~~~~~~~~~~~~~~  107 (114)
                      |..|+.||..  .+...|..+-.+.
T Consensus       475 p~~Cp~Cgs~--~L~~~G~Gterie  497 (730)
T COG1198         475 PQSCPECGSE--HLRAVGPGTERIE  497 (730)
T ss_pred             CCCCCCCCCC--eeEEecccHHHHH
Confidence            4899999986  4444455444433


No 93 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=60.95  E-value=11  Score=26.25  Aligned_cols=43  Identities=23%  Similarity=0.158  Sum_probs=27.6

Q ss_pred             ccCccCCCCccccCCCCC----CceecCcchhhcCCchHHHHHHHHhc
Q psy7447           6 RFSEFNLPPHTLFNPLLQ----FRYTCDSCGKVYKLKRSLYRHRTLEC   49 (114)
Q Consensus         6 ~~~~~~l~~h~~~~h~~~----k~~~C~~C~~~f~~~~~l~~h~~~h~   49 (114)
                      .|++..|+.|.-. ...+    ..-.|..|...|-....|..|++...
T Consensus       198 lF~~~~Lr~H~~~-G~~e~GFKGHP~C~FC~~~FYdDDEL~~HcR~~H  244 (493)
T COG5236         198 LFRSSTLRDHKNG-GLEEEGFKGHPLCIFCKIYFYDDDELRRHCRLRH  244 (493)
T ss_pred             eeecccccccccC-CccccCcCCCchhhhccceecChHHHHHHHHhhh
Confidence            3566666666544 2222    23368888888888888888888544


No 94 
>KOG2893|consensus
Probab=60.42  E-value=4.4  Score=26.67  Aligned_cols=42  Identities=17%  Similarity=0.184  Sum_probs=30.8

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccccccccc
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSIKHQ   99 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~~~~   99 (114)
                      .|+| |=.|++.|....-|..|++..+     |+|.+|-+...+-.+.
T Consensus         9 ~kpw-cwycnrefddekiliqhqkakh-----fkchichkkl~sgpgl   50 (341)
T KOG2893|consen    9 DKPW-CWYCNREFDDEKILIQHQKAKH-----FKCHICHKKLFSGPGL   50 (341)
T ss_pred             CCce-eeecccccchhhhhhhhhhhcc-----ceeeeehhhhccCCCc
Confidence            3454 5668899999888888887643     9999998766544443


No 95 
>KOG2785|consensus
Probab=60.33  E-value=17  Score=25.60  Aligned_cols=55  Identities=20%  Similarity=0.216  Sum_probs=40.2

Q ss_pred             ceecCcchhhcCCchHHHHHHHHhcCC----------------------CCCeeCCCCC---cccCCchHHHHHHHHhcC
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRTLECGK----------------------EPRYQCPHCP---YRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~~h~~~----------------------~k~~~C~~c~---~~~~~~~~l~~h~~~~~~   79 (114)
                      |-.|..|++.+.....-..||..++|.                      .+.+.|-.|+   +.|.+..+.+.|+.....
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K~H  245 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDKGH  245 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhccC
Confidence            457888998888777777788877654                      3445676777   888888888888875433


No 96 
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=60.27  E-value=3.7  Score=20.60  Aligned_cols=10  Identities=30%  Similarity=0.577  Sum_probs=4.7

Q ss_pred             ecCcchhhcC
Q psy7447          27 TCDSCGKVYK   36 (114)
Q Consensus        27 ~C~~C~~~f~   36 (114)
                      .|..|++.+.
T Consensus         4 kC~lCdk~~~   13 (56)
T PF09963_consen    4 KCILCDKKEE   13 (56)
T ss_pred             EEEecCCEEE
Confidence            3455554443


No 97 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=59.98  E-value=4.3  Score=16.61  Aligned_cols=7  Identities=14%  Similarity=0.344  Sum_probs=4.3

Q ss_pred             ccccCCC
Q psy7447          84 LSVKHQG   90 (114)
Q Consensus        84 ~~C~~C~   90 (114)
                      |.|+.||
T Consensus        17 f~CPnCG   23 (24)
T PF07754_consen   17 FPCPNCG   23 (24)
T ss_pred             EeCCCCC
Confidence            6666665


No 98 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=59.93  E-value=1.9  Score=26.35  Aligned_cols=11  Identities=36%  Similarity=0.945  Sum_probs=4.6

Q ss_pred             eecCcchhhcC
Q psy7447          26 YTCDSCGKVYK   36 (114)
Q Consensus        26 ~~C~~C~~~f~   36 (114)
                      ++|..||.+|.
T Consensus        29 ~~c~~c~~~f~   39 (154)
T PRK00464         29 RECLACGKRFT   39 (154)
T ss_pred             eeccccCCcce
Confidence            34444444443


No 99 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=59.73  E-value=8.4  Score=17.80  Aligned_cols=13  Identities=46%  Similarity=0.887  Sum_probs=5.0

Q ss_pred             CceecCcchhhcC
Q psy7447          24 FRYTCDSCGKVYK   36 (114)
Q Consensus        24 k~~~C~~C~~~f~   36 (114)
                      ....|..|++.+.
T Consensus        15 ~~a~C~~C~~~~~   27 (45)
T PF02892_consen   15 KKAKCKYCGKVIK   27 (45)
T ss_dssp             S-EEETTTTEE--
T ss_pred             CeEEeCCCCeEEe
Confidence            3345555554443


No 100
>KOG1146|consensus
Probab=58.72  E-value=0.87  Score=36.53  Aligned_cols=74  Identities=19%  Similarity=0.221  Sum_probs=46.3

Q ss_pred             CcchhhcCCchHHHHHHH-HhcCCCCCeeCCCCCcccCCchHHHHHHHHhcC-------------------------CCC
Q psy7447          29 DSCGKVYKLKRSLYRHRT-LECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQ-------------------------GPE   82 (114)
Q Consensus        29 ~~C~~~f~~~~~l~~h~~-~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~-------------------------~~p   82 (114)
                      ..++..+.....+..++. .+.- .+.+.|+.|+..|.....|-.|+|..+.                         .++
T Consensus       440 ~~~e~~~~s~r~~~~~t~~L~S~-~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p  518 (1406)
T KOG1146|consen  440 TKAEPLLESKRSLEGQTVVLHSF-FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKP  518 (1406)
T ss_pred             cchhhhhhhhcccccceeeeecc-cccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCc
Confidence            334444444443433333 2333 6788999999999999999999998221                         134


Q ss_pred             cccccCCCcccccccccCCCcc
Q psy7447          83 MLSVKHQGPEMLSIKHQGPETL  104 (114)
Q Consensus        83 ~~~C~~C~~~f~~~~~~~~~~~  104 (114)
                       |.|..|..++.....--.|..
T Consensus       519 -~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  519 -YPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             -ccceeeeeeeecchHHHHHHH
Confidence             888888887775433333333


No 101
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=56.83  E-value=4.5  Score=18.78  Aligned_cols=18  Identities=11%  Similarity=0.150  Sum_probs=13.8

Q ss_pred             ccccCCCcccccccccCC
Q psy7447          84 LSVKHQGPEMLSIKHQGP  101 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~~~~  101 (114)
                      |.|..||..|-.+.....
T Consensus         6 y~C~~Cg~~fe~~~~~~~   23 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISE   23 (42)
T ss_pred             EEeCCCCCEEEEEEEcCC
Confidence            899999998886655433


No 102
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=56.47  E-value=9.3  Score=21.20  Aligned_cols=14  Identities=14%  Similarity=0.543  Sum_probs=8.7

Q ss_pred             CCeeCCCCCcccCC
Q psy7447          53 PRYQCPHCPYRGKQ   66 (114)
Q Consensus        53 k~~~C~~c~~~~~~   66 (114)
                      +|..|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45566667666655


No 103
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=56.18  E-value=5.9  Score=18.27  Aligned_cols=14  Identities=29%  Similarity=0.335  Sum_probs=9.4

Q ss_pred             CcccccCCCccccc
Q psy7447          82 EMLSVKHQGPEMLS   95 (114)
Q Consensus        82 p~~~C~~C~~~f~~   95 (114)
                      |.+.|+.||..+.+
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            44678888776654


No 104
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=54.62  E-value=6.1  Score=18.09  Aligned_cols=14  Identities=14%  Similarity=0.233  Sum_probs=11.8

Q ss_pred             ccccCCCccccccc
Q psy7447          84 LSVKHQGPEMLSIK   97 (114)
Q Consensus        84 ~~C~~C~~~f~~~~   97 (114)
                      +.|..|+..|-...
T Consensus        13 f~C~~C~~~FC~~H   26 (39)
T smart00154       13 FKCRHCGNLFCGEH   26 (39)
T ss_pred             eECCccCCcccccc
Confidence            99999999998553


No 105
>PHA00626 hypothetical protein
Probab=54.36  E-value=6.3  Score=19.76  Aligned_cols=14  Identities=7%  Similarity=-0.311  Sum_probs=11.7

Q ss_pred             cccccCCCcccccc
Q psy7447          83 MLSVKHQGPEMLSI   96 (114)
Q Consensus        83 ~~~C~~C~~~f~~~   96 (114)
                      .|.|+.||..|...
T Consensus        23 rYkCkdCGY~ft~~   36 (59)
T PHA00626         23 DYVCCDCGYNDSKD   36 (59)
T ss_pred             ceEcCCCCCeechh
Confidence            39999999998854


No 106
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=54.16  E-value=8.1  Score=18.81  Aligned_cols=10  Identities=10%  Similarity=-0.077  Sum_probs=6.2

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      +.|..||..+
T Consensus        38 ~~C~~Cgyt~   47 (50)
T PRK00432         38 WHCGKCGYTE   47 (50)
T ss_pred             EECCCcCCEE
Confidence            6666666544


No 107
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=53.77  E-value=5.9  Score=23.57  Aligned_cols=15  Identities=20%  Similarity=0.406  Sum_probs=9.7

Q ss_pred             CCeeCCCCCcccCCc
Q psy7447          53 PRYQCPHCPYRGKQK   67 (114)
Q Consensus        53 k~~~C~~c~~~~~~~   67 (114)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            346777787766553


No 108
>KOG4167|consensus
Probab=53.70  E-value=3.9  Score=31.17  Aligned_cols=28  Identities=25%  Similarity=0.386  Sum_probs=23.8

Q ss_pred             CCceecCcchhhcCCchHHHHHHHHhcC
Q psy7447          23 QFRYTCDSCGKVYKLKRSLYRHRTLECG   50 (114)
Q Consensus        23 ~k~~~C~~C~~~f~~~~~l~~h~~~h~~   50 (114)
                      ..-|.|.+|++.|....++..||+.|..
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            3468999999999988889999999854


No 109
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=53.60  E-value=19  Score=17.21  Aligned_cols=8  Identities=25%  Similarity=0.580  Sum_probs=4.3

Q ss_pred             hHHHHHHH
Q psy7447          68 VHLKTHVA   75 (114)
Q Consensus        68 ~~l~~h~~   75 (114)
                      ++|.+|+.
T Consensus        37 s~L~rHl~   44 (50)
T smart00614       37 SNLRRHLR   44 (50)
T ss_pred             HHHHHHHH
Confidence            45555555


No 110
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=53.39  E-value=8.3  Score=23.06  Aligned_cols=24  Identities=21%  Similarity=0.128  Sum_probs=13.5

Q ss_pred             eCCCCCcccCCchHHHHHHHHhcCCCC
Q psy7447          56 QCPHCPYRGKQKVHLKTHVAIKHQGPE   82 (114)
Q Consensus        56 ~C~~c~~~~~~~~~l~~h~~~~~~~~p   82 (114)
                      .|-++|+.|.+   |.+|..+|.|.-|
T Consensus        78 icLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          78 ICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEeccCcchHH---HHHHHhcccCCCH
Confidence            45555655554   5666666655433


No 111
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=53.13  E-value=10  Score=21.47  Aligned_cols=15  Identities=27%  Similarity=0.693  Sum_probs=10.8

Q ss_pred             ceecCcchhhcCCch
Q psy7447          25 RYTCDSCGKVYKLKR   39 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~   39 (114)
                      |.+|..||..|...+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            457888888887643


No 112
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=53.04  E-value=4.2  Score=24.39  Aligned_cols=33  Identities=18%  Similarity=0.386  Sum_probs=18.4

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLS   95 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~   95 (114)
                      .|.|..|+..+...      .+.  .... |.|..|+..+..
T Consensus       123 ~~~C~~C~~~~~r~------~~~--~~~~-~~C~~C~~~l~~  155 (157)
T PF10263_consen  123 VYRCPSCGREYKRH------RRS--KRKR-YRCGRCGGPLVQ  155 (157)
T ss_pred             EEEcCCCCCEeeee------ccc--chhh-EECCCCCCEEEE
Confidence            46777777655332      122  2223 788888866543


No 113
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=51.44  E-value=8.9  Score=18.87  Aligned_cols=20  Identities=30%  Similarity=0.551  Sum_probs=8.6

Q ss_pred             hHHHHHHHHhcCCCCCeeCCC
Q psy7447          39 RSLYRHRTLECGKEPRYQCPH   59 (114)
Q Consensus        39 ~~l~~h~~~h~~~~k~~~C~~   59 (114)
                      ..|..|....-. ..+..|..
T Consensus        24 ~~l~~H~~~~C~-~~~v~C~~   43 (60)
T PF02176_consen   24 KELDDHLENECP-KRPVPCPY   43 (60)
T ss_dssp             CCHHHHHHTTST-TSEEE-SS
T ss_pred             HHHHHHHHccCC-CCcEECCC
Confidence            345555554333 44444444


No 114
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=50.95  E-value=24  Score=23.72  Aligned_cols=72  Identities=15%  Similarity=0.274  Sum_probs=39.3

Q ss_pred             CCCCCceecCcchhhcCCchHHHHHHHH--hcCCCCCeeCCCCCcccCCc------hHHHHHHHH----hcCCCCccccc
Q psy7447          20 PLLQFRYTCDSCGKVYKLKRSLYRHRTL--ECGKEPRYQCPHCPYRGKQK------VHLKTHVAI----KHQGPEMLSVK   87 (114)
Q Consensus        20 h~~~k~~~C~~C~~~f~~~~~l~~h~~~--h~~~~k~~~C~~c~~~~~~~------~~l~~h~~~----~~~~~p~~~C~   87 (114)
                      ..+.+.|+|..|....-....+ .|+..  ... ...|.|..|++.-..+      .....|.+.    ....++ +.|+
T Consensus       137 ~hGGrif~CsfC~~flCEDDQF-EHQAsCQvLe-~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~-~PCP  213 (314)
T PF06524_consen  137 DHGGRIFKCSFCDNFLCEDDQF-EHQASCQVLE-SETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKP-IPCP  213 (314)
T ss_pred             cCCCeEEEeecCCCeeeccchh-hhhhhhhhhh-cccccccccccccchhhhheeeeehhhhhhhcccccccCCC-CCCC
Confidence            3467889999998665444433 45442  122 3356777666532221      112234442    233455 9999


Q ss_pred             CCCcccc
Q psy7447          88 HQGPEML   94 (114)
Q Consensus        88 ~C~~~f~   94 (114)
                      .||....
T Consensus       214 KCg~et~  220 (314)
T PF06524_consen  214 KCGYETQ  220 (314)
T ss_pred             CCCCccc
Confidence            9996544


No 115
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=49.12  E-value=7.5  Score=23.72  Aligned_cols=36  Identities=14%  Similarity=0.348  Sum_probs=20.2

Q ss_pred             CCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          53 PRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        53 k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      -+|.|. |+..+...   .+|-.+--|+ . |.|..|+....
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~-YrC~~C~gkL~  151 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-V-YRCGKCGGKLV  151 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-e-EEeccCCceEE
Confidence            467777 77665543   2332333344 5 88888876443


No 116
>PRK14873 primosome assembly protein PriA; Provisional
Probab=48.97  E-value=19  Score=27.38  Aligned_cols=55  Identities=16%  Similarity=0.320  Sum_probs=28.4

Q ss_pred             ecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccccccccC
Q psy7447          27 TCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSIKHQG  100 (114)
Q Consensus        27 ~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~~~~~  100 (114)
                      .|..||..+.-... ...+..|.. .....|..||..                ..| +.|+.||.......+.|
T Consensus       385 ~C~~Cg~~~~C~~C-~~~L~~h~~-~~~l~Ch~CG~~----------------~~p-~~Cp~Cgs~~l~~~g~G  439 (665)
T PRK14873        385 ACARCRTPARCRHC-TGPLGLPSA-GGTPRCRWCGRA----------------APD-WRCPRCGSDRLRAVVVG  439 (665)
T ss_pred             EhhhCcCeeECCCC-CCceeEecC-CCeeECCCCcCC----------------CcC-ccCCCCcCCcceeeecc
Confidence            56666554433211 111233333 445678777741                113 89999987655444444


No 117
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=48.40  E-value=12  Score=21.63  Aligned_cols=27  Identities=11%  Similarity=0.213  Sum_probs=17.9

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEM   93 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f   93 (114)
                      ...|..|+..|.....            - +.|+.||...
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~-~~CP~Cgs~~   96 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------L-YRCPKCHGIM   96 (115)
T ss_pred             EEEcccCCCEEecCCc------------C-ccCcCCcCCC
Confidence            3578888877665421            2 7788888644


No 118
>PRK05580 primosome assembly protein PriA; Validated
Probab=48.16  E-value=8.5  Score=29.20  Aligned_cols=13  Identities=15%  Similarity=0.021  Sum_probs=8.1

Q ss_pred             ccccCCCcccccc
Q psy7447          84 LSVKHQGPEMLSI   96 (114)
Q Consensus        84 ~~C~~C~~~f~~~   96 (114)
                      ..|+.||......
T Consensus       422 ~~Cp~Cg~~~l~~  434 (679)
T PRK05580        422 KACPECGSTDLVP  434 (679)
T ss_pred             CCCCCCcCCeeEE
Confidence            6777777654433


No 119
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=48.11  E-value=9.2  Score=22.01  Aligned_cols=26  Identities=15%  Similarity=0.070  Sum_probs=16.7

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPE   92 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~   92 (114)
                      ...|..|+..|....            . .+.|+.||..
T Consensus        70 ~~~C~~Cg~~~~~~~------------~-~~~CP~Cgs~   95 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ------------H-DAQCPHCHGE   95 (113)
T ss_pred             EEEcccCCCEEecCC------------c-CccCcCCCCC
Confidence            457888886666532            1 2678888853


No 120
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=48.09  E-value=25  Score=16.21  Aligned_cols=22  Identities=23%  Similarity=0.356  Sum_probs=10.1

Q ss_pred             eCCCCCcccC--CchHHHHHHHHh
Q psy7447          56 QCPHCPYRGK--QKVHLKTHVAIK   77 (114)
Q Consensus        56 ~C~~c~~~~~--~~~~l~~h~~~~   77 (114)
                      .|+.||..|.  .......|.+.|
T Consensus        15 ~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   15 TCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             CCCCCCCEECCCCHHHHHHHHHHH
Confidence            5566665443  233344444433


No 121
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=47.67  E-value=6.7  Score=18.19  Aligned_cols=10  Identities=10%  Similarity=0.086  Sum_probs=7.3

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      -.|++|+..|
T Consensus        30 ~~CpYCg~~y   39 (40)
T PF10276_consen   30 VVCPYCGTRY   39 (40)
T ss_dssp             EEETTTTEEE
T ss_pred             EECCCCCCEE
Confidence            6778887765


No 122
>KOG2231|consensus
Probab=47.52  E-value=22  Score=27.10  Aligned_cols=48  Identities=23%  Similarity=0.380  Sum_probs=34.0

Q ss_pred             eecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCC------CcccCCchHHHHHHHHhc
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHC------PYRGKQKVHLKTHVAIKH   78 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c------~~~~~~~~~l~~h~~~~~   78 (114)
                      ..|..|...|.....+..|++.+.     +.|..|      +..|..-..|..|.+..|
T Consensus       183 p~C~~C~~~fld~~el~rH~~~~h-----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  183 PLCKFCHERFLDDDELYRHLRFDH-----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             ccchhhhhhhccHHHHHHhhccce-----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            468888888888888888887543     244444      345677778888888765


No 123
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=46.94  E-value=8.8  Score=22.11  Aligned_cols=28  Identities=11%  Similarity=0.112  Sum_probs=15.9

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEM   93 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f   93 (114)
                      ...|..|+..|......            .+.|+.||...
T Consensus        70 ~~~C~~Cg~~~~~~~~~------------~~~CP~Cgs~~   97 (114)
T PRK03681         70 ECWCETCQQYVTLLTQR------------VRRCPQCHGDM   97 (114)
T ss_pred             EEEcccCCCeeecCCcc------------CCcCcCcCCCC
Confidence            35777787655442110            15688888543


No 124
>KOG3507|consensus
Probab=46.92  E-value=13  Score=18.82  Aligned_cols=27  Identities=41%  Similarity=0.936  Sum_probs=15.2

Q ss_pred             ceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcc
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYR   63 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~   63 (114)
                      .|.|.+|+.....+.            .-.+.|..||..
T Consensus        20 iYiCgdC~~en~lk~------------~D~irCReCG~R   46 (62)
T KOG3507|consen   20 IYICGDCGQENTLKR------------GDVIRCRECGYR   46 (62)
T ss_pred             EEEeccccccccccC------------CCcEehhhcchH
Confidence            467777775433211            335677777753


No 125
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=46.59  E-value=2  Score=19.84  Aligned_cols=8  Identities=13%  Similarity=0.119  Sum_probs=3.4

Q ss_pred             ccccCCCc
Q psy7447          84 LSVKHQGP   91 (114)
Q Consensus        84 ~~C~~C~~   91 (114)
                      |.|..|+.
T Consensus        29 y~C~~C~~   36 (40)
T smart00440       29 YVCTKCGH   36 (40)
T ss_pred             EEeCCCCC
Confidence            44444443


No 126
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=46.59  E-value=6.4  Score=18.34  Aligned_cols=15  Identities=20%  Similarity=0.206  Sum_probs=9.4

Q ss_pred             cccccCCCccccccc
Q psy7447          83 MLSVKHQGPEMLSIK   97 (114)
Q Consensus        83 ~~~C~~C~~~f~~~~   97 (114)
                      ++.|..|+..|-...
T Consensus        13 ~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   13 PFKCKHCGKSFCLKH   27 (43)
T ss_dssp             HEE-TTTS-EE-TTT
T ss_pred             CeECCCCCcccCccc
Confidence            399999999999543


No 127
>KOG3362|consensus
Probab=45.46  E-value=8.1  Score=23.33  Aligned_cols=20  Identities=15%  Similarity=0.177  Sum_probs=15.3

Q ss_pred             ccccCCCcccccccccCCCc
Q psy7447          84 LSVKHQGPEMLSIKHQGPET  103 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~~~~~~  103 (114)
                      |.|.-||..+.++....-|.
T Consensus       130 ysC~~CG~kyCsv~C~~~Hn  149 (156)
T KOG3362|consen  130 YSCVNCGTKYCSVRCLKTHN  149 (156)
T ss_pred             hHHHhcCCceeechhhhhcc
Confidence            88999998888887655443


No 128
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=45.40  E-value=24  Score=15.86  Aligned_cols=10  Identities=20%  Similarity=0.179  Sum_probs=5.3

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      -.|+.||..+
T Consensus        22 ~~Cd~cg~~L   31 (36)
T PF05191_consen   22 GVCDNCGGEL   31 (36)
T ss_dssp             TBCTTTTEBE
T ss_pred             CccCCCCCee
Confidence            4566665533


No 129
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=45.32  E-value=11  Score=19.17  Aligned_cols=11  Identities=9%  Similarity=0.102  Sum_probs=4.1

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      +.|..||..|-
T Consensus        26 hhCr~CG~~vC   36 (69)
T PF01363_consen   26 HHCRNCGRVVC   36 (69)
T ss_dssp             EE-TTT--EEE
T ss_pred             EccCCCCCEEC
Confidence            45555555444


No 130
>KOG2482|consensus
Probab=44.03  E-value=15  Score=25.69  Aligned_cols=24  Identities=29%  Similarity=0.576  Sum_probs=21.4

Q ss_pred             ceecCcchhhcCCchHHHHHHHHh
Q psy7447          25 RYTCDSCGKVYKLKRSLYRHRTLE   48 (114)
Q Consensus        25 ~~~C~~C~~~f~~~~~l~~h~~~h   48 (114)
                      .++|-.|.+.|..+..|..||+..
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK  218 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKK  218 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhc
Confidence            468999999999999999999854


No 131
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=43.10  E-value=12  Score=21.09  Aligned_cols=14  Identities=43%  Similarity=0.925  Sum_probs=11.1

Q ss_pred             CceecCcchhhcCC
Q psy7447          24 FRYTCDSCGKVYKL   37 (114)
Q Consensus        24 k~~~C~~C~~~f~~   37 (114)
                      ++.+|..||..|..
T Consensus        78 ~~~rC~eCG~~fkL   91 (97)
T cd00924          78 KPKRCPECGHVFKL   91 (97)
T ss_pred             CceeCCCCCcEEEE
Confidence            78888888887763


No 132
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=41.76  E-value=19  Score=20.85  Aligned_cols=29  Identities=10%  Similarity=0.165  Sum_probs=17.1

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ...|..|+..|.....            .-+.|+.||....
T Consensus        71 ~~~C~~Cg~~~~~~~~------------~~~~CP~Cgs~~~   99 (117)
T PRK00564         71 ELECKDCSHVFKPNAL------------DYGVCEKCHSKNV   99 (117)
T ss_pred             EEEhhhCCCccccCCc------------cCCcCcCCCCCce
Confidence            3578888866655321            1034888886544


No 133
>KOG4167|consensus
Probab=41.71  E-value=5.4  Score=30.51  Aligned_cols=26  Identities=15%  Similarity=0.232  Sum_probs=22.5

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcC
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~   79 (114)
                      .|-|.+|++.|...-.++.|++.|..
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            47899999999988889999998854


No 134
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=41.66  E-value=7.3  Score=22.37  Aligned_cols=28  Identities=18%  Similarity=0.258  Sum_probs=16.6

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ...|..|+..|.....             .+.|+.||....
T Consensus        70 ~~~C~~Cg~~~~~~~~-------------~~~CP~Cgs~~~   97 (113)
T PF01155_consen   70 RARCRDCGHEFEPDEF-------------DFSCPRCGSPDV   97 (113)
T ss_dssp             EEEETTTS-EEECHHC-------------CHH-SSSSSS-E
T ss_pred             cEECCCCCCEEecCCC-------------CCCCcCCcCCCc
Confidence            3578888887776432             156888887653


No 135
>PLN02294 cytochrome c oxidase subunit Vb
Probab=41.64  E-value=13  Score=23.20  Aligned_cols=15  Identities=20%  Similarity=0.698  Sum_probs=10.9

Q ss_pred             CCceecCcchhhcCC
Q psy7447          23 QFRYTCDSCGKVYKL   37 (114)
Q Consensus        23 ~k~~~C~~C~~~f~~   37 (114)
                      .++.+|.+||..|..
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            467788888877763


No 136
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.63  E-value=3.6  Score=26.89  Aligned_cols=10  Identities=0%  Similarity=-0.403  Sum_probs=6.8

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      +.|+.|+.+.
T Consensus        63 vvCP~C~yAa   72 (267)
T COG1655          63 VVCPICYYAA   72 (267)
T ss_pred             EEcchhhHHH
Confidence            4788887543


No 137
>KOG3408|consensus
Probab=40.58  E-value=23  Score=20.78  Aligned_cols=26  Identities=15%  Similarity=0.262  Sum_probs=16.1

Q ss_pred             CCCCceecCcchhhcCCchHHHHHHH
Q psy7447          21 LLQFRYTCDSCGKVYKLKRSLYRHRT   46 (114)
Q Consensus        21 ~~~k~~~C~~C~~~f~~~~~l~~h~~   46 (114)
                      +|...|.|-.|.+-|.....|..|.+
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHh
Confidence            34455667777777766666666654


No 138
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=40.45  E-value=23  Score=16.90  Aligned_cols=21  Identities=38%  Similarity=0.940  Sum_probs=11.3

Q ss_pred             eeCCCCCcccCCchHHHHHHH
Q psy7447          55 YQCPHCPYRGKQKVHLKTHVA   75 (114)
Q Consensus        55 ~~C~~c~~~~~~~~~l~~h~~   75 (114)
                      |.|-.|..+...++.|-.|++
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            345555555555555555554


No 139
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=40.35  E-value=18  Score=21.42  Aligned_cols=17  Identities=12%  Similarity=0.032  Sum_probs=14.3

Q ss_pred             ccccCCCcccccccccC
Q psy7447          84 LSVKHQGPEMLSIKHQG  100 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~~~  100 (114)
                      |.|..|++.|....+..
T Consensus        54 yrC~~C~~tf~~~~~~~   70 (129)
T COG3677          54 YKCKSCGSTFTVETGSP   70 (129)
T ss_pred             cccCCcCcceeeeccCc
Confidence            99999999999776643


No 140
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=39.90  E-value=11  Score=18.35  Aligned_cols=15  Identities=27%  Similarity=0.344  Sum_probs=10.2

Q ss_pred             ccccCCCcccccccc
Q psy7447          84 LSVKHQGPEMLSIKH   98 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~   98 (114)
                      +.|.-||..|....+
T Consensus         5 l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    5 LTCKDCGAEFVFTAG   19 (49)
T ss_pred             EEcccCCCeEEEehh
Confidence            677778877775443


No 141
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=39.48  E-value=11  Score=18.39  Aligned_cols=11  Identities=9%  Similarity=-0.016  Sum_probs=5.2

Q ss_pred             cccCCCccccc
Q psy7447          85 SVKHQGPEMLS   95 (114)
Q Consensus        85 ~C~~C~~~f~~   95 (114)
                      .|+.|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            78888887764


No 142
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=38.76  E-value=13  Score=18.09  Aligned_cols=9  Identities=11%  Similarity=0.036  Sum_probs=6.0

Q ss_pred             ccccCCCcc
Q psy7447          84 LSVKHQGPE   92 (114)
Q Consensus        84 ~~C~~C~~~   92 (114)
                      |.|..||..
T Consensus        38 ~~CGkCgyT   46 (51)
T COG1998          38 WACGKCGYT   46 (51)
T ss_pred             eEeccccce
Confidence            777777653


No 143
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=38.73  E-value=12  Score=19.85  Aligned_cols=8  Identities=25%  Similarity=0.816  Sum_probs=3.8

Q ss_pred             ecCcchhh
Q psy7447          27 TCDSCGKV   34 (114)
Q Consensus        27 ~C~~C~~~   34 (114)
                      .|..||..
T Consensus         3 ~CP~Cg~~   10 (72)
T PRK09678          3 HCPLCQHA   10 (72)
T ss_pred             cCCCCCCc
Confidence            35555543


No 144
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=38.55  E-value=16  Score=17.15  Aligned_cols=11  Identities=9%  Similarity=-0.100  Sum_probs=8.2

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      =.|..|++.|.
T Consensus         9 K~C~~C~rpf~   19 (42)
T PF10013_consen    9 KICPVCGRPFT   19 (42)
T ss_pred             CcCcccCCcch
Confidence            46788888776


No 145
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=38.47  E-value=24  Score=25.34  Aligned_cols=13  Identities=23%  Similarity=0.889  Sum_probs=6.7

Q ss_pred             CeeCCCCCcccCC
Q psy7447          54 RYQCPHCPYRGKQ   66 (114)
Q Consensus        54 ~~~C~~c~~~~~~   66 (114)
                      -|.|+.|+..+..
T Consensus       367 g~rC~kCg~~~~~  379 (421)
T COG1571         367 GFRCKKCGTRARE  379 (421)
T ss_pred             CcccccccccCCc
Confidence            4555555554444


No 146
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=37.54  E-value=36  Score=16.56  Aligned_cols=12  Identities=33%  Similarity=0.899  Sum_probs=5.6

Q ss_pred             eeCCCCCcccCC
Q psy7447          55 YQCPHCPYRGKQ   66 (114)
Q Consensus        55 ~~C~~c~~~~~~   66 (114)
                      +.|..|+..|..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            355555444443


No 147
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=35.95  E-value=63  Score=20.33  Aligned_cols=33  Identities=15%  Similarity=0.371  Sum_probs=21.1

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ..-|.|+.|...++...+..      .    .|.|+.||....
T Consensus       111 ~~~y~C~~~~~r~sfdeA~~------~----~F~Cp~Cg~~L~  143 (176)
T COG1675         111 NNYYVCPNCHVKYSFDEAME------L----GFTCPKCGEDLE  143 (176)
T ss_pred             CCceeCCCCCCcccHHHHHH------h----CCCCCCCCchhh
Confidence            66788877776666544332      1    289999986543


No 149
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=35.95  E-value=19  Score=19.91  Aligned_cols=17  Identities=24%  Similarity=0.175  Sum_probs=12.5

Q ss_pred             CCCcccccCCCcccccc
Q psy7447          80 GPEMLSVKHQGPEMLSI   96 (114)
Q Consensus        80 ~~p~~~C~~C~~~f~~~   96 (114)
                      .-|...|..||..+.+.
T Consensus        32 nVPa~~C~~CGe~y~~d   48 (89)
T TIGR03829        32 ETPSISCSHCGMEYQDD   48 (89)
T ss_pred             cCCcccccCCCcEeecH
Confidence            34668899999887753


No 150
>COG1773 Rubredoxin [Energy production and conversion]
Probab=35.89  E-value=20  Score=17.94  Aligned_cols=13  Identities=31%  Similarity=0.825  Sum_probs=9.8

Q ss_pred             CeeCCCCCcccCC
Q psy7447          54 RYQCPHCPYRGKQ   66 (114)
Q Consensus        54 ~~~C~~c~~~~~~   66 (114)
                      .|+|.+||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            5788888887765


No 151
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=35.84  E-value=36  Score=16.41  Aligned_cols=9  Identities=44%  Similarity=1.243  Sum_probs=4.3

Q ss_pred             cCcchhhcC
Q psy7447          28 CDSCGKVYK   36 (114)
Q Consensus        28 C~~C~~~f~   36 (114)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            445554443


No 152
>PRK12496 hypothetical protein; Provisional
Probab=34.99  E-value=29  Score=21.37  Aligned_cols=12  Identities=42%  Similarity=0.946  Sum_probs=7.4

Q ss_pred             ceecCcchhhcC
Q psy7447          25 RYTCDSCGKVYK   36 (114)
Q Consensus        25 ~~~C~~C~~~f~   36 (114)
                      .+.|.-|++.|.
T Consensus       127 ~~~C~gC~~~~~  138 (164)
T PRK12496        127 RKVCKGCKKKYP  138 (164)
T ss_pred             eEECCCCCcccc
Confidence            456777766654


No 153
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=34.81  E-value=4  Score=27.41  Aligned_cols=9  Identities=33%  Similarity=0.752  Sum_probs=3.6

Q ss_pred             eecCcchhh
Q psy7447          26 YTCDSCGKV   34 (114)
Q Consensus        26 ~~C~~C~~~   34 (114)
                      -.|..||..
T Consensus       173 g~CPvCGs~  181 (290)
T PF04216_consen  173 GYCPVCGSP  181 (290)
T ss_dssp             SS-TTT---
T ss_pred             CcCCCCCCc
Confidence            368888854


No 154
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=34.81  E-value=15  Score=16.63  Aligned_cols=13  Identities=15%  Similarity=0.227  Sum_probs=7.1

Q ss_pred             ccccCCCcccccc
Q psy7447          84 LSVKHQGPEMLSI   96 (114)
Q Consensus        84 ~~C~~C~~~f~~~   96 (114)
                      |+|..||..+.-+
T Consensus         7 YkC~~CGniVev~   19 (36)
T PF06397_consen    7 YKCEHCGNIVEVV   19 (36)
T ss_dssp             EE-TTT--EEEEE
T ss_pred             EEccCCCCEEEEE
Confidence            7888888876544


No 155
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=34.03  E-value=25  Score=21.01  Aligned_cols=10  Identities=10%  Similarity=0.199  Sum_probs=6.5

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      |.|..|+..+
T Consensus       134 y~C~~C~g~l  143 (146)
T smart00731      134 YRCGKCGGKL  143 (146)
T ss_pred             EEcCCCCCEE
Confidence            6777776654


No 156
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=34.02  E-value=33  Score=17.44  Aligned_cols=15  Identities=20%  Similarity=0.791  Sum_probs=7.6

Q ss_pred             CCCeeCCCCCcccCC
Q psy7447          52 EPRYQCPHCPYRGKQ   66 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~   66 (114)
                      .+.+.|+.||.....
T Consensus        44 ~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   44 GRVFTCPNCGFEMDR   58 (69)
T ss_pred             cceEEcCCCCCEECc
Confidence            344555556554443


No 157
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.31  E-value=19  Score=18.42  Aligned_cols=11  Identities=0%  Similarity=-0.176  Sum_probs=8.0

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      -.|++|+..|.
T Consensus        49 v~CPYC~t~y~   59 (62)
T COG4391          49 VVCPYCSTRYR   59 (62)
T ss_pred             EecCccccEEE
Confidence            67788877664


No 158
>KOG2071|consensus
Probab=33.30  E-value=31  Score=25.83  Aligned_cols=28  Identities=21%  Similarity=0.415  Sum_probs=19.3

Q ss_pred             CCCeeCCCCCcccCCchHHHHHHHHhcC
Q psy7447          52 EPRYQCPHCPYRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~~~l~~h~~~~~~   79 (114)
                      ..+-+|..||..|........|+..|..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhh
Confidence            4456788888888877766666666543


No 159
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=33.04  E-value=2.3  Score=32.33  Aligned_cols=60  Identities=20%  Similarity=0.441  Sum_probs=33.1

Q ss_pred             ecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          27 TCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        27 ~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      .|..||-+|+....|-.-. ..+.-..--.|+.|.+-+..+.+.+.|    .  .+ -.|..||....
T Consensus        92 nCt~CGPr~~i~~~lpydr-~~t~m~~f~~C~~C~~ey~~p~~rr~h----~--~~-~~C~~Cgp~l~  151 (711)
T TIGR00143        92 SCTHCGPRFTIIEALPYDR-ENTSMADFPLCPDCAKEYKDPLDRRFH----A--QP-IACPRCGPQLN  151 (711)
T ss_pred             cccCCCCCeEEeecCCCCC-CCcCCCCCcCCHHHHHHhcCCccccCC----C--CC-ccCCCCCcEEE
Confidence            5888888877654433221 122202223677777666655433222    1  23 79999997664


No 160
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=32.83  E-value=78  Score=17.93  Aligned_cols=38  Identities=8%  Similarity=0.118  Sum_probs=23.9

Q ss_pred             CceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcc
Q psy7447          24 FRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYR   63 (114)
Q Consensus        24 k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~   63 (114)
                      +.|.|..-+..|..-..+...+..-.  .+.|.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y~--~~vwtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILYN--QRVWTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHHh--CCeeEEecCCCC
Confidence            45667777777777666655555432  566777776653


No 161
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=32.58  E-value=26  Score=23.71  Aligned_cols=32  Identities=25%  Similarity=0.529  Sum_probs=18.9

Q ss_pred             eecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCc
Q psy7447          26 YTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQK   67 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~   67 (114)
                      .+|..|+...-.+.     ..     ..-+.|+.|+.-|...
T Consensus        27 ~~c~~c~~~~~~~~-----l~-----~~~~vc~~c~~h~rl~   58 (285)
T TIGR00515        27 TKCPKCGQVLYTKE-----LE-----RNLEVCPKCDHHMRMD   58 (285)
T ss_pred             eECCCCcchhhHHH-----HH-----hhCCCCCCCCCcCcCC
Confidence            36888876643211     11     2235788898877654


No 162
>PRK04351 hypothetical protein; Provisional
Probab=32.54  E-value=19  Score=21.86  Aligned_cols=34  Identities=15%  Similarity=0.192  Sum_probs=19.6

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEMLSI   96 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~~~   96 (114)
                      .|.|..|+..+...      .+  +.... |.|..|+..+...
T Consensus       112 ~Y~C~~Cg~~~~r~------Rr--~n~~~-yrCg~C~g~L~~~  145 (149)
T PRK04351        112 LYECQSCGQQYLRK------RR--INTKR-YRCGKCRGKLKLI  145 (149)
T ss_pred             EEECCCCCCEeeee------ee--cCCCc-EEeCCCCcEeeec
Confidence            46787777554432      11  12344 8888888666543


No 163
>KOG2636|consensus
Probab=32.26  E-value=37  Score=24.67  Aligned_cols=27  Identities=37%  Similarity=0.755  Sum_probs=16.1

Q ss_pred             CCCCCceecCcch-hhcCCchHHHHHHH
Q psy7447          20 PLLQFRYTCDSCG-KVYKLKRSLYRHRT   46 (114)
Q Consensus        20 h~~~k~~~C~~C~-~~f~~~~~l~~h~~   46 (114)
                      |.-..-|.|.+|| .++..+..+.+|-.
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            4444556777777 55555666666644


No 164
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=32.08  E-value=59  Score=15.87  Aligned_cols=13  Identities=8%  Similarity=-0.013  Sum_probs=7.4

Q ss_pred             cCCCCcccccCCCc
Q psy7447          78 HQGPEMLSVKHQGP   91 (114)
Q Consensus        78 ~~~~p~~~C~~C~~   91 (114)
                      .+.+- ..|+.||+
T Consensus        42 ~~~~i-~~Cp~CgR   54 (56)
T PF02591_consen   42 KGDEI-VFCPNCGR   54 (56)
T ss_pred             cCCCe-EECcCCCc
Confidence            33344 66777765


No 165
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=32.02  E-value=24  Score=16.01  Aligned_cols=11  Identities=0%  Similarity=-0.266  Sum_probs=5.1

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      |-|++|+.-+.
T Consensus         4 yyCdyC~~~~~   14 (38)
T PF06220_consen    4 YYCDYCKKYLT   14 (38)
T ss_dssp             -B-TTT--B-S
T ss_pred             eecccccceec
Confidence            89999998884


No 166
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=31.72  E-value=26  Score=17.27  Aligned_cols=13  Identities=8%  Similarity=0.107  Sum_probs=9.6

Q ss_pred             ccccCCCcccccc
Q psy7447          84 LSVKHQGPEMLSI   96 (114)
Q Consensus        84 ~~C~~C~~~f~~~   96 (114)
                      +.|++||..+..+
T Consensus         1 i~CPyCge~~~~~   13 (52)
T PF14255_consen    1 IQCPYCGEPIEIL   13 (52)
T ss_pred             CCCCCCCCeeEEE
Confidence            3689999877644


No 167
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=31.17  E-value=7.9  Score=21.87  Aligned_cols=15  Identities=33%  Similarity=0.700  Sum_probs=10.0

Q ss_pred             CCCceecCcchhhcC
Q psy7447          22 LQFRYTCDSCGKVYK   36 (114)
Q Consensus        22 ~~k~~~C~~C~~~f~   36 (114)
                      -.+.|.|..|+..-.
T Consensus        19 L~k~FtCp~Cghe~v   33 (104)
T COG4888          19 LPKTFTCPRCGHEKV   33 (104)
T ss_pred             CCceEecCccCCeee
Confidence            456788888875533


No 168
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=30.62  E-value=28  Score=14.99  Aligned_cols=8  Identities=38%  Similarity=1.070  Sum_probs=3.6

Q ss_pred             CeeCCCCC
Q psy7447          54 RYQCPHCP   61 (114)
Q Consensus        54 ~~~C~~c~   61 (114)
                      .+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            34444444


No 169
>PF14369 zf-RING_3:  zinc-finger
Probab=30.14  E-value=27  Score=15.51  Aligned_cols=10  Identities=0%  Similarity=-0.054  Sum_probs=7.0

Q ss_pred             cccCCCcccc
Q psy7447          85 SVKHQGPEML   94 (114)
Q Consensus        85 ~C~~C~~~f~   94 (114)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4777777775


No 170
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.91  E-value=18  Score=21.34  Aligned_cols=14  Identities=29%  Similarity=0.430  Sum_probs=6.6

Q ss_pred             CCeeCCCCCcccCC
Q psy7447          53 PRYQCPHCPYRGKQ   66 (114)
Q Consensus        53 k~~~C~~c~~~~~~   66 (114)
                      .|.-|.-||+.|.+
T Consensus        67 ~psfchncgs~fpw   80 (160)
T COG4306          67 PPSFCHNCGSRFPW   80 (160)
T ss_pred             CcchhhcCCCCCCc
Confidence            34444445555544


No 171
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=29.49  E-value=15  Score=26.76  Aligned_cols=15  Identities=33%  Similarity=0.738  Sum_probs=9.7

Q ss_pred             CCCeeCCCCCcccCC
Q psy7447          52 EPRYQCPHCPYRGKQ   66 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~   66 (114)
                      ...|+|..|+..+..
T Consensus       423 ~~~~~c~~c~~~yd~  437 (479)
T PRK05452        423 GPRMQCSVCQWIYDP  437 (479)
T ss_pred             CCeEEECCCCeEECC
Confidence            345677777766654


No 172
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=29.40  E-value=21  Score=20.31  Aligned_cols=11  Identities=27%  Similarity=0.564  Sum_probs=6.1

Q ss_pred             CceecCcchhh
Q psy7447          24 FRYTCDSCGKV   34 (114)
Q Consensus        24 k~~~C~~C~~~   34 (114)
                      ||..|..||..
T Consensus         1 ~p~~CpYCg~~   11 (102)
T PF11672_consen    1 KPIICPYCGGP   11 (102)
T ss_pred             CCcccCCCCCe
Confidence            34556666643


No 173
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=29.24  E-value=30  Score=16.82  Aligned_cols=15  Identities=7%  Similarity=-0.124  Sum_probs=11.0

Q ss_pred             ccccCCCcccccccc
Q psy7447          84 LSVKHQGPEMLSIKH   98 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~   98 (114)
                      |.|..||..+....|
T Consensus         2 y~C~~CgyiYd~~~G   16 (50)
T cd00730           2 YECRICGYIYDPAEG   16 (50)
T ss_pred             cCCCCCCeEECCCCC
Confidence            788888887775443


No 174
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.86  E-value=19  Score=19.31  Aligned_cols=32  Identities=16%  Similarity=0.358  Sum_probs=19.0

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEM   93 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f   93 (114)
                      .|+|..|+..|.--.    +    ..+.|.-.|+.|+-.+
T Consensus        12 ~Y~c~~cg~~~dvvq----~----~~ddplt~ce~c~a~~   43 (82)
T COG2331          12 SYECTECGNRFDVVQ----A----MTDDPLTTCEECGARL   43 (82)
T ss_pred             EEeecccchHHHHHH----h----cccCccccChhhChHH
Confidence            478888887654421    1    2233435788888544


No 175
>PRK04023 DNA polymerase II large subunit; Validated
Probab=28.59  E-value=59  Score=26.33  Aligned_cols=10  Identities=60%  Similarity=1.178  Sum_probs=6.1

Q ss_pred             ceecCcchhh
Q psy7447          25 RYTCDSCGKV   34 (114)
Q Consensus        25 ~~~C~~C~~~   34 (114)
                      ...|..||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            3457777755


No 176
>PRK11823 DNA repair protein RadA; Provisional
Probab=28.43  E-value=54  Score=23.66  Aligned_cols=13  Identities=31%  Similarity=0.846  Sum_probs=9.2

Q ss_pred             CCceecCcchhhc
Q psy7447          23 QFRYTCDSCGKVY   35 (114)
Q Consensus        23 ~k~~~C~~C~~~f   35 (114)
                      ...|.|..||...
T Consensus         5 ~~~y~C~~Cg~~~   17 (446)
T PRK11823          5 KTAYVCQECGAES   17 (446)
T ss_pred             CCeEECCcCCCCC
Confidence            3568898888654


No 177
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=28.39  E-value=26  Score=16.83  Aligned_cols=15  Identities=13%  Similarity=-0.173  Sum_probs=10.6

Q ss_pred             ccccCCCcccccccc
Q psy7447          84 LSVKHQGPEMLSIKH   98 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~   98 (114)
                      |.|..|+..+....+
T Consensus         2 y~C~~CgyvYd~~~G   16 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKG   16 (47)
T ss_dssp             EEETTTSBEEETTTB
T ss_pred             cCCCCCCEEEcCCcC
Confidence            778888877665544


No 178
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=28.26  E-value=54  Score=23.79  Aligned_cols=23  Identities=26%  Similarity=0.774  Sum_probs=15.8

Q ss_pred             CceecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCC
Q psy7447          24 FRYTCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCP   61 (114)
Q Consensus        24 k~~~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~   61 (114)
                      ..|.|..||....               ..-+.|+.|+
T Consensus         6 ~~y~C~~Cg~~~~---------------~~~g~Cp~C~   28 (454)
T TIGR00416         6 SKFVCQHCGADSP---------------KWQGKCPACH   28 (454)
T ss_pred             CeEECCcCCCCCc---------------cccEECcCCC
Confidence            4589999986543               3345788885


No 179
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=28.00  E-value=61  Score=16.20  Aligned_cols=14  Identities=21%  Similarity=0.785  Sum_probs=9.4

Q ss_pred             CCCeeCCCCCcccC
Q psy7447          52 EPRYQCPHCPYRGK   65 (114)
Q Consensus        52 ~k~~~C~~c~~~~~   65 (114)
                      ...|.|+.||-.+-
T Consensus        12 ~v~~~Cp~cGipth   25 (55)
T PF13824_consen   12 HVNFECPDCGIPTH   25 (55)
T ss_pred             ccCCcCCCCCCcCc
Confidence            56678888875443


No 180
>KOG4173|consensus
Probab=27.62  E-value=41  Score=21.80  Aligned_cols=68  Identities=18%  Similarity=0.320  Sum_probs=33.6

Q ss_pred             ceecCc--chhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCchHHHHHHHHhc---------CCCCcccccC--CCc
Q psy7447          25 RYTCDS--CGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQKVHLKTHVAIKH---------QGPEMLSVKH--QGP   91 (114)
Q Consensus        25 ~~~C~~--C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~~~l~~h~~~~~---------~~~p~~~C~~--C~~   91 (114)
                      .+.|.+  |-+.|.....+..|--+..+    -.|..|.+.|....-|..|+--.+         ..++.|.|=.  |+.
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~----~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG----NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc----chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            344544  44555544444444332222    256667777776666666644222         1244466653  555


Q ss_pred             ccccc
Q psy7447          92 EMLSI   96 (114)
Q Consensus        92 ~f~~~   96 (114)
                      .|-..
T Consensus       155 KFkT~  159 (253)
T KOG4173|consen  155 KFKTS  159 (253)
T ss_pred             hhhhh
Confidence            55433


No 181
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=27.55  E-value=25  Score=20.60  Aligned_cols=34  Identities=18%  Similarity=0.343  Sum_probs=18.0

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ...| .|+..|.....-..+      -.+.+.|+.||....
T Consensus        70 ~~~C-~Cg~~~~~~~~~~~~------~~~~~~CP~Cgs~~~  103 (124)
T PRK00762         70 EIEC-ECGYEGVVDEDEIDH------YAAVIECPVCGNKRA  103 (124)
T ss_pred             eEEe-eCcCcccccccchhc------cccCCcCcCCCCCCC
Confidence            4588 888776654210000      011267999985443


No 182
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=27.42  E-value=20  Score=15.34  Aligned_cols=13  Identities=15%  Similarity=0.207  Sum_probs=6.9

Q ss_pred             ccccCCCcccccc
Q psy7447          84 LSVKHQGPEMLSI   96 (114)
Q Consensus        84 ~~C~~C~~~f~~~   96 (114)
                      |.|+.|+..+-++
T Consensus        14 Y~Cp~C~~~~CSl   26 (30)
T PF04438_consen   14 YRCPRCGARYCSL   26 (30)
T ss_dssp             EE-TTT--EESSH
T ss_pred             EECCCcCCceeCc
Confidence            7777777766554


No 183
>PHA02998 RNA polymerase subunit; Provisional
Probab=27.11  E-value=12  Score=23.49  Aligned_cols=11  Identities=0%  Similarity=-0.055  Sum_probs=7.4

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      |.|..||..|.
T Consensus       172 YkC~~CG~~wk  182 (195)
T PHA02998        172 HACRDCKKHFK  182 (195)
T ss_pred             EEcCCCCCccC
Confidence            67777776665


No 184
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=26.48  E-value=35  Score=23.31  Aligned_cols=14  Identities=29%  Similarity=0.558  Sum_probs=9.4

Q ss_pred             CeeCCCCCcccCCc
Q psy7447          54 RYQCPHCPYRGKQK   67 (114)
Q Consensus        54 ~~~C~~c~~~~~~~   67 (114)
                      -+.|+.|+.-|...
T Consensus        57 ~~vcp~c~~h~rlt   70 (296)
T CHL00174         57 MNICEQCGYHLKMS   70 (296)
T ss_pred             CCCCCCCCCCcCCC
Confidence            35778888766654


No 185
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=26.30  E-value=42  Score=19.28  Aligned_cols=13  Identities=31%  Similarity=0.881  Sum_probs=6.6

Q ss_pred             CeeCCCCCcccCC
Q psy7447          54 RYQCPHCPYRGKQ   66 (114)
Q Consensus        54 ~~~C~~c~~~~~~   66 (114)
                      .+.|+.|+..|..
T Consensus        19 ~~iCpeC~~EW~~   31 (109)
T TIGR00686        19 QLICPSCLYEWNE   31 (109)
T ss_pred             eeECccccccccc
Confidence            3555555554443


No 186
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=26.28  E-value=36  Score=14.78  Aligned_cols=15  Identities=7%  Similarity=-0.017  Sum_probs=11.3

Q ss_pred             ccccCCCcccccccc
Q psy7447          84 LSVKHQGPEMLSIKH   98 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~   98 (114)
                      |+|..||..+..+..
T Consensus         5 ykC~~CGniv~v~~~   19 (34)
T cd00974           5 YKCEICGNIVEVLNV   19 (34)
T ss_pred             EEcCCCCcEEEEEEC
Confidence            788888888776643


No 187
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=26.16  E-value=52  Score=19.96  Aligned_cols=8  Identities=13%  Similarity=0.144  Sum_probs=4.9

Q ss_pred             cccCCCcc
Q psy7447          85 SVKHQGPE   92 (114)
Q Consensus        85 ~C~~C~~~   92 (114)
                      .|+.||..
T Consensus       132 ~Cp~C~~~  139 (146)
T PF07295_consen  132 PCPKCGHT  139 (146)
T ss_pred             CCCCCCCC
Confidence            66666653


No 188
>PRK05978 hypothetical protein; Provisional
Probab=26.06  E-value=42  Score=20.45  Aligned_cols=13  Identities=8%  Similarity=-0.025  Sum_probs=8.4

Q ss_pred             ccccCCCcccccc
Q psy7447          84 LSVKHQGPEMLSI   96 (114)
Q Consensus        84 ~~C~~C~~~f~~~   96 (114)
                      -.|+.||..|...
T Consensus        53 ~~C~~CG~~~~~~   65 (148)
T PRK05978         53 DHCAACGEDFTHH   65 (148)
T ss_pred             CCccccCCccccC
Confidence            4777777766633


No 189
>KOG1842|consensus
Probab=26.06  E-value=39  Score=24.55  Aligned_cols=27  Identities=19%  Similarity=0.128  Sum_probs=21.7

Q ss_pred             CceecCcchhhcCCchHHHHHHHHhcC
Q psy7447          24 FRYTCDSCGKVYKLKRSLYRHRTLECG   50 (114)
Q Consensus        24 k~~~C~~C~~~f~~~~~l~~h~~~h~~   50 (114)
                      +-|.|+.|..-|...+.|..|....+.
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcc
Confidence            457899999999998999998775444


No 190
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=25.98  E-value=62  Score=26.89  Aligned_cols=11  Identities=9%  Similarity=0.093  Sum_probs=6.2

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      ..|+.|+....
T Consensus       710 ~~CP~CGtplv  720 (1337)
T PRK14714        710 VECPRCDVELT  720 (1337)
T ss_pred             ccCCCCCCccc
Confidence            45666664433


No 191
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=25.84  E-value=36  Score=14.75  Aligned_cols=14  Identities=7%  Similarity=0.029  Sum_probs=10.8

Q ss_pred             ccccCCCccccccc
Q psy7447          84 LSVKHQGPEMLSIK   97 (114)
Q Consensus        84 ~~C~~C~~~f~~~~   97 (114)
                      |+|..||..+..+.
T Consensus         8 ykC~~Cgniv~v~~   21 (34)
T TIGR00319         8 YKCEVCGNIVEVLH   21 (34)
T ss_pred             EEcCCCCcEEEEEE
Confidence            88888888777554


No 192
>KOG1280|consensus
Probab=25.51  E-value=75  Score=22.37  Aligned_cols=26  Identities=31%  Similarity=0.643  Sum_probs=13.1

Q ss_pred             CeeCCCCCcccCCchHHHHHHHHhcC
Q psy7447          54 RYQCPHCPYRGKQKVHLKTHVAIKHQ   79 (114)
Q Consensus        54 ~~~C~~c~~~~~~~~~l~~h~~~~~~   79 (114)
                      -|.|+.|+..-.....+..|.-..+.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hp  104 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHP  104 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCc
Confidence            34555555554444555555544443


No 193
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=25.24  E-value=16  Score=21.10  Aligned_cols=11  Identities=9%  Similarity=-0.025  Sum_probs=6.9

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      |.|..||..+.
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            66666766553


No 194
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=24.55  E-value=70  Score=19.16  Aligned_cols=47  Identities=13%  Similarity=0.244  Sum_probs=26.4

Q ss_pred             eecCcchhhcCCchH--HHHH--HHHhcCCCCCeeCCCCCcccCCchHHHH
Q psy7447          26 YTCDSCGKVYKLKRS--LYRH--RTLECGKEPRYQCPHCPYRGKQKVHLKT   72 (114)
Q Consensus        26 ~~C~~C~~~f~~~~~--l~~h--~~~h~~~~k~~~C~~c~~~~~~~~~l~~   72 (114)
                      -.|..|+..+...+.  +..-  ..+......-+.|+.|++.|...++..+
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~  142 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRR  142 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHH
Confidence            479999876543211  1100  0011110346799999999988776553


No 195
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=24.05  E-value=41  Score=15.23  Aligned_cols=13  Identities=8%  Similarity=-0.205  Sum_probs=7.2

Q ss_pred             ccccCCCcccccc
Q psy7447          84 LSVKHQGPEMLSI   96 (114)
Q Consensus        84 ~~C~~C~~~f~~~   96 (114)
                      -.|..|++.|--.
T Consensus         3 ~~CprC~kg~Hwa   15 (36)
T PF14787_consen    3 GLCPRCGKGFHWA   15 (36)
T ss_dssp             -C-TTTSSSCS-T
T ss_pred             ccCcccCCCcchh
Confidence            3578888877533


No 196
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=23.99  E-value=43  Score=17.25  Aligned_cols=9  Identities=22%  Similarity=0.261  Sum_probs=5.7

Q ss_pred             ccccCCCcc
Q psy7447          84 LSVKHQGPE   92 (114)
Q Consensus        84 ~~C~~C~~~   92 (114)
                      |.|++||..
T Consensus         1 y~C~KCg~~    9 (64)
T PF09855_consen    1 YKCPKCGNE    9 (64)
T ss_pred             CCCCCCCCc
Confidence            567777743


No 197
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=23.77  E-value=27  Score=19.37  Aligned_cols=31  Identities=19%  Similarity=0.475  Sum_probs=19.9

Q ss_pred             CCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          53 PRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        53 k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ..|.|+.|++.--.        +.-+|  - |.|..|+..|+
T Consensus        34 ~ky~Cp~Cgk~~vk--------R~a~G--I-W~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTSVK--------RVATG--I-WKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSEEE--------EEETT--E-EEETTTTEEEE
T ss_pred             CCCcCCCCCCceeE--------EeeeE--E-eecCCCCCEEe
Confidence            46899999864211        11222  2 99999999887


No 198
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=23.74  E-value=11  Score=16.87  Aligned_cols=6  Identities=33%  Similarity=1.270  Sum_probs=2.1

Q ss_pred             eCCCCC
Q psy7447          56 QCPHCP   61 (114)
Q Consensus        56 ~C~~c~   61 (114)
                      .|..||
T Consensus        23 sC~~CG   28 (35)
T PF07503_consen   23 SCTNCG   28 (35)
T ss_dssp             -BTTCC
T ss_pred             cCCCCC
Confidence            344444


No 199
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=23.31  E-value=83  Score=14.09  Aligned_cols=14  Identities=36%  Similarity=0.980  Sum_probs=6.8

Q ss_pred             HHhcCCCCCeeCCCC
Q psy7447          46 TLECGKEPRYQCPHC   60 (114)
Q Consensus        46 ~~h~~~~k~~~C~~c   60 (114)
                      ....| ...|.|..|
T Consensus        22 ~~~~G-~qryrC~~C   35 (36)
T PF03811_consen   22 KSPSG-HQRYRCKDC   35 (36)
T ss_pred             CCCCC-CEeEecCcC
Confidence            33344 445666554


No 200
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=23.01  E-value=96  Score=21.36  Aligned_cols=10  Identities=40%  Similarity=0.992  Sum_probs=6.7

Q ss_pred             ceecCcchhh
Q psy7447          25 RYTCDSCGKV   34 (114)
Q Consensus        25 ~~~C~~C~~~   34 (114)
                      .-.|..||..
T Consensus       184 ~~~CPvCGs~  193 (305)
T TIGR01562       184 RTLCPACGSP  193 (305)
T ss_pred             CCcCCCCCCh
Confidence            3468888844


No 201
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=22.49  E-value=47  Score=22.65  Aligned_cols=31  Identities=29%  Similarity=0.565  Sum_probs=18.4

Q ss_pred             ecCcchhhcCCchHHHHHHHHhcCCCCCeeCCCCCcccCCc
Q psy7447          27 TCDSCGKVYKLKRSLYRHRTLECGKEPRYQCPHCPYRGKQK   67 (114)
Q Consensus        27 ~C~~C~~~f~~~~~l~~h~~~h~~~~k~~~C~~c~~~~~~~   67 (114)
                      +|..|+...-.+.     ..     ..-+.|+.|+.-|...
T Consensus        29 ~c~~c~~~~~~~~-----l~-----~~~~vc~~c~~h~rl~   59 (292)
T PRK05654         29 KCPSCGQVLYRKE-----LE-----ANLNVCPKCGHHMRIS   59 (292)
T ss_pred             ECCCccchhhHHH-----HH-----hcCCCCCCCCCCeeCC
Confidence            6888876532211     11     2235888999877654


No 202
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=22.42  E-value=32  Score=20.65  Aligned_cols=16  Identities=44%  Similarity=0.883  Sum_probs=12.5

Q ss_pred             CCceecCcchhhcCCc
Q psy7447          23 QFRYTCDSCGKVYKLK   38 (114)
Q Consensus        23 ~k~~~C~~C~~~f~~~   38 (114)
                      .++.+|..||..|...
T Consensus       110 g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen  110 GKPQRCPECGQVFKLK  125 (136)
T ss_dssp             TSEEEETTTEEEEEEE
T ss_pred             CCccCCCCCCeEEEEE
Confidence            4688999999888643


No 203
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=22.29  E-value=75  Score=22.07  Aligned_cols=12  Identities=8%  Similarity=-0.036  Sum_probs=7.5

Q ss_pred             ccccCCCccccc
Q psy7447          84 LSVKHQGPEMLS   95 (114)
Q Consensus        84 ~~C~~C~~~f~~   95 (114)
                      |.|..|...|..
T Consensus       389 Y~Ce~CK~~FC~  400 (421)
T COG5151         389 YQCELCKSTFCS  400 (421)
T ss_pred             eechhhhhhhhh
Confidence            666666666654


No 204
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=22.03  E-value=37  Score=14.98  Aligned_cols=11  Identities=9%  Similarity=0.178  Sum_probs=7.6

Q ss_pred             ccccCCCcccc
Q psy7447          84 LSVKHQGPEML   94 (114)
Q Consensus        84 ~~C~~C~~~f~   94 (114)
                      +.|+.|++.+.
T Consensus         5 ~~C~nC~R~v~   15 (33)
T PF08209_consen    5 VECPNCGRPVA   15 (33)
T ss_dssp             EE-TTTSSEEE
T ss_pred             EECCCCcCCcc
Confidence            67888888665


No 205
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=21.98  E-value=44  Score=22.38  Aligned_cols=27  Identities=19%  Similarity=0.252  Sum_probs=17.9

Q ss_pred             eCCCCCcccCCchHHHHHHHHhcCCCCcccccCCC
Q psy7447          56 QCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQG   90 (114)
Q Consensus        56 ~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~   90 (114)
                      .|+.||..+.....+.  --.      .|+|+.|-
T Consensus       222 ~CP~Cg~~W~L~~plh--~iF------dFKCD~CR  248 (258)
T PF10071_consen  222 KCPSCGGDWRLKEPLH--DIF------DFKCDPCR  248 (258)
T ss_pred             CCCCCCCccccCCchh--hce------eccCCcce
Confidence            6888888777766652  111      28888874


No 206
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=21.89  E-value=41  Score=16.51  Aligned_cols=15  Identities=0%  Similarity=-0.265  Sum_probs=7.2

Q ss_pred             ccccCCCcccccccc
Q psy7447          84 LSVKHQGPEMLSIKH   98 (114)
Q Consensus        84 ~~C~~C~~~f~~~~~   98 (114)
                      |.|+.|...|-..-.
T Consensus        22 y~C~~C~~~FC~dCD   36 (51)
T PF07975_consen   22 YRCPKCKNHFCIDCD   36 (51)
T ss_dssp             E--TTTT--B-HHHH
T ss_pred             EECCCCCCccccCcC
Confidence            999999988874433


No 207
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=21.62  E-value=38  Score=15.10  Aligned_cols=13  Identities=8%  Similarity=0.128  Sum_probs=6.8

Q ss_pred             ccccCCCcccccc
Q psy7447          84 LSVKHQGPEMLSI   96 (114)
Q Consensus        84 ~~C~~C~~~f~~~   96 (114)
                      -.|..|++.|+..
T Consensus         4 ~~C~eC~~~f~dS   16 (34)
T PF01286_consen    4 PKCDECGKPFMDS   16 (34)
T ss_dssp             EE-TTT--EES-S
T ss_pred             chHhHhCCHHHHH
Confidence            3688899988843


No 208
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=21.30  E-value=43  Score=22.05  Aligned_cols=17  Identities=29%  Similarity=0.835  Sum_probs=13.8

Q ss_pred             CCCceecCcchhhcCCc
Q psy7447          22 LQFRYTCDSCGKVYKLK   38 (114)
Q Consensus        22 ~~k~~~C~~C~~~f~~~   38 (114)
                      ..++.+|.+||..|...
T Consensus       178 EGkpqRCpECGqVFKLV  194 (268)
T PTZ00043        178 EGFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCCccCCCCCcEEEEE
Confidence            45788999999998754


No 209
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=21.29  E-value=18  Score=24.63  Aligned_cols=10  Identities=10%  Similarity=0.255  Sum_probs=6.1

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      |.|..||..+
T Consensus       287 ~~C~~Cg~~w  296 (299)
T TIGR01385       287 VTCEECGNRW  296 (299)
T ss_pred             EEcCCCCCee
Confidence            5666666544


No 210
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=21.17  E-value=41  Score=14.77  Aligned_cols=10  Identities=10%  Similarity=0.016  Sum_probs=6.4

Q ss_pred             ccccCCCccc
Q psy7447          84 LSVKHQGPEM   93 (114)
Q Consensus        84 ~~C~~C~~~f   93 (114)
                      +.|..|+..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            5666666655


No 211
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=20.99  E-value=1e+02  Score=20.62  Aligned_cols=16  Identities=19%  Similarity=0.760  Sum_probs=10.1

Q ss_pred             CCCeeCCCCCcccCCc
Q psy7447          52 EPRYQCPHCPYRGKQK   67 (114)
Q Consensus        52 ~k~~~C~~c~~~~~~~   67 (114)
                      .+.+.|+.||..+...
T Consensus       320 ~r~~~C~~cg~~~~rD  335 (364)
T COG0675         320 GRLFKCPRCGFVHDRD  335 (364)
T ss_pred             ceeEECCCCCCeehhh
Confidence            4456777777665554


No 212
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=20.97  E-value=44  Score=15.79  Aligned_cols=12  Identities=17%  Similarity=0.083  Sum_probs=9.7

Q ss_pred             ccccCCCccccc
Q psy7447          84 LSVKHQGPEMLS   95 (114)
Q Consensus        84 ~~C~~C~~~f~~   95 (114)
                      +.|+.||..+..
T Consensus        21 ~vC~~Cg~~~~~   32 (52)
T smart00661       21 FVCRKCGYEEPI   32 (52)
T ss_pred             EECCcCCCeEEC
Confidence            899999987653


No 213
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=20.65  E-value=70  Score=22.55  Aligned_cols=10  Identities=30%  Similarity=0.926  Sum_probs=4.7

Q ss_pred             CceecCcchh
Q psy7447          24 FRYTCDSCGK   33 (114)
Q Consensus        24 k~~~C~~C~~   33 (114)
                      ..++|+.|+.
T Consensus        13 ~~g~cp~c~~   22 (372)
T cd01121          13 WLGKCPECGE   22 (372)
T ss_pred             ccEECcCCCC
Confidence            3345555543


No 214
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=20.49  E-value=53  Score=15.81  Aligned_cols=8  Identities=0%  Similarity=-0.246  Sum_probs=2.9

Q ss_pred             ccccCCCc
Q psy7447          84 LSVKHQGP   91 (114)
Q Consensus        84 ~~C~~C~~   91 (114)
                      |.|+.|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            77777764


No 215
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=20.37  E-value=44  Score=18.59  Aligned_cols=31  Identities=16%  Similarity=0.417  Sum_probs=20.2

Q ss_pred             CCeeCCCCCcccCCchHHHHHHHHhcCCCCcccccCCCcccc
Q psy7447          53 PRYQCPHCPYRGKQKVHLKTHVAIKHQGPEMLSVKHQGPEML   94 (114)
Q Consensus        53 k~~~C~~c~~~~~~~~~l~~h~~~~~~~~p~~~C~~C~~~f~   94 (114)
                      ..|.|+.|++.--.        +.-+|  . |.|..|+..|+
T Consensus        34 a~y~CpfCgk~~vk--------R~a~G--I-W~C~~C~~~~A   64 (91)
T TIGR00280        34 AKYVCPFCGKKTVK--------RGSTG--I-WTCRKCGAKFA   64 (91)
T ss_pred             cCccCCCCCCCceE--------EEeeE--E-EEcCCCCCEEe
Confidence            46899999852111        22222  3 99999999887


No 216
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=20.20  E-value=40  Score=16.55  Aligned_cols=16  Identities=13%  Similarity=0.507  Sum_probs=8.8

Q ss_pred             CCCCceecCcchhhcC
Q psy7447          21 LLQFRYTCDSCGKVYK   36 (114)
Q Consensus        21 ~~~k~~~C~~C~~~f~   36 (114)
                      .....++|.+|++.+.
T Consensus        31 ~~~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   31 KEPIKLRCHYCERIIT   46 (52)
T ss_dssp             TTTCEEEETTT--EEE
T ss_pred             CCCCEEEeeCCCCEec
Confidence            3455677777776654


Done!