Query         psy7449
Match_columns 596
No_of_seqs    505 out of 3164
Neff          10.4
Searched_HMMs 46136
Date          Fri Aug 16 18:35:29 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7449.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7449hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1074|consensus              100.0 1.6E-31 3.4E-36  267.9   8.1  112   59-170   169-408 (958)
  2 KOG1074|consensus              100.0 5.2E-31 1.1E-35  264.2   7.6  236  348-584   605-936 (958)
  3 KOG2462|consensus               99.9 1.4E-27 3.1E-32  211.7   5.8  134  375-577   129-265 (279)
  4 KOG3608|consensus               99.9 3.1E-26 6.7E-31  207.6   7.0  193  229-432   181-379 (467)
  5 KOG3608|consensus               99.9 3.2E-26 6.9E-31  207.5   6.0  163  228-427   135-314 (467)
  6 KOG2462|consensus               99.9 6.3E-26 1.4E-30  201.3   6.9  142   56-199   127-271 (279)
  7 KOG3623|consensus               99.9   9E-24   2E-28  208.6   9.1   83  495-577   890-972 (1007)
  8 KOG3623|consensus               99.9 3.1E-23 6.6E-28  204.9   5.6  108   58-165   209-331 (1007)
  9 KOG3576|consensus               99.7   5E-18 1.1E-22  142.5   0.5  117  460-583   113-240 (267)
 10 KOG3576|consensus               99.6 3.8E-17 8.2E-22  137.3   1.8  116   56-171   114-240 (267)
 11 PHA00733 hypothetical protein   99.2 1.6E-11 3.5E-16  101.1   3.0   93  487-581    28-125 (128)
 12 PLN03086 PRLI-interacting fact  99.1 1.1E-10 2.4E-15  118.4   9.2  147  348-580   407-565 (567)
 13 PLN03086 PRLI-interacting fact  99.0   8E-10 1.7E-14  112.3   6.1   93   86-184   452-554 (567)
 14 PHA00733 hypothetical protein   98.9 9.6E-10 2.1E-14   90.6   4.7   53  113-167    71-123 (128)
 15 PHA02768 hypothetical protein;  98.9 6.6E-10 1.4E-14   74.1   1.3   42  500-543     6-47  (55)
 16 PHA02768 hypothetical protein;  98.8 1.4E-09   3E-14   72.6   1.8   44  527-572     5-48  (55)
 17 KOG1146|consensus               98.8 3.4E-09 7.4E-14  114.3   4.4   77  499-580  1260-1353(1406)
 18 KOG3993|consensus               98.7 1.3E-08 2.8E-13   96.3   3.9   84  348-432   267-383 (500)
 19 KOG3993|consensus               98.7   8E-09 1.7E-13   97.7   1.7  171  376-580   267-483 (500)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.6 1.4E-08   3E-13   57.9   0.8   24  543-566     2-25  (26)
 21 PF13465 zf-H2C2_2:  Zinc-finge  98.5 2.6E-08 5.7E-13   56.7   1.1   26  514-539     1-26  (26)
 22 PHA00616 hypothetical protein   98.4 6.6E-08 1.4E-12   61.2   0.6   33  527-559     1-33  (44)
 23 PHA00732 hypothetical protein   98.2 7.5E-07 1.6E-11   66.1   2.7   46  499-550     1-47  (79)
 24 PHA00616 hypothetical protein   98.1 1.2E-06 2.5E-11   55.6   1.8   34  255-288     1-34  (44)
 25 PHA00732 hypothetical protein   98.1 1.6E-06 3.5E-11   64.3   2.8   49  527-581     1-50  (79)
 26 PF05605 zf-Di19:  Drought indu  98.0 4.9E-06 1.1E-10   57.4   3.0   50  377-429     3-53  (54)
 27 PF05605 zf-Di19:  Drought indu  97.9 7.7E-06 1.7E-10   56.4   3.1   50  528-580     3-54  (54)
 28 PF00096 zf-C2H2:  Zinc finger,  97.6 1.7E-05 3.7E-10   43.9   0.3   18  558-575     3-20  (23)
 29 PF00096 zf-C2H2:  Zinc finger,  97.5 6.3E-05 1.4E-09   41.5   1.6   23  256-278     1-23  (23)
 30 PF13894 zf-C2H2_4:  C2H2-type   97.4 6.3E-05 1.4E-09   42.0   1.4   24  556-579     1-24  (24)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.4 7.7E-05 1.7E-09   59.6   2.0   74  501-579     1-74  (100)
 32 PF13912 zf-C2H2_6:  C2H2-type   97.3 0.00013 2.8E-09   42.1   1.3   26  555-580     1-26  (27)
 33 COG5189 SFP1 Putative transcri  97.3 9.5E-05 2.1E-09   67.8   1.1   55  373-427   346-420 (423)
 34 COG5189 SFP1 Putative transcri  97.2 0.00012 2.5E-09   67.3   1.2   54  526-579   348-422 (423)
 35 PF13894 zf-C2H2_4:  C2H2-type   97.1 0.00025 5.4E-09   39.5   1.7   24  406-429     1-24  (24)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.1 0.00018 3.8E-09   41.5   0.7   24  527-550     1-24  (27)
 37 PF12756 zf-C2H2_2:  C2H2 type   97.1 0.00033 7.2E-09   55.9   2.3   24  143-166    50-73  (100)
 38 PF09237 GAGA:  GAGA factor;  I  96.5  0.0015 3.3E-08   42.4   1.5   30  525-554    22-51  (54)
 39 KOG2231|consensus               96.5   0.002 4.2E-08   67.3   3.1   22  350-371   184-205 (669)
 40 smart00355 ZnF_C2H2 zinc finge  96.3   0.002 4.3E-08   36.5   1.4   18  558-575     3-20  (26)
 41 PF13909 zf-H2C2_5:  C2H2-type   96.3  0.0015 3.4E-08   36.3   0.7   24  556-580     1-24  (24)
 42 PRK04860 hypothetical protein;  96.2  0.0018 3.9E-08   55.6   0.9   39  498-540   118-156 (160)
 43 PF09237 GAGA:  GAGA factor;  I  96.1  0.0055 1.2E-07   39.9   2.5   39  393-431    12-50  (54)
 44 KOG2231|consensus               96.0  0.0068 1.5E-07   63.4   4.1  147  377-576   100-260 (669)
 45 smart00355 ZnF_C2H2 zinc finge  95.9  0.0086 1.9E-07   33.7   2.6   23  256-278     1-23  (26)
 46 PRK04860 hypothetical protein;  95.8  0.0045 9.8E-08   53.2   1.7   40  527-570   119-158 (160)
 47 COG5236 Uncharacterized conser  95.8   0.007 1.5E-07   56.6   2.8  133  256-432   152-308 (493)
 48 PF12874 zf-met:  Zinc-finger o  95.6  0.0053 1.1E-07   34.5   0.8   22  556-577     1-22  (25)
 49 PF13909 zf-H2C2_5:  C2H2-type   95.6  0.0044 9.5E-08   34.4   0.5   22  528-550     1-22  (24)
 50 KOG1146|consensus               95.5   0.006 1.3E-07   67.6   1.8   53  378-430   438-490 (1406)
 51 PF12874 zf-met:  Zinc-finger o  95.5  0.0047   1E-07   34.7   0.5   22  500-521     1-22  (25)
 52 COG5236 Uncharacterized conser  95.3   0.015 3.2E-07   54.6   3.1   73  501-581   222-307 (493)
 53 KOG2785|consensus               95.2   0.026 5.7E-07   54.2   4.7   26  499-524   166-191 (390)
 54 KOG2785|consensus               95.2   0.016 3.4E-07   55.7   3.0   54  375-428   165-243 (390)
 55 KOG2482|consensus               95.1    0.04 8.6E-07   51.8   5.4   23  143-165   195-217 (423)
 56 KOG2482|consensus               95.1   0.028 6.1E-07   52.8   4.3  181  241-427   129-356 (423)
 57 PF12171 zf-C2H2_jaz:  Zinc-fin  94.9   0.012 2.6E-07   33.8   0.8   22  500-521     2-23  (27)
 58 PF12171 zf-C2H2_jaz:  Zinc-fin  94.7   0.016 3.4E-07   33.2   1.0   22  528-549     2-23  (27)
 59 COG5048 FOG: Zn-finger [Genera  93.5     0.1 2.2E-06   54.4   5.2  158  375-563   288-454 (467)
 60 COG5048 FOG: Zn-finger [Genera  92.6    0.07 1.5E-06   55.7   2.4  154  114-290   288-453 (467)
 61 PF13913 zf-C2HC_2:  zinc-finge  92.2    0.11 2.4E-06   29.0   1.7   21   60-81      3-23  (25)
 62 PF13913 zf-C2HC_2:  zinc-finge  91.6    0.17 3.8E-06   28.2   2.1   20  256-276     3-22  (25)
 63 smart00451 ZnF_U1 U1-like zinc  91.3    0.15 3.2E-06   31.3   1.8   24  555-578     3-26  (35)
 64 KOG2893|consensus               90.1    0.12 2.7E-06   45.9   0.9   48  349-400    11-58  (341)
 65 cd00350 rubredoxin_like Rubred  89.0     0.3 6.5E-06   29.5   1.7   10  500-509     2-11  (33)
 66 cd00350 rubredoxin_like Rubred  88.5    0.35 7.6E-06   29.2   1.8   10  465-474     2-11  (33)
 67 smart00451 ZnF_U1 U1-like zinc  88.0    0.39 8.5E-06   29.3   1.9   21  116-136     4-24  (35)
 68 KOG4173|consensus               87.7    0.13 2.7E-06   44.8  -0.7   83  498-583    78-174 (253)
 69 TIGR00622 ssl1 transcription f  86.7     1.9   4E-05   34.4   5.3   23  555-577    81-103 (112)
 70 KOG2893|consensus               85.9    0.37 8.1E-06   42.9   1.2   42  229-274    12-53  (341)
 71 KOG4173|consensus               85.8    0.19 4.2E-06   43.7  -0.5   81  349-432    80-173 (253)
 72 COG4049 Uncharacterized protei  84.7    0.35 7.5E-06   32.2   0.4   29  552-580    14-42  (65)
 73 TIGR00622 ssl1 transcription f  83.7     2.3   5E-05   33.8   4.6   19  308-327    14-32  (112)
 74 KOG1280|consensus               83.4     1.3 2.8E-05   42.3   3.6   41  553-594    77-117 (381)
 75 PF12013 DUF3505:  Protein of u  83.0     1.2 2.6E-05   35.9   2.9   25  406-430    81-109 (109)
 76 PF09986 DUF2225:  Uncharacteri  82.0    0.65 1.4E-05   42.6   1.2   44  375-418     4-61  (214)
 77 PF12013 DUF3505:  Protein of u  81.1     1.3 2.9E-05   35.6   2.6   25  348-372    80-108 (109)
 78 COG4049 Uncharacterized protei  80.9    0.76 1.6E-05   30.6   0.8   29  402-430    14-42  (65)
 79 PHA00626 hypothetical protein   80.7     1.3 2.7E-05   29.8   1.8   12  499-510    23-34  (59)
 80 cd00729 rubredoxin_SM Rubredox  77.8     1.7 3.7E-05   26.4   1.7    8  528-535    19-26  (34)
 81 PF10571 UPF0547:  Uncharacteri  77.5     1.9   4E-05   24.3   1.6   11  349-359    15-25  (26)
 82 PF09986 DUF2225:  Uncharacteri  75.4     1.6 3.4E-05   40.1   1.6   43  526-568     4-61  (214)
 83 PF09538 FYDLN_acid:  Protein o  74.2     2.3 4.9E-05   33.9   2.0   15  526-540    25-39  (108)
 84 COG2888 Predicted Zn-ribbon RN  72.7     3.7 7.9E-05   28.2   2.3    9  499-507    27-35  (61)
 85 PRK00464 nrdR transcriptional   72.4     1.4   3E-05   37.7   0.4   16  528-543    29-44  (154)
 86 PRK00398 rpoP DNA-directed RNA  70.8     3.5 7.5E-05   27.1   1.9   13  464-476     3-15  (46)
 87 PF03604 DNA_RNApol_7kD:  DNA d  69.4     4.9 0.00011   24.0   2.1   12  465-476     1-12  (32)
 88 PF09538 FYDLN_acid:  Protein o  69.1     4.1 8.8E-05   32.5   2.3   30  256-296    10-39  (108)
 89 PRK14890 putative Zn-ribbon RN  67.8       8 0.00017   26.7   3.1   10  499-508    25-34  (59)
 90 PF02892 zf-BED:  BED zinc fing  66.9     3.8 8.3E-05   26.6   1.5   26  554-579    15-44  (45)
 91 KOG2186|consensus               66.4       3 6.4E-05   38.1   1.2   46  500-548     4-49  (276)
 92 smart00659 RPOLCX RNA polymera  66.1     5.2 0.00011   26.0   2.0   11  465-475     3-13  (44)
 93 COG1592 Rubrerythrin [Energy p  65.7     3.9 8.5E-05   35.3   1.8   22  349-383   135-156 (166)
 94 KOG2186|consensus               65.6     3.2 6.9E-05   37.9   1.2   46  116-164     4-49  (276)
 95 PF13719 zinc_ribbon_5:  zinc-r  65.1     6.7 0.00015   24.3   2.3   10  256-265    26-35  (37)
 96 TIGR02605 CxxC_CxxC_SSSS putat  65.0     3.6 7.8E-05   27.8   1.2   11  500-510     6-16  (52)
 97 PRK00464 nrdR transcriptional   64.8     4.2 9.2E-05   34.8   1.8   19  499-517    28-46  (154)
 98 PF09723 Zn-ribbon_8:  Zinc rib  63.3     3.3 7.2E-05   26.5   0.7   13  172-184     6-18  (42)
 99 PRK09678 DNA-binding transcrip  63.3     2.1 4.5E-05   31.2  -0.3   40  500-541     2-43  (72)
100 PF12907 zf-met2:  Zinc-binding  63.2       4 8.7E-05   25.8   1.0   32  556-587     2-36  (40)
101 PF13717 zinc_ribbon_4:  zinc-r  63.0     8.5 0.00019   23.7   2.4   10  256-265    26-35  (36)
102 PF01352 KRAB:  KRAB box;  Inte  62.8     3.5 7.5E-05   26.3   0.7   20   19-38     21-40  (41)
103 PRK09678 DNA-binding transcrip  61.6     3.2 6.9E-05   30.2   0.4   17  498-514    26-44  (72)
104 PF05443 ROS_MUCR:  ROS/MUCR tr  61.1     3.7   8E-05   34.1   0.7   25  556-583    73-97  (132)
105 smart00531 TFIIE Transcription  60.9     5.8 0.00013   33.9   2.0   13  499-511    99-111 (147)
106 TIGR02098 MJ0042_CXXC MJ0042 f  59.4       9  0.0002   23.8   2.2   10  256-265    26-35  (38)
107 COG1592 Rubrerythrin [Energy p  59.2     6.5 0.00014   34.0   1.9   24  499-535   134-157 (166)
108 TIGR02300 FYDLN_acid conserved  58.7     7.7 0.00017   31.5   2.1   12  527-538    26-37  (129)
109 TIGR00373 conserved hypothetic  58.0     6.3 0.00014   34.1   1.7   17  527-543   109-125 (158)
110 TIGR00373 conserved hypothetic  57.6     9.2  0.0002   33.1   2.6   16  349-364   110-125 (158)
111 KOG2807|consensus               56.1      13 0.00028   35.5   3.4   24  255-278   345-368 (378)
112 smart00834 CxxC_CXXC_SSSS Puta  55.8     5.8 0.00013   25.0   0.9   10  144-153     6-15  (41)
113 PF15269 zf-C2H2_7:  Zinc-finge  55.5      15 0.00032   23.5   2.5   27  344-370    16-42  (54)
114 TIGR02300 FYDLN_acid conserved  55.4     8.9 0.00019   31.2   2.0   31   59-100     9-39  (129)
115 COG1996 RPC10 DNA-directed RNA  55.3     6.3 0.00014   26.1   0.9   10  500-509     7-16  (49)
116 smart00531 TFIIE Transcription  55.1      13 0.00027   31.9   3.1   13  376-388    99-111 (147)
117 TIGR01384 TFS_arch transcripti  55.1     8.1 0.00018   30.7   1.8   11  556-566    91-101 (104)
118 PRK04023 DNA polymerase II lar  54.9      12 0.00026   41.7   3.5   11  556-566   664-674 (1121)
119 smart00734 ZnF_Rad18 Rad18-lik  54.8      11 0.00023   21.3   1.7   19  557-576     3-21  (26)
120 PF14353 CpXC:  CpXC protein     54.2     2.2 4.8E-05   35.5  -1.7   13  465-477     2-14  (128)
121 COG1997 RPL43A Ribosomal prote  53.3     8.3 0.00018   28.9   1.4   13  404-416    52-64  (89)
122 PRK06266 transcription initiat  51.2     9.2  0.0002   33.8   1.7   16  528-543   118-133 (178)
123 smart00614 ZnF_BED BED zinc fi  50.9      10 0.00023   25.3   1.5   23  557-579    20-47  (50)
124 PRK06266 transcription initiat  50.4      14  0.0003   32.7   2.7   16  376-391   117-132 (178)
125 PF07754 DUF1610:  Domain of un  48.1      16 0.00035   20.1   1.7   10  498-507    15-24  (24)
126 PF14353 CpXC:  CpXC protein     47.8     4.7  0.0001   33.6  -0.7   19  528-546    39-57  (128)
127 PF06524 NOA36:  NOA36 protein;  47.0      13 0.00028   34.2   1.8   14  278-291   137-150 (314)
128 PF15269 zf-C2H2_7:  Zinc-finge  46.9      14  0.0003   23.5   1.5   24  498-521    19-42  (54)
129 PF06524 NOA36:  NOA36 protein;  46.8      13 0.00028   34.2   1.9   60  226-303   170-229 (314)
130 PRK14714 DNA polymerase II lar  46.0      22 0.00048   40.9   3.8   41  500-566   680-720 (1337)
131 KOG2593|consensus               45.0      14  0.0003   37.0   1.9   37  523-562   124-160 (436)
132 COG5151 SSL1 RNA polymerase II  45.0      21 0.00046   33.7   3.0   47  378-427   364-410 (421)
133 KOG2071|consensus               44.4      16 0.00034   38.3   2.3   26  498-523   417-442 (579)
134 KOG2593|consensus               43.8      27  0.0006   35.0   3.7   15   58-72    127-141 (436)
135 PF05495 zf-CHY:  CHY zinc fing  43.6      11 0.00023   27.6   0.7   11  465-475    11-21  (71)
136 PRK04023 DNA polymerase II lar  42.1      23 0.00049   39.7   3.1    8  256-263   639-646 (1121)
137 PF04959 ARS2:  Arsenite-resist  42.0      11 0.00025   34.2   0.8   26  555-580    77-102 (214)
138 KOG4124|consensus               42.0     7.3 0.00016   37.3  -0.4   54  374-427   347-420 (442)
139 COG1198 PriA Primosomal protei  41.3      19 0.00041   39.6   2.4    9  282-290   474-482 (730)
140 PF01780 Ribosomal_L37ae:  Ribo  40.5     9.9 0.00022   29.0   0.2   13  404-416    52-64  (90)
141 PF02176 zf-TRAF:  TRAF-type zi  40.2      21 0.00046   24.7   1.8    6  103-108    26-31  (60)
142 PF12760 Zn_Tnp_IS1595:  Transp  39.2      27 0.00059   22.8   2.1   11  553-563    35-45  (46)
143 COG4957 Predicted transcriptio  38.9      15 0.00033   30.0   1.0   23  557-582    78-100 (148)
144 PTZ00255 60S ribosomal protein  38.5      14 0.00031   28.1   0.7   14  404-417    53-66  (90)
145 PF13240 zinc_ribbon_2:  zinc-r  38.2      18 0.00039   19.7   0.9    8  467-474     2-9   (23)
146 PF05443 ROS_MUCR:  ROS/MUCR tr  38.0      12 0.00027   31.0   0.4   24  528-554    73-96  (132)
147 PF05191 ADK_lid:  Adenylate ki  37.8      24 0.00051   21.8   1.5   10  528-537    22-31  (36)
148 PF03811 Zn_Tnp_IS1:  InsA N-te  37.5      35 0.00075   21.1   2.2   19  487-505    17-35  (36)
149 PF08274 PhnA_Zn_Ribbon:  PhnA   37.0      17 0.00036   21.4   0.7   11  466-476     4-14  (30)
150 TIGR00280 L37a ribosomal prote  36.7      15 0.00032   28.1   0.6   15  403-417    51-65  (91)
151 PF04959 ARS2:  Arsenite-resist  36.3      19 0.00041   32.8   1.3   26  405-430    77-102 (214)
152 PF00301 Rubredoxin:  Rubredoxi  36.2      36 0.00077   22.5   2.2   12  465-476     2-13  (47)
153 COG4530 Uncharacterized protei  35.6      23 0.00051   27.7   1.5   12  498-509    25-36  (129)
154 PRK14714 DNA polymerase II lar  34.3      37  0.0008   39.2   3.3   11  376-386   692-702 (1337)
155 COG1198 PriA Primosomal protei  33.9      32  0.0007   37.8   2.8    9  465-473   436-444 (730)
156 KOG2272|consensus               33.6      23 0.00049   32.4   1.3   28  172-199   100-127 (332)
157 KOG4377|consensus               33.5      32  0.0007   34.0   2.4   64   60-126   272-360 (480)
158 KOG2272|consensus               33.4      37  0.0008   31.1   2.6  127   58-189    98-239 (332)
159 PRK00432 30S ribosomal protein  33.2      33 0.00071   23.0   1.7   11  499-509    37-47  (50)
160 PF14446 Prok-RING_1:  Prokaryo  32.3      30 0.00066   23.5   1.4   25  116-152     6-30  (54)
161 COG5151 SSL1 RNA polymerase II  32.2      73  0.0016   30.3   4.3   25  347-371   387-411 (421)
162 PF13453 zf-TFIIB:  Transcripti  32.2      26 0.00057   22.2   1.1   20  554-573    18-37  (41)
163 PRK03976 rpl37ae 50S ribosomal  31.3      19 0.00041   27.5   0.4   15  403-417    52-66  (90)
164 PF01096 TFIIS_C:  Transcriptio  30.9      22 0.00048   22.3   0.6   11  499-509    28-38  (39)
165 PRK03824 hypA hydrogenase nick  30.6      38 0.00083   28.4   2.1   14  463-476    69-82  (135)
166 PF02176 zf-TRAF:  TRAF-type zi  30.4      53  0.0012   22.6   2.6   21  156-176    23-43  (60)
167 cd00730 rubredoxin Rubredoxin;  29.9      43 0.00093   22.5   1.8   12  465-476     2-13  (50)
168 KOG2807|consensus               29.6      63  0.0014   31.1   3.5   20  376-395   345-364 (378)
169 PF08790 zf-LYAR:  LYAR-type C2  28.3      30 0.00064   19.9   0.7    9  501-509     2-10  (28)
170 PF09845 DUF2072:  Zn-ribbon co  28.3      34 0.00074   28.1   1.4   13  464-476     1-13  (131)
171 smart00440 ZnF_C2C2 C2C2 Zinc   28.1      47   0.001   21.0   1.7   11  499-509    28-38  (40)
172 PF15135 UPF0515:  Uncharacteri  28.1      65  0.0014   29.7   3.2   12  349-360   156-167 (278)
173 KOG4167|consensus               27.3      17 0.00038   38.7  -0.5   25  255-279   792-816 (907)
174 smart00661 RPOL9 RNA polymeras  27.0      53  0.0012   21.9   2.0   13  499-511    20-32  (52)
175 PF07975 C1_4:  TFIIH C1-like d  26.7      32 0.00069   23.2   0.8   20  376-395    21-40  (51)
176 KOG3362|consensus               26.0      25 0.00055   29.1   0.3   22  499-520   129-150 (156)
177 PF13451 zf-trcl:  Probable zin  25.8      29 0.00064   23.1   0.5   10  377-386     5-14  (49)
178 KOG4167|consensus               25.5      19 0.00042   38.4  -0.6   27   57-83    790-816 (907)
179 TIGR01562 FdhE formate dehydro  25.4      48   0.001   32.2   2.1   75  463-564   183-261 (305)
180 PF07649 C1_3:  C1-like domain;  25.1      50  0.0011   19.1   1.4   11  226-236    14-24  (30)
181 PF08271 TF_Zn_Ribbon:  TFIIB z  24.4      38 0.00083   21.7   0.9    9  406-414    20-28  (43)
182 PF04216 FdhE:  Protein involve  24.1      16 0.00035   35.5  -1.4   75  464-563   172-246 (290)
183 COG3677 Transposase and inacti  23.8      54  0.0012   27.3   1.8   13  498-510    52-64  (129)
184 PRK03564 formate dehydrogenase  23.5      73  0.0016   31.0   2.9   78  461-566   184-263 (309)
185 COG2331 Uncharacterized protei  23.3      40 0.00086   24.6   0.8   10  144-153    13-22  (82)
186 PRK03681 hypA hydrogenase nick  23.3      52  0.0011   26.6   1.6   11  465-475    71-81  (114)
187 PF03833 PolC_DP2:  DNA polymer  22.9      28 0.00061   38.2   0.0   11  527-537   680-690 (900)
188 TIGR00595 priA primosomal prot  22.8      56  0.0012   34.6   2.2   47  193-290   214-260 (505)
189 COG0068 HypF Hydrogenase matur  22.2      27 0.00058   37.6  -0.3   73  466-562   103-180 (750)
190 TIGR00100 hypA hydrogenase nic  22.2      50  0.0011   26.8   1.3   12  500-511    71-82  (115)
191 KOG4124|consensus               22.1      28 0.00062   33.5  -0.1   24  553-576   396-419 (442)
192 PF05290 Baculo_IE-1:  Baculovi  22.1      49  0.0011   27.2   1.2   15   85-99     78-92  (140)
193 cd00065 FYVE FYVE domain; Zinc  21.9      65  0.0014   21.9   1.7   11  501-511     4-14  (57)
194 KOG3408|consensus               21.8      34 0.00074   27.5   0.3   25  524-548    54-78  (129)
195 KOG2461|consensus               21.6 2.2E+02  0.0049   28.9   6.0   69  494-562   326-394 (396)
196 PF01286 XPA_N:  XPA protein N-  21.4      39 0.00085   20.5   0.4    8  467-474     6-13  (34)
197 KOG1701|consensus               21.0      20 0.00044   35.7  -1.4   36  285-320   396-438 (468)
198 PRK14873 primosome assembly pr  21.0      64  0.0014   35.4   2.2   46  193-290   384-429 (665)
199 PF11789 zf-Nse:  Zinc-finger o  20.9      53  0.0011   22.7   1.0   15  499-513    24-38  (57)
200 COG3364 Zn-ribbon containing p  20.7      54  0.0012   25.4   1.1   14  376-389     2-15  (112)
201 PF06220 zf-U1:  U1 zinc finger  20.6      73  0.0016   19.9   1.5   22  555-576     3-26  (38)
202 PRK12380 hydrogenase nickel in  20.2      64  0.0014   26.1   1.6   11  465-475    71-81  (113)
203 smart00064 FYVE Protein presen  20.2      66  0.0014   22.9   1.5   26  501-538    12-37  (68)
204 PF01363 FYVE:  FYVE zinc finge  20.2      55  0.0012   23.5   1.1   10  465-474    10-19  (69)
205 TIGR01206 lysW lysine biosynth  20.1      49  0.0011   22.6   0.7   10  144-153     3-12  (54)
206 PF13878 zf-C2H2_3:  zinc-finge  20.1      82  0.0018   20.0   1.7   10  117-126    15-24  (41)

No 1  
>KOG1074|consensus
Probab=99.97  E-value=1.6e-31  Score=267.93  Aligned_cols=112  Identities=18%  Similarity=0.193  Sum_probs=94.6

Q ss_pred             ccccccccccccCchHHHhHHhhhcCCCCcccCcCcccccChhHHHHHHhhcCCC-------------------------
Q psy7449          59 KNTCCICGHVESGAWRLKRHFLKHTGEKSYECCWCTYKTAYENDLKKHQRKHTGE-------------------------  113 (596)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-------------------------  113 (596)
                      +-.|..|...|.+...+..+++.|..+.++.|..|+..|....+|..+.-.+...                         
T Consensus       169 ~~~~~~s~~~~~t~s~~~~~lrqhl~qq~~~~~~~~q~~~a~~s~~~~~~~~~~~~e~Pq~~~e~~~kp~ng~~~p~~l~  248 (958)
T KOG1074|consen  169 PPGVGSSHLNIPTISEELRVLRQHLIQQMQMTEQICQQVLALGSLGQTVGAPASPSELPQTGTESSTKPLNGLFSPIKLV  248 (958)
T ss_pred             CCCCCccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccccCCCChhhcCCCCCcccccccCCCCCccccc
Confidence            4468889999999999999999999999999999999888888877764322100                         


Q ss_pred             --------------------------------------------------------------------------------
Q psy7449         114 --------------------------------------------------------------------------------  113 (596)
Q Consensus       114 --------------------------------------------------------------------------------  113 (596)
                                                                                                      
T Consensus       249 ~~~~~d~pS~s~~ss~a~~~~~~~~~~~~~~~~~~~~~s~~s~~S~~~~~~~~~~~~~~P~~l~~~~~~~~~~~~~s~sa  328 (958)
T KOG1074|consen  249 QTSKADSPSSSSSSSGAETPKQAFFHLYHELGSQMAFSSGGSLASHPPTPAPPPAAPAFPSPLGLLAQTEEAARGLSGSA  328 (958)
T ss_pred             cCCccCCcccccccccccCccccccccccccccccchhhcCccccCCCCCCCCcccCCCCCCccccccchhhhccccccc
Confidence                                                                                            


Q ss_pred             -----------------------CCcccCCCCccccChhHHHHHhhhccCCCCccCCCCCccccCchhHHhHhhhccCCC
Q psy7449         114 -----------------------KPYSCGHCPYTARSSSYMLTHLKVHSGEKAFKCEYCSYSSYSKSNLRTHMRTHIGEK  170 (596)
Q Consensus       114 -----------------------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~  170 (596)
                                             -+.+|.+|.+.|.+.+.|..|++.|+|++||+|++||..|.++.+|+.|...|...-
T Consensus       329 ~p~~~k~~~~~~~~v~~~~~~~~~khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH~~rH~e~~  408 (958)
T KOG1074|consen  329 SPGLLKEKNGSYFSVEGPSEKPFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVHFQRHREKY  408 (958)
T ss_pred             CcccCCcccccccccccCCccccccchhhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeeeeeeccccC
Confidence                                   006799999999999999999999999999999999999999999999998876543


No 2  
>KOG1074|consensus
Probab=99.97  E-value=5.2e-31  Score=264.22  Aligned_cols=236  Identities=23%  Similarity=0.328  Sum_probs=158.8

Q ss_pred             CcccCCCCCcccCHHHHHHhhhhcCCCCccccCccccccccchhhhhhhhcccCCC----CcccCC---CCcccccchhh
Q psy7449         348 NYVCYTCDYHTGVRECMKKHIRTHTGEKPFKCTHCRYSASRRDTLDHHIQVSHLYK----KRFQCP---VCDYRCTKKYN  420 (596)
Q Consensus       348 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~L~~H~~~~H~~~----~~~~C~---~C~~~f~~~~~  420 (596)
                      .-+|-+|-++.+-.++|+.|.++|+||+||+|.+||++|.++.+|+.|| ..|...    -.+.|+   +|-+.|.+...
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~-~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHM-SVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcc-cccccCccccccccCCchhhhccccccccc
Confidence            4689999999999999999999999999999999999999999999995 456544    348999   99999999999


Q ss_pred             HHHHhhhcccCCCC-----------CCCcccCCcccccccCCCCcccc---------------ccCCcc----ceecCCC
Q psy7449         421 LQMHALTKHDLDIK-----------SDGIIQDAGTYILDTALSPEKRV---------------KSRGHE----TVICHHC  470 (596)
Q Consensus       421 l~~H~~~~H~~~~~-----------~~~~~~~~~~~~~~~~l~~~~~~---------------~~~~~~----~~~C~~C  470 (596)
                      |..|++.|-++...           .+.|..|.+.|.....+..++..               ..+++.    +..+..|
T Consensus       684 lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~  763 (958)
T KOG1074|consen  684 LPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSC  763 (958)
T ss_pred             ccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccc
Confidence            99999995433321           23456666666443333332220               111111    4556667


Q ss_pred             Ccccccchhhhcccccc--cc--------------CCCCCCCCCcc-cCCCCCccccccchhh----hh-----------
Q psy7449         471 RDLLPYKIKDLVSHGEL--CS--------------GVPRPDGSFRF-VCFTCNYHTYKSGHMR----QH-----------  518 (596)
Q Consensus       471 ~~~~~~~~~~~~~~~~l--~~--------------h~~~~~~~~~~-~C~~C~~~f~~~~~l~----~H-----------  518 (596)
                      +..+.......+.-..-  ..              .....+++++. .+.+++-.-...-...    .=           
T Consensus       764 ~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t  843 (958)
T KOG1074|consen  764 GRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLAT  843 (958)
T ss_pred             ccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccc
Confidence            76665532222111100  00              01112334455 5666653322111100    00           


Q ss_pred             ---hhccCCC------------------------CCccCCCCCccccCchhhhhhhhhccCCCcccCCccCcCccChhhH
Q psy7449         519 ---INGHVGI------------------------KPYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCDLKFSQNSQL  571 (596)
Q Consensus       519 ---~~~H~~~------------------------~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~l  571 (596)
                         ..++.+.                        ....|.+||+.|...++|..||++|+|++||.|.+|++.|..+..|
T Consensus       844 ~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnL  923 (958)
T KOG1074|consen  844 KTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNL  923 (958)
T ss_pred             ccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhh
Confidence               0000000                        1167999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCCCCCC
Q psy7449         572 KYHLTTRHDLPDM  584 (596)
Q Consensus       572 ~~H~~~~H~~~~~  584 (596)
                      +.||.+|+..-|.
T Consensus       924 KvHMgtH~w~q~~  936 (958)
T KOG1074|consen  924 KVHMGTHMWVQPP  936 (958)
T ss_pred             hhhhccccccCCC
Confidence            9999999865443


No 3  
>KOG2462|consensus
Probab=99.94  E-value=1.4e-27  Score=211.67  Aligned_cols=134  Identities=31%  Similarity=0.533  Sum_probs=119.3

Q ss_pred             CccccCccccccccchhhhhhhhcccC---CCCcccCCCCcccccchhhHHHHhhhcccCCCCCCCcccCCcccccccCC
Q psy7449         375 KPFKCTHCRYSASRRDTLDHHIQVSHL---YKKRFQCPVCDYRCTKKYNLQMHALTKHDLDIKSDGIIQDAGTYILDTAL  451 (596)
Q Consensus       375 k~~~C~~C~~~f~~~~~L~~H~~~~H~---~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~l  451 (596)
                      ..|+|+.||+.+.+.++|.+|.+ .|-   ..+.+.|++|||.|.+...|.+|+++ |+                     
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ-~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT-H~---------------------  185 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQ-THRSLDSKKAFSCKYCGKVYVSMPALKMHIRT-HT---------------------  185 (279)
T ss_pred             Cceeccccccccccccccchhhc-ccccccccccccCCCCCceeeehHHHhhHhhc-cC---------------------
Confidence            45888888888888888888844 442   24669999999999999999999988 43                     


Q ss_pred             CCccccccCCccceecCCCCcccccchhhhccccccccCCCCCCCCCcccCCCCCccccccchhhhhhhccCCCCCccCC
Q psy7449         452 SPEKRVKSRGHETVICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCL  531 (596)
Q Consensus       452 ~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~  531 (596)
                                                                    .+++|.+|||.|...+.|+-|+|+|+|||||.|+
T Consensus       186 ----------------------------------------------l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~  219 (279)
T KOG2462|consen  186 ----------------------------------------------LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCP  219 (279)
T ss_pred             ----------------------------------------------CCcccccccccccchHHhhcccccccCCCCccCC
Confidence                                                          2478999999999999999999999999999999


Q ss_pred             CCCccccCchhhhhhhhhccCCCcccCCccCcCccChhhHHHHHhh
Q psy7449         532 HCSYKSTQSSCLGRHMRIHTGEKPYACSLCDLKFSQNSQLKYHLTT  577 (596)
Q Consensus       532 ~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~l~~H~~~  577 (596)
                      +|+++|.++++|+.||++|.+.++|+|..|++.|..++.|.+|+..
T Consensus       220 hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  220 HCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999999999999999999999999999764


No 4  
>KOG3608|consensus
Probab=99.93  E-value=3.1e-26  Score=207.57  Aligned_cols=193  Identities=26%  Similarity=0.508  Sum_probs=178.1

Q ss_pred             ecCCCCccCCChHHHHhhhhhcCCCCCccCccCcccccChHHHHHHHHHhc--CCCceeeCCCCCccccccccccccccc
Q psy7449         229 QCYSCEYHSLYSSRMIKHIRNHTGERPFQCKICDSTFKRKQTLDLHIKRHT--GERTYKCEFCDYTAARKDTLGVHVRIK  306 (596)
Q Consensus       229 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~~  306 (596)
                      ....|.+.+.+++.|++|++.|++++...|+.||.-|.++..|-.|+++-+  ...+|.|..|.|.|.++..|..|+..+
T Consensus       181 ~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rH  260 (467)
T KOG3608|consen  181 NWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRH  260 (467)
T ss_pred             cchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHh
Confidence            446799999999999999999999999999999999999999999987643  456899999999999999999999999


Q ss_pred             ccccccCCcccccchhhHHHHHHhhhcCCCCCCCCCCCCCCCcccCCCCCcccCHHHHHHhhhhcCCCCccccCc--ccc
Q psy7449         307 HKISICQNCGLILSTITEELLEHCRICSGKERPDSSTDKSFNYVCYTCDYHTGVRECMKKHIRTHTGEKPFKCTH--CRY  384 (596)
Q Consensus       307 h~~~~C~~C~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~--C~~  384 (596)
                      -.-|.|+.|+...+. .++|..|++.-+.+.+|         |+|+.|++.+.+.+.|.+|..+|. +..|.|..  |.+
T Consensus       261 vn~ykCplCdmtc~~-~ssL~~H~r~rHs~dkp---------fKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~  329 (467)
T KOG3608|consen  261 VNCYKCPLCDMTCSS-ASSLTTHIRYRHSKDKP---------FKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHY  329 (467)
T ss_pred             hhcccccccccCCCC-hHHHHHHHHhhhccCCC---------ccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcH
Confidence            999999999999998 89999999987777788         999999999999999999999988 67899998  999


Q ss_pred             ccccchhhhhhhhcccCCC--CcccCCCCcccccchhhHHHHhhhcccCC
Q psy7449         385 SASRRDTLDHHIQVSHLYK--KRFQCPVCDYRCTKKYNLQMHALTKHDLD  432 (596)
Q Consensus       385 ~f~~~~~L~~H~~~~H~~~--~~~~C~~C~~~f~~~~~l~~H~~~~H~~~  432 (596)
                      +|.....|.+|++.+|.+.  .+|.|..|++.|++-.+|..|++..|+..
T Consensus       330 s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~f~  379 (467)
T KOG3608|consen  330 SVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHGFR  379 (467)
T ss_pred             HHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhccc
Confidence            9999999999999988655  45999999999999999999999999876


No 5  
>KOG3608|consensus
Probab=99.92  E-value=3.2e-26  Score=207.48  Aligned_cols=163  Identities=28%  Similarity=0.566  Sum_probs=127.2

Q ss_pred             eec--CCCCccCCChHHHHhhhhhcCC------------CCC-ccC--ccCcccccChHHHHHHHHHhcCCCceeeCCCC
Q psy7449         228 YQC--YSCEYHSLYSSRMIKHIRNHTG------------ERP-FQC--KICDSTFKRKQTLDLHIKRHTGERTYKCEFCD  290 (596)
Q Consensus       228 ~~C--~~C~~~f~~~~~l~~H~~~h~~------------~~~-~~C--~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  290 (596)
                      |.|  ..|+..|.+...|..|+-.|.-            ++| +.|  ..|.+.|.++..|+.|++.|++++...|+.|+
T Consensus       135 f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg  214 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCG  214 (467)
T ss_pred             hccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHH
Confidence            455  6899999999999999877642            122 456  46999999999999999999999999999999


Q ss_pred             CcccccccccccccccccccccCCcccccchhhHHHHHHhhhcCCCCCCCCCCCCCCCcccCCCCCcccCHHHHHHhhhh
Q psy7449         291 YTAARKDTLGVHVRIKHKISICQNCGLILSTITEELLEHCRICSGKERPDSSTDKSFNYVCYTCDYHTGVRECMKKHIRT  370 (596)
Q Consensus       291 ~~f~~~~~l~~H~~~~h~~~~C~~C~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  370 (596)
                      ..|+++..|-.|++..                 ..|..         .+         |.|..|.+.|.+...|..|+..
T Consensus       215 ~~F~~~tkl~DH~rRq-----------------t~l~~---------n~---------fqC~~C~KrFaTeklL~~Hv~r  259 (467)
T KOG3608|consen  215 ELFRTKTKLFDHLRRQ-----------------TELNT---------NS---------FQCAQCFKRFATEKLLKSHVVR  259 (467)
T ss_pred             HHhccccHHHHHHHhh-----------------hhhcC---------Cc---------hHHHHHHHHHhHHHHHHHHHHH
Confidence            9999988888877531                 11100         12         8888888888888888888887


Q ss_pred             cCCCCccccCccccccccchhhhhhhhcccCCCCcccCCCCcccccchhhHHHHhhh
Q psy7449         371 HTGEKPFKCTHCRYSASRRDTLDHHIQVSHLYKKRFQCPVCDYRCTKKYNLQMHALT  427 (596)
Q Consensus       371 h~~~k~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~  427 (596)
                      |..  .|+|+.|+.+....++|..||+..|...+||+|..|++.|.+.++|.+|+..
T Consensus       260 Hvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~  314 (467)
T KOG3608|consen  260 HVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQV  314 (467)
T ss_pred             hhh--cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHh
Confidence            765  4788888888888888888888778777888888888888777777777765


No 6  
>KOG2462|consensus
Probab=99.92  E-value=6.3e-26  Score=201.29  Aligned_cols=142  Identities=31%  Similarity=0.535  Sum_probs=132.8

Q ss_pred             CCCccccccccccccCchHHHhHHhhhc---CCCCcccCcCcccccChhHHHHHHhhcCCCCCcccCCCCccccChhHHH
Q psy7449          56 AQNKNTCCICGHVESGAWRLKRHFLKHT---GEKSYECCWCTYKTAYENDLKKHQRKHTGEKPYSCGHCPYTARSSSYML  132 (596)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~---~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  132 (596)
                      ....|.|+.||+.+.+.+.|.+|.+.|-   ..+.+.|+.||+.|.+...|+.|+++|+  .+.+|.+|||.|.....|.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhh
Confidence            4567899999999999999999999985   3678999999999999999999999997  6899999999999999999


Q ss_pred             HHhhhccCCCCccCCCCCccccCchhHHhHhhhccCCCceecCCCccccchhHhhhcccccccccCC
Q psy7449         133 THLKVHSGEKAFKCEYCSYSSYSKSNLRTHMRTHIGEKPYKCSSCDFQATQKIQVKKHVLIICQHCD  199 (596)
Q Consensus       133 ~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~c~~c~  199 (596)
                      -|+++|+|||||.|+.|++.|.++++|+.||++|.+.|.|+|..|++.|..++.|.+|..--|....
T Consensus       205 GHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~C~~~~  271 (279)
T KOG2462|consen  205 GHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESACLKYL  271 (279)
T ss_pred             cccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhcccccc
Confidence            9999999999999999999999999999999999999999999999999999999999876665443


No 7  
>KOG3623|consensus
Probab=99.89  E-value=9e-24  Score=208.61  Aligned_cols=83  Identities=28%  Similarity=0.621  Sum_probs=79.8

Q ss_pred             CCCCcccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchhhhhhhhhccCCCcccCCccCcCccChhhHHHH
Q psy7449         495 DGSFRFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCDLKFSQNSQLKYH  574 (596)
Q Consensus       495 ~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~l~~H  574 (596)
                      +.+..|.|++|+|.|...+.|.+|.-.|+|.+||+|.+|.|.|..+..|..|+|.|.||+||+|+.|++.|.....+..|
T Consensus       890 te~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQH  969 (1007)
T KOG3623|consen  890 TEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQH  969 (1007)
T ss_pred             CccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhh
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Hhh
Q psy7449         575 LTT  577 (596)
Q Consensus       575 ~~~  577 (596)
                      |..
T Consensus       970 MNH  972 (1007)
T KOG3623|consen  970 MNH  972 (1007)
T ss_pred             hcc
Confidence            863


No 8  
>KOG3623|consensus
Probab=99.88  E-value=3.1e-23  Score=204.89  Aligned_cols=108  Identities=27%  Similarity=0.549  Sum_probs=92.3

Q ss_pred             CccccccccccccCchHHHhHHhhhc--CCCCcccCcCcccccChhHHHHHHhhcCC-------------CCCcccCCCC
Q psy7449          58 NKNTCCICGHVESGAWRLKRHFLKHT--GEKSYECCWCTYKTAYENDLKKHQRKHTG-------------EKPYSCGHCP  122 (596)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~--~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------------~~~~~C~~C~  122 (596)
                      ...+|+.|++.+....+|..|++-.+  .+.-|.|..|.++|.++..|.+||.+|..             .+.|+|.+|+
T Consensus       209 qlltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECg  288 (1007)
T KOG3623|consen  209 QLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECG  288 (1007)
T ss_pred             hhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccc
Confidence            45689999999999999999987554  34568899999999999999999988853             3569999999


Q ss_pred             ccccChhHHHHHhhhccCCCCccCCCCCccccCchhHHhHhhh
Q psy7449         123 YTARSSSYMLTHLKVHSGEKAFKCEYCSYSSYSKSNLRTHMRT  165 (596)
Q Consensus       123 ~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  165 (596)
                      |.|+.+-.|+.|+++|+|++||.|+.|++.|...+.+..||..
T Consensus       289 KAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  289 KAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             hhhhhHHHHHhhheeecCCCCcCCcccccccccCCcccccccc
Confidence            9999999999999999999999999999999999999888753


No 9  
>KOG3576|consensus
Probab=99.68  E-value=5e-18  Score=142.51  Aligned_cols=117  Identities=22%  Similarity=0.446  Sum_probs=106.4

Q ss_pred             CCccceecCCCCcccccchhhhccccccccCCCCCCCCCcccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccC
Q psy7449         460 RGHETVICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQ  539 (596)
Q Consensus       460 ~~~~~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~  539 (596)
                      .+...+.|.+|++.|..       ...|..|+.-|+..++|-|..||+.|.....|++|+|+|+|.+||+|..|+++|++
T Consensus       113 sd~d~ftCrvCgK~F~l-------QRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftq  185 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGL-------QRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQ  185 (267)
T ss_pred             CCCCeeeeehhhhhhhH-------HHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHh
Confidence            34567999999999998       88999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhhhhhhhccC-----------CCcccCCccCcCccChhhHHHHHhhcCCCCC
Q psy7449         540 SSCLGRHMRIHTG-----------EKPYACSLCDLKFSQNSQLKYHLTTRHDLPD  583 (596)
Q Consensus       540 ~~~L~~H~~~H~~-----------~~~~~C~~C~~~F~~~~~l~~H~~~~H~~~~  583 (596)
                      .-+|..|++.-+|           ++.|.|+.||.+-.....+..|++.+|..-|
T Consensus       186 rcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  186 RCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             hccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            9999999974443           4679999999999999999999999997654


No 10 
>KOG3576|consensus
Probab=99.64  E-value=3.8e-17  Score=137.28  Aligned_cols=116  Identities=32%  Similarity=0.546  Sum_probs=105.6

Q ss_pred             CCCccccccccccccCchHHHhHHhhhcCCCCcccCcCcccccChhHHHHHHhhcCCCCCcccCCCCccccChhHHHHHh
Q psy7449          56 AQNKNTCCICGHVESGAWRLKRHFLKHTGEKSYECCWCTYKTAYENDLKKHQRKHTGEKPYSCGHCPYTARSSSYMLTHL  135 (596)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  135 (596)
                      ++..|.|.+|++.|.-...|.+|++-|..-+.|.|..||+.|+...+|++|+|+|+|.+||+|..|++.|..+-+|..|+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            46689999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             hhccC-----------CCCccCCCCCccccCchhHHhHhhhccCCCc
Q psy7449         136 KVHSG-----------EKAFKCEYCSYSSYSKSNLRTHMRTHIGEKP  171 (596)
Q Consensus       136 ~~h~~-----------~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~  171 (596)
                      +.-+|           ++.|.|+.||.+-.....+..|++.|+...|
T Consensus       194 ~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  194 KKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             HHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCCH
Confidence            75444           4678999999999999999999998876543


No 11 
>PHA00733 hypothetical protein
Probab=99.16  E-value=1.6e-11  Score=101.12  Aligned_cols=93  Identities=18%  Similarity=0.358  Sum_probs=76.3

Q ss_pred             cccCCCCCCCCCcccCCCCCccccccchhhhh--hh---ccCCCCCccCCCCCccccCchhhhhhhhhccCCCcccCCcc
Q psy7449         487 LCSGVPRPDGSFRFVCFTCNYHTYKSGHMRQH--IN---GHVGIKPYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLC  561 (596)
Q Consensus       487 l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H--~~---~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C  561 (596)
                      |...-......+++.|.+|++.|.....|..|  ++   .+.+.+||.|+.||+.|.+...|..|++.|  +.+|.|+.|
T Consensus        28 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~C  105 (128)
T PHA00733         28 LKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVC  105 (128)
T ss_pred             hhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCC
Confidence            33333333445679999999999888877776  22   344588999999999999999999999987  457999999


Q ss_pred             CcCccChhhHHHHHhhcCCC
Q psy7449         562 DLKFSQNSQLKYHLTTRHDL  581 (596)
Q Consensus       562 ~~~F~~~~~l~~H~~~~H~~  581 (596)
                      +++|.....|..|+...|++
T Consensus       106 gK~F~~~~sL~~H~~~~h~~  125 (128)
T PHA00733        106 GKEFRNTDSTLDHVCKKHNI  125 (128)
T ss_pred             CCccCCHHHHHHHHHHhcCc
Confidence            99999999999999999984


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.15  E-value=1.1e-10  Score=118.39  Aligned_cols=147  Identities=18%  Similarity=0.362  Sum_probs=112.3

Q ss_pred             CcccCCCCCcccCHHHHHHhhhhcCCCCccccCc--cccccccchhhhhhhhcccCCCCcccCCCCcccccchhhHHHHh
Q psy7449         348 NYVCYTCDYHTGVRECMKKHIRTHTGEKPFKCTH--CRYSASRRDTLDHHIQVSHLYKKRFQCPVCDYRCTKKYNLQMHA  425 (596)
Q Consensus       348 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~--C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~  425 (596)
                      .-.|+-|....... .|..|...-.. ....|+.  |+..| .+..|..|          +.|+.|++.|. ...|..|+
T Consensus       407 ~V~C~NC~~~i~l~-~l~lHe~~C~r-~~V~Cp~~~Cg~v~-~r~el~~H----------~~C~~Cgk~f~-~s~LekH~  472 (567)
T PLN03086        407 TVECRNCKHYIPSR-SIALHEAYCSR-HNVVCPHDGCGIVL-RVEEAKNH----------VHCEKCGQAFQ-QGEMEKHM  472 (567)
T ss_pred             eEECCCCCCccchh-HHHHHHhhCCC-cceeCCccccccee-eccccccC----------ccCCCCCCccc-hHHHHHHH
Confidence            35799998876544 45577754332 3456884  99988 45555555          48999999996 67899998


Q ss_pred             hhcccCCCCCCCcccCCcccccccCCCCccccccCCccceecCCCCcccccchhhhccccccccCCCCCCCCCcccCCCC
Q psy7449         426 LTKHDLDIKSDGIIQDAGTYILDTALSPEKRVKSRGHETVICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRFVCFTC  505 (596)
Q Consensus       426 ~~~H~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~~C~~C  505 (596)
                      ..+|                                                                    .++.|+ |
T Consensus       473 ~~~H--------------------------------------------------------------------kpv~Cp-C  483 (567)
T PLN03086        473 KVFH--------------------------------------------------------------------EPLQCP-C  483 (567)
T ss_pred             HhcC--------------------------------------------------------------------CCccCC-C
Confidence            7743                                                                    246788 8


Q ss_pred             CccccccchhhhhhhccCCCCCccCCCCCccccC----------chhhhhhhhhccCCCcccCCccCcCccChhhHHHHH
Q psy7449         506 NYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQ----------SSCLGRHMRIHTGEKPYACSLCDLKFSQNSQLKYHL  575 (596)
Q Consensus       506 ~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~----------~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~l~~H~  575 (596)
                      |+.+ ....|..|+.+|.+.+++.|..|++.|..          .+.|..|..+. |.+++.|..||+.|. ...|..|+
T Consensus       484 g~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vr-lrdm~~H~  560 (567)
T PLN03086        484 GVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVM-LKEMDIHQ  560 (567)
T ss_pred             CCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeee-ehhHHHHH
Confidence            8655 56899999999999999999999999952          35799999885 999999999998754 55788998


Q ss_pred             hhcCC
Q psy7449         576 TTRHD  580 (596)
Q Consensus       576 ~~~H~  580 (596)
                      ...|.
T Consensus       561 ~~~h~  565 (567)
T PLN03086        561 IAVHQ  565 (567)
T ss_pred             HHhhc
Confidence            88874


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.95  E-value=8e-10  Score=112.26  Aligned_cols=93  Identities=18%  Similarity=0.416  Sum_probs=72.5

Q ss_pred             CCcccCcCcccccChhHHHHHHhhcCCCCCcccCCCCccccChhHHHHHhhhccCCCCccCCCCCcccc----------C
Q psy7449          86 KSYECCWCTYKTAYENDLKKHQRKHTGEKPYSCGHCPYTARSSSYMLTHLKVHSGEKAFKCEYCSYSSY----------S  155 (596)
Q Consensus        86 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~  155 (596)
                      +.+.|+.|++.|. ...|..|++.++  +++.|+ |++.+ .+..|..|+.+|.+.+++.|..|++.|.          .
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~  526 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDR  526 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhh
Confidence            3457888888885 577888888875  778888 88655 5688888888888888888888888884          1


Q ss_pred             chhHHhHhhhccCCCceecCCCccccchh
Q psy7449         156 KSNLRTHMRTHIGEKPYKCSSCDFQATQK  184 (596)
Q Consensus       156 ~~~L~~H~~~h~~~~~~~C~~C~~~f~~~  184 (596)
                      ...|..|.... +.+++.|..||+.+..+
T Consensus       527 ~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr  554 (567)
T PLN03086        527 LRGMSEHESIC-GSRTAPCDSCGRSVMLK  554 (567)
T ss_pred             hhhHHHHHHhc-CCcceEccccCCeeeeh
Confidence            34788888775 78888888888877653


No 14 
>PHA00733 hypothetical protein
Probab=98.93  E-value=9.6e-10  Score=90.64  Aligned_cols=53  Identities=21%  Similarity=0.365  Sum_probs=30.2

Q ss_pred             CCCcccCCCCccccChhHHHHHhhhccCCCCccCCCCCccccCchhHHhHhhhcc
Q psy7449         113 EKPYSCGHCPYTARSSSYMLTHLKVHSGEKAFKCEYCSYSSYSKSNLRTHMRTHI  167 (596)
Q Consensus       113 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~  167 (596)
                      ++||.|+.|++.|.+...|..|++.+  ..+|.|+.|++.|.....|..|+...+
T Consensus        71 ~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         71 VSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             CCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            45555555665565555555555544  234566666666666666666655433


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.87  E-value=6.6e-10  Score=74.10  Aligned_cols=42  Identities=21%  Similarity=0.312  Sum_probs=25.2

Q ss_pred             ccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchhh
Q psy7449         500 FVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCL  543 (596)
Q Consensus       500 ~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L  543 (596)
                      |.|+.||+.|...++|..|+++|+  ++|+|..|++.|.+.+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            566666666666666666666665  456666666666555544


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.83  E-value=1.4e-09  Score=72.61  Aligned_cols=44  Identities=18%  Similarity=0.288  Sum_probs=40.9

Q ss_pred             CccCCCCCccccCchhhhhhhhhccCCCcccCCccCcCccChhhHH
Q psy7449         527 PYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCDLKFSQNSQLK  572 (596)
Q Consensus       527 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~l~  572 (596)
                      .|+|++||+.|+..++|..|+++|+  ++|+|..|++.|.+...|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4899999999999999999999999  7999999999999887764


No 17 
>KOG1146|consensus
Probab=98.79  E-value=3.4e-09  Score=114.27  Aligned_cols=77  Identities=17%  Similarity=0.235  Sum_probs=61.0

Q ss_pred             cccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchhhhhhhhh-----------------ccCCCcccCCcc
Q psy7449         499 RFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCLGRHMRI-----------------HTGEKPYACSLC  561 (596)
Q Consensus       499 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~-----------------H~~~~~~~C~~C  561 (596)
                      .+.|..|++.|...-.+. |+-.   ..+|.|..|...|.....|..|.+.                 +..-.+| |.+|
T Consensus      1260 e~~c~~~~~~~~~~~~~~-~l~~---~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c 1334 (1406)
T KOG1146|consen 1260 EGECGAVDELLTPSFGIS-TLDV---THRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCTYH-CLAC 1334 (1406)
T ss_pred             cchhhhccccccCcccee-eccc---chhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccccc-chHH
Confidence            478999988888877777 6643   2468999999999999999888742                 1223446 9999


Q ss_pred             CcCccChhhHHHHHhhcCC
Q psy7449         562 DLKFSQNSQLKYHLTTRHD  580 (596)
Q Consensus       562 ~~~F~~~~~l~~H~~~~H~  580 (596)
                      ...|.....|+.||+..+.
T Consensus      1335 ~~~~~~~~alqihm~~~~~ 1353 (1406)
T KOG1146|consen 1335 EVLLSGREALQIHMRSSAH 1353 (1406)
T ss_pred             HhhcchhHHHHHHHHHhhh
Confidence            9999999999999998775


No 18 
>KOG3993|consensus
Probab=98.68  E-value=1.3e-08  Score=96.33  Aligned_cols=84  Identities=20%  Similarity=0.385  Sum_probs=54.6

Q ss_pred             CcccCCCCCcccCHHHHHHhhhhcCCCCccccCccccccccchhhhhhhhcccC--------------------------
Q psy7449         348 NYVCYTCDYHTGVRECMKKHIRTHTGEKPFKCTHCRYSASRRDTLDHHIQVSHL--------------------------  401 (596)
Q Consensus       348 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~L~~H~~~~H~--------------------------  401 (596)
                      .|.|..|...|.+.-.|..|.-.-.-.-.|+|++|+|.|+-..+|..| ++.|.                          
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASH-RRWHKPR~eaa~a~~~P~k~~~~~rae~~ea  345 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASH-RRWHKPRPEAAKAGSPPPKQAVETRAEVQEA  345 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhh-hcccCCchhhhhcCCCChhhhhhhhhhhhhc
Confidence            366666666666666666664211111236666666666666666666 44441                          


Q ss_pred             -------CCCcccCCCCcccccchhhHHHHhhhcccCC
Q psy7449         402 -------YKKRFQCPVCDYRCTKKYNLQMHALTKHDLD  432 (596)
Q Consensus       402 -------~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~  432 (596)
                             ....|.|.+|++.|.+...|+.|+.++|...
T Consensus       346 ~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~  383 (500)
T KOG3993|consen  346 ERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAP  383 (500)
T ss_pred             cccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccc
Confidence                   1234999999999999999999999977543


No 19 
>KOG3993|consensus
Probab=98.66  E-value=8e-09  Score=97.70  Aligned_cols=171  Identities=23%  Similarity=0.315  Sum_probs=106.7

Q ss_pred             ccccCccccccccchhhhhhhhcccCCCCcccCCCCcccccchhhHHHHhhhcccCCCCCCCcccCCcccccccCCCCcc
Q psy7449         376 PFKCTHCRYSASRRDTLDHHIQVSHLYKKRFQCPVCDYRCTKKYNLQMHALTKHDLDIKSDGIIQDAGTYILDTALSPEK  455 (596)
Q Consensus       376 ~~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~l~~~~  455 (596)
                      .|.|..|...|.+...|.+|. -.-...-.|+|+.|+|.|.-..+|..|.+. |........    ...-.-+..     
T Consensus       267 dyiCqLCK~kYeD~F~LAQHr-C~RIV~vEYrCPEC~KVFsCPANLASHRRW-HKPR~eaa~----a~~~P~k~~-----  335 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHR-CPRIVHVEYRCPECDKVFSCPANLASHRRW-HKPRPEAAK----AGSPPPKQA-----  335 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhcc-CCeeEEeeecCCcccccccCchhhhhhhcc-cCCchhhhh----cCCCChhhh-----
Confidence            499999999999999999994 222222359999999999999999999988 543311110    000000000     


Q ss_pred             ccccCCccceecCCCCcccccchhhhccccccccCCCCCCCCCcccCCCCCccccccchhhhhhhccCCC--------C-
Q psy7449         456 RVKSRGHETVICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRFVCFTCNYHTYKSGHMRQHINGHVGI--------K-  526 (596)
Q Consensus       456 ~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~--------~-  526 (596)
                        ..++.+                  +.... ++...  ..+..|.|.+|+++|.+...|+.|+.+|...        + 
T Consensus       336 --~~~rae------------------~~ea~-rsg~d--ss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f  392 (500)
T KOG3993|consen  336 --VETRAE------------------VQEAE-RSGDD--SSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKF  392 (500)
T ss_pred             --hhhhhh------------------hhhcc-ccCCc--ccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCc
Confidence              000000                  00000 00000  2233688888888898888888887766411        0 


Q ss_pred             --------Cc-----------------------------cCCCCCccccCchhhhhhhhhccCCCcccCCccCcCccChh
Q psy7449         527 --------PY-----------------------------KCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCDLKFSQNS  569 (596)
Q Consensus       527 --------~~-----------------------------~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~  569 (596)
                              .+                             .|++||-.+.++..--.+.+.-..+.-|.|.+|...|.+..
T Consensus       393 ~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~  472 (500)
T KOG3993|consen  393 LLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSP  472 (500)
T ss_pred             chhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCc
Confidence                    02                             35555555555554444444333455699999999999999


Q ss_pred             hHHHHHhhcCC
Q psy7449         570 QLKYHLTTRHD  580 (596)
Q Consensus       570 ~l~~H~~~~H~  580 (596)
                      .|.+|+..-|.
T Consensus       473 ~ltrhin~~Hp  483 (500)
T KOG3993|consen  473 GLTRHINKCHP  483 (500)
T ss_pred             chHhHhhhcCh
Confidence            99999998885


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.59  E-value=1.4e-08  Score=57.86  Aligned_cols=24  Identities=67%  Similarity=1.244  Sum_probs=12.4

Q ss_pred             hhhhhhhccCCCcccCCccCcCcc
Q psy7449         543 LGRHMRIHTGEKPYACSLCDLKFS  566 (596)
Q Consensus       543 L~~H~~~H~~~~~~~C~~C~~~F~  566 (596)
                      |.+||++|+|++||.|++|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            445555555555555555555543


No 21 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.54  E-value=2.6e-08  Score=56.71  Aligned_cols=26  Identities=38%  Similarity=0.844  Sum_probs=24.0

Q ss_pred             hhhhhhhccCCCCCccCCCCCccccC
Q psy7449         514 HMRQHINGHVGIKPYKCLHCSYKSTQ  539 (596)
Q Consensus       514 ~l~~H~~~H~~~~~~~C~~C~~~f~~  539 (596)
                      +|..|+++|+|++||.|++|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            48899999999999999999999964


No 22 
>PHA00616 hypothetical protein
Probab=98.41  E-value=6.6e-08  Score=61.22  Aligned_cols=33  Identities=15%  Similarity=0.252  Sum_probs=20.0

Q ss_pred             CccCCCCCccccCchhhhhhhhhccCCCcccCC
Q psy7449         527 PYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACS  559 (596)
Q Consensus       527 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~  559 (596)
                      ||+|+.||+.|...+.|..|++.|+|++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            456666666666666666666666666665554


No 23 
>PHA00732 hypothetical protein
Probab=98.22  E-value=7.5e-07  Score=66.12  Aligned_cols=46  Identities=26%  Similarity=0.457  Sum_probs=26.5

Q ss_pred             cccCCCCCccccccchhhhhhhc-cCCCCCccCCCCCccccCchhhhhhhhhc
Q psy7449         499 RFVCFTCNYHTYKSGHMRQHING-HVGIKPYKCLHCSYKSTQSSCLGRHMRIH  550 (596)
Q Consensus       499 ~~~C~~C~~~f~~~~~l~~H~~~-H~~~~~~~C~~C~~~f~~~~~L~~H~~~H  550 (596)
                      ||.|..||+.|.+...|..|++. |.   ++.|+.||+.|.   .|..|++..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            35666666666666666666653 43   245666666665   355555443


No 24 
>PHA00616 hypothetical protein
Probab=98.14  E-value=1.2e-06  Score=55.64  Aligned_cols=34  Identities=21%  Similarity=0.476  Sum_probs=27.9

Q ss_pred             CccCccCcccccChHHHHHHHHHhcCCCceeeCC
Q psy7449         255 PFQCKICDSTFKRKQTLDLHIKRHTGERTYKCEF  288 (596)
Q Consensus       255 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  288 (596)
                      ||+|+.||+.|..++.|..|++.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5788888888888888888888888888887764


No 25 
>PHA00732 hypothetical protein
Probab=98.13  E-value=1.6e-06  Score=64.35  Aligned_cols=49  Identities=27%  Similarity=0.614  Sum_probs=42.4

Q ss_pred             CccCCCCCccccCchhhhhhhhh-ccCCCcccCCccCcCccChhhHHHHHhhcCCC
Q psy7449         527 PYKCLHCSYKSTQSSCLGRHMRI-HTGEKPYACSLCDLKFSQNSQLKYHLTTRHDL  581 (596)
Q Consensus       527 ~~~C~~C~~~f~~~~~L~~H~~~-H~~~~~~~C~~C~~~F~~~~~l~~H~~~~H~~  581 (596)
                      ||.|+.||+.|.+...|+.|++. |++   +.|+.||+.|.   .|..|++++-|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~~~~   50 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQYDI   50 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---ChhhhhcccCCc
Confidence            68999999999999999999984 654   68999999998   599999777654


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.00  E-value=4.9e-06  Score=57.35  Aligned_cols=50  Identities=32%  Similarity=0.581  Sum_probs=31.9

Q ss_pred             cccCccccccccchhhhhhhhcccCCC-CcccCCCCcccccchhhHHHHhhhcc
Q psy7449         377 FKCTHCRYSASRRDTLDHHIQVSHLYK-KRFQCPVCDYRCTKKYNLQMHALTKH  429 (596)
Q Consensus       377 ~~C~~C~~~f~~~~~L~~H~~~~H~~~-~~~~C~~C~~~f~~~~~l~~H~~~~H  429 (596)
                      |.|++|++ -.+...|..|+...|..+ +.+.||+|...++  .+|..|+...|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            66777777 345566777766666554 3577777776544  37777776655


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.94  E-value=7.7e-06  Score=56.36  Aligned_cols=50  Identities=28%  Similarity=0.572  Sum_probs=29.5

Q ss_pred             ccCCCCCccccCchhhhhhhh-hccCC-CcccCCccCcCccChhhHHHHHhhcCC
Q psy7449         528 YKCLHCSYKSTQSSCLGRHMR-IHTGE-KPYACSLCDLKFSQNSQLKYHLTTRHD  580 (596)
Q Consensus       528 ~~C~~C~~~f~~~~~L~~H~~-~H~~~-~~~~C~~C~~~F~~~~~l~~H~~~~H~  580 (596)
                      |.|++||+. .+...|..|.. .|..+ +.+.|++|...+.  .+|..||...|+
T Consensus         3 f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            666666663 34556666654 34433 3466777766544  367777776663


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.59  E-value=1.7e-05  Score=43.86  Aligned_cols=18  Identities=44%  Similarity=0.955  Sum_probs=7.0

Q ss_pred             CCccCcCccChhhHHHHH
Q psy7449         558 CSLCDLKFSQNSQLKYHL  575 (596)
Q Consensus       558 C~~C~~~F~~~~~l~~H~  575 (596)
                      |+.|++.|.++..|..|+
T Consensus         3 C~~C~~~f~~~~~l~~H~   20 (23)
T PF00096_consen    3 CPICGKSFSSKSNLKRHM   20 (23)
T ss_dssp             ETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCccCCHHHHHHHH
Confidence            333333333333333333


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.48  E-value=6.3e-05  Score=41.53  Aligned_cols=23  Identities=39%  Similarity=1.009  Sum_probs=15.3

Q ss_pred             ccCccCcccccChHHHHHHHHHh
Q psy7449         256 FQCKICDSTFKRKQTLDLHIKRH  278 (596)
Q Consensus       256 ~~C~~C~~~f~~~~~l~~H~~~h  278 (596)
                      |.|+.|++.|.++..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            45667777777777777776653


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.45  E-value=6.3e-05  Score=42.02  Aligned_cols=24  Identities=33%  Similarity=0.883  Sum_probs=14.9

Q ss_pred             ccCCccCcCccChhhHHHHHhhcC
Q psy7449         556 YACSLCDLKFSQNSQLKYHLTTRH  579 (596)
Q Consensus       556 ~~C~~C~~~F~~~~~l~~H~~~~H  579 (596)
                      |.|++|++.|.+...|..|++++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            466677777777777777766655


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.41  E-value=7.7e-05  Score=59.64  Aligned_cols=74  Identities=18%  Similarity=0.374  Sum_probs=22.3

Q ss_pred             cCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchhhhhhhhhccCCCcccCCccCcCccChhhHHHHHhhcC
Q psy7449         501 VCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCDLKFSQNSQLKYHLTTRH  579 (596)
Q Consensus       501 ~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~l~~H~~~~H  579 (596)
                      +|..|+..|.+...|..|+...++...-    ....+.....|..+++.-. ...+.|.+|++.|.+...|..||+.++
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             Cccccccccccccccccccccccccccc----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCcc
Confidence            4899999999999999999765543211    1222224444555544322 236899999999999999999999764


No 32 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.27  E-value=0.00013  Score=42.11  Aligned_cols=26  Identities=31%  Similarity=0.627  Sum_probs=15.6

Q ss_pred             cccCCccCcCccChhhHHHHHhhcCC
Q psy7449         555 PYACSLCDLKFSQNSQLKYHLTTRHD  580 (596)
Q Consensus       555 ~~~C~~C~~~F~~~~~l~~H~~~~H~  580 (596)
                      ||.|..|++.|.+...|..|++.+++
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhcC
Confidence            45666666666666666666655543


No 33 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.26  E-value=9.5e-05  Score=67.84  Aligned_cols=55  Identities=29%  Similarity=0.589  Sum_probs=46.0

Q ss_pred             CCCccccCc--cccccccchhhhhhhhccc------------------CCCCcccCCCCcccccchhhHHHHhhh
Q psy7449         373 GEKPFKCTH--CRYSASRRDTLDHHIQVSH------------------LYKKRFQCPVCDYRCTKKYNLQMHALT  427 (596)
Q Consensus       373 ~~k~~~C~~--C~~~f~~~~~L~~H~~~~H------------------~~~~~~~C~~C~~~f~~~~~l~~H~~~  427 (596)
                      ++|||+|++  |++.+.+...|..|+..-|                  ...+||.|++|+|.+.+...|+.|...
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~H  420 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKH  420 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccc
Confidence            358999988  9999999999999976555                  134789999999999999999998653


No 34 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.22  E-value=0.00012  Score=67.28  Aligned_cols=54  Identities=41%  Similarity=0.795  Sum_probs=34.3

Q ss_pred             CCccCCC--CCccccCchhhhhhhh-hc------------------cCCCcccCCccCcCccChhhHHHHHhhcC
Q psy7449         526 KPYKCLH--CSYKSTQSSCLGRHMR-IH------------------TGEKPYACSLCDLKFSQNSQLKYHLTTRH  579 (596)
Q Consensus       526 ~~~~C~~--C~~~f~~~~~L~~H~~-~H------------------~~~~~~~C~~C~~~F~~~~~l~~H~~~~H  579 (596)
                      |||+|++  |.|.+.....|+.|+. -|                  ..++||+|++|++.+....-|+.|...-|
T Consensus       348 KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~Hsh  422 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKHSH  422 (423)
T ss_pred             ceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccccC
Confidence            5555554  5555555555555543 11                  23578888888888888888888866443


No 35 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.15  E-value=0.00025  Score=39.51  Aligned_cols=24  Identities=42%  Similarity=0.822  Sum_probs=14.1

Q ss_pred             ccCCCCcccccchhhHHHHhhhcc
Q psy7449         406 FQCPVCDYRCTKKYNLQMHALTKH  429 (596)
Q Consensus       406 ~~C~~C~~~f~~~~~l~~H~~~~H  429 (596)
                      |.|++|++.|.+...|..|+.++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666543


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.10  E-value=0.00018  Score=41.54  Aligned_cols=24  Identities=33%  Similarity=0.668  Sum_probs=13.3

Q ss_pred             CccCCCCCccccCchhhhhhhhhc
Q psy7449         527 PYKCLHCSYKSTQSSCLGRHMRIH  550 (596)
Q Consensus       527 ~~~C~~C~~~f~~~~~L~~H~~~H  550 (596)
                      ||+|+.|++.|.+...|..|++.|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHh
Confidence            355555555555555555555544


No 37 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.06  E-value=0.00033  Score=55.90  Aligned_cols=24  Identities=38%  Similarity=0.890  Sum_probs=14.7

Q ss_pred             CccCCCCCccccCchhHHhHhhhc
Q psy7449         143 AFKCEYCSYSSYSKSNLRTHMRTH  166 (596)
Q Consensus       143 ~~~C~~C~~~f~~~~~L~~H~~~h  166 (596)
                      .+.|.+|++.|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            466666666666666666666653


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.47  E-value=0.0015  Score=42.41  Aligned_cols=30  Identities=33%  Similarity=0.452  Sum_probs=12.2

Q ss_pred             CCCccCCCCCccccCchhhhhhhhhccCCC
Q psy7449         525 IKPYKCLHCSYKSTQSSCLGRHMRIHTGEK  554 (596)
Q Consensus       525 ~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~  554 (596)
                      +.|-.|++|+..+++..+|++|+.++++.+
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            344455555555555555555554444433


No 39 
>KOG2231|consensus
Probab=96.45  E-value=0.002  Score=67.27  Aligned_cols=22  Identities=18%  Similarity=0.362  Sum_probs=10.9

Q ss_pred             ccCCCCCcccCHHHHHHhhhhc
Q psy7449         350 VCYTCDYHTGVRECMKKHIRTH  371 (596)
Q Consensus       350 ~C~~C~~~f~~~~~l~~H~~~h  371 (596)
                      .|..|...|-....|.+|++.+
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~  205 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFD  205 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccc
Confidence            3455555555555555555443


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.34  E-value=0.002  Score=36.49  Aligned_cols=18  Identities=39%  Similarity=0.746  Sum_probs=6.8

Q ss_pred             CCccCcCccChhhHHHHH
Q psy7449         558 CSLCDLKFSQNSQLKYHL  575 (596)
Q Consensus       558 C~~C~~~F~~~~~l~~H~  575 (596)
                      |..|++.|.+...|..|+
T Consensus         3 C~~C~~~f~~~~~l~~H~   20 (26)
T smart00355        3 CPECGKVFKSKSALKEHM   20 (26)
T ss_pred             CCCCcchhCCHHHHHHHH
Confidence            333333333333333333


No 41 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.30  E-value=0.0015  Score=36.27  Aligned_cols=24  Identities=42%  Similarity=0.755  Sum_probs=14.5

Q ss_pred             ccCCccCcCccChhhHHHHHhhcCC
Q psy7449         556 YACSLCDLKFSQNSQLKYHLTTRHD  580 (596)
Q Consensus       556 ~~C~~C~~~F~~~~~l~~H~~~~H~  580 (596)
                      |+|+.|++... +..|.+|++.+|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            56777776665 6667777766653


No 42 
>PRK04860 hypothetical protein; Provisional
Probab=96.19  E-value=0.0018  Score=55.64  Aligned_cols=39  Identities=23%  Similarity=0.461  Sum_probs=24.9

Q ss_pred             CcccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCc
Q psy7449         498 FRFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQS  540 (596)
Q Consensus       498 ~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~  540 (596)
                      .+|.|. |+.   ....++.|.++|+++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            356776 665   556666666666666666666666666543


No 43 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.07  E-value=0.0055  Score=39.92  Aligned_cols=39  Identities=18%  Similarity=0.294  Sum_probs=23.6

Q ss_pred             hhhhhcccCCCCcccCCCCcccccchhhHHHHhhhcccC
Q psy7449         393 DHHIQVSHLYKKRFQCPVCDYRCTKKYNLQMHALTKHDL  431 (596)
Q Consensus       393 ~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~  431 (596)
                      ..+.+..+..+.|-.|++|+..+....+|++|+...|..
T Consensus        12 ~~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   12 TKKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             ----CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             hhHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            445555566677888888888888888888888776754


No 44 
>KOG2231|consensus
Probab=95.97  E-value=0.0068  Score=63.38  Aligned_cols=147  Identities=20%  Similarity=0.317  Sum_probs=85.4

Q ss_pred             cccCccccccccchhhhhhhhcccCCCCcccCCCCcccccchhhHHHHhhhcccCCCCCCCcccCCcccccccCCCCccc
Q psy7449         377 FKCTHCRYSASRRDTLDHHIQVSHLYKKRFQCPVCDYRCTKKYNLQMHALTKHDLDIKSDGIIQDAGTYILDTALSPEKR  456 (596)
Q Consensus       377 ~~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~~l~~~~~  456 (596)
                      +.|.+|++.|.-..             ..-.|..| -.|.+...|+.|+...|..- .-..|..-.+.|...        
T Consensus       100 ~~C~~C~~~~~~~~-------------~~~~~~~c-~~~~s~~~Lk~H~~~~H~~~-~c~lC~~~~kif~~e--------  156 (669)
T KOG2231|consen  100 HSCHICDRRFRALY-------------NKKECLHC-TEFKSVENLKNHMRDQHKLH-LCSLCLQNLKIFINE--------  156 (669)
T ss_pred             hhcCccccchhhhc-------------ccCCCccc-cchhHHHHHHHHHHHhhhhh-ccccccccceeeeee--------
Confidence            78999998873211             12368888 88889999999998878543 111222222222211        


Q ss_pred             cccCCccceecCCCCcccccchhhhccccccccCCCCCCC-CC----cccCCCCCccccccchhhhhhhccCCCCCccCC
Q psy7449         457 VKSRGHETVICHHCRDLLPYKIKDLVSHGELCSGVPRPDG-SF----RFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCL  531 (596)
Q Consensus       457 ~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~-~~----~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~  531 (596)
                                    ++.+.        ..+|..|...... +.    --.|..|...|.....|..|++.++    |.|.
T Consensus       157 --------------~k~Yt--------~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h----~~ch  210 (669)
T KOG2231|consen  157 --------------RKLYT--------RAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH----EFCH  210 (669)
T ss_pred             --------------eeheh--------HHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce----ehee
Confidence                          11111        1222222111110 00    1369999999999999999998765    6677


Q ss_pred             CCC------ccccCchhhhhhhhhccCCCcccCC--ccCc-CccChhhHHHHHh
Q psy7449         532 HCS------YKSTQSSCLGRHMRIHTGEKPYACS--LCDL-KFSQNSQLKYHLT  576 (596)
Q Consensus       532 ~C~------~~f~~~~~L~~H~~~H~~~~~~~C~--~C~~-~F~~~~~l~~H~~  576 (596)
                      .|.      .-|.....|..|.+.++    |.|+  .|.. .|...-.+..|++
T Consensus       211 fC~~~~~~neyy~~~~dLe~HfR~~H----flCE~~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  211 FCDYKTGQNEYYNDYDDLEEHFRKGH----FLCEEEFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             ecCcccccchhcccchHHHHHhhhcC----ccccccccccceeeehhHHHHHHH
Confidence            774      45667778888887655    7787  5643 3333324444444


No 45 
>smart00355 ZnF_C2H2 zinc finger.
Probab=95.87  E-value=0.0086  Score=33.74  Aligned_cols=23  Identities=35%  Similarity=0.857  Sum_probs=15.7

Q ss_pred             ccCccCcccccChHHHHHHHHHh
Q psy7449         256 FQCKICDSTFKRKQTLDLHIKRH  278 (596)
Q Consensus       256 ~~C~~C~~~f~~~~~l~~H~~~h  278 (596)
                      |.|+.|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45677777777777777776655


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=95.81  E-value=0.0045  Score=53.18  Aligned_cols=40  Identities=30%  Similarity=0.706  Sum_probs=35.3

Q ss_pred             CccCCCCCccccCchhhhhhhhhccCCCcccCCccCcCccChhh
Q psy7449         527 PYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCDLKFSQNSQ  570 (596)
Q Consensus       527 ~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~  570 (596)
                      +|.|. |+.   ....+++|.++|+|+++|.|..|+..|.....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~~  158 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKGE  158 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEecc
Confidence            69998 998   77889999999999999999999998876543


No 47 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.76  E-value=0.007  Score=56.58  Aligned_cols=133  Identities=21%  Similarity=0.342  Sum_probs=87.5

Q ss_pred             ccCcc--CcccccChHHHHHHHHHhcCCCceeeCCCC---Cccc------ccccccccccccccccccCCcccccchhhH
Q psy7449         256 FQCKI--CDSTFKRKQTLDLHIKRHTGERTYKCEFCD---YTAA------RKDTLGVHVRIKHKISICQNCGLILSTITE  324 (596)
Q Consensus       256 ~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~---~~f~------~~~~l~~H~~~~h~~~~C~~C~~~~~~~~~  324 (596)
                      |.|+.  |.........|..|.+.-++.  +.|.+|-   +.|.      ++..|..|...+-..       ..|     
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e-------~GF-----  217 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEE-------EGF-----  217 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccc-------cCc-----
Confidence            67765  666666778888888765442  6777774   2333      233444443321100       000     


Q ss_pred             HHHHHhhhcCCCCCCCCCCCCCCCcccCCCCCcccCHHHHHHhhhhcCCCCccccCcccc-------ccccchhhhhhhh
Q psy7449         325 ELLEHCRICSGKERPDSSTDKSFNYVCYTCDYHTGVRECMKKHIRTHTGEKPFKCTHCRY-------SASRRDTLDHHIQ  397 (596)
Q Consensus       325 ~l~~h~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~-------~f~~~~~L~~H~~  397 (596)
                                           ..--.|..|...|-+...|..|++..+.    .|.+|++       -|.+...|..|.+
T Consensus       218 ---------------------KGHP~C~FC~~~FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         218 ---------------------KGHPLCIFCKIYFYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             ---------------------CCCchhhhccceecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhh
Confidence                                 0114699999999999999999986552    4666654       3888899999987


Q ss_pred             cccCCCCcccCCC--Cc----ccccchhhHHHHhhhcccCC
Q psy7449         398 VSHLYKKRFQCPV--CD----YRCTKKYNLQMHALTKHDLD  432 (596)
Q Consensus       398 ~~H~~~~~~~C~~--C~----~~f~~~~~l~~H~~~~H~~~  432 (596)
                      ..|     |.|..  |-    ..|.....|..|+..-|+..
T Consensus       273 ~~h-----y~ct~qtc~~~k~~vf~~~~el~~h~~~~h~~~  308 (493)
T COG5236         273 NAH-----YCCTFQTCRVGKCYVFPYHTELLEHLTRFHKVN  308 (493)
T ss_pred             cCc-----eEEEEEEEecCcEEEeccHHHHHHHHHHHhhcc
Confidence            666     66644  42    46889999999998888754


No 48 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.57  E-value=0.0053  Score=34.47  Aligned_cols=22  Identities=32%  Similarity=0.865  Sum_probs=14.3

Q ss_pred             ccCCccCcCccChhhHHHHHhh
Q psy7449         556 YACSLCDLKFSQNSQLKYHLTT  577 (596)
Q Consensus       556 ~~C~~C~~~F~~~~~l~~H~~~  577 (596)
                      |.|++|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666654


No 49 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.56  E-value=0.0044  Score=34.41  Aligned_cols=22  Identities=55%  Similarity=1.120  Sum_probs=10.6

Q ss_pred             ccCCCCCccccCchhhhhhhhhc
Q psy7449         528 YKCLHCSYKSTQSSCLGRHMRIH  550 (596)
Q Consensus       528 ~~C~~C~~~f~~~~~L~~H~~~H  550 (596)
                      |+|+.|+.... ...|.+|+++|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~   22 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRH   22 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhh
Confidence            44555555554 55555555544


No 50 
>KOG1146|consensus
Probab=95.54  E-value=0.006  Score=67.58  Aligned_cols=53  Identities=23%  Similarity=0.432  Sum_probs=47.2

Q ss_pred             ccCccccccccchhhhhhhhcccCCCCcccCCCCcccccchhhHHHHhhhccc
Q psy7449         378 KCTHCRYSASRRDTLDHHIQVSHLYKKRFQCPVCDYRCTKKYNLQMHALTKHD  430 (596)
Q Consensus       378 ~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~  430 (596)
                      .|.-|+..+.....+..|++..|...+.|.|+.|+..|.....|..|++..|.
T Consensus       438 e~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp  490 (1406)
T KOG1146|consen  438 ELTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHP  490 (1406)
T ss_pred             cccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhccccccc
Confidence            46667788888889999999899989999999999999999999999999774


No 51 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.52  E-value=0.0047  Score=34.67  Aligned_cols=22  Identities=32%  Similarity=0.628  Sum_probs=12.0

Q ss_pred             ccCCCCCccccccchhhhhhhc
Q psy7449         500 FVCFTCNYHTYKSGHMRQHING  521 (596)
Q Consensus       500 ~~C~~C~~~f~~~~~l~~H~~~  521 (596)
                      |.|.+|++.|.+...|+.|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            3455555555555555555543


No 52 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.29  E-value=0.015  Score=54.56  Aligned_cols=73  Identities=26%  Similarity=0.518  Sum_probs=55.3

Q ss_pred             cCCCCCccccccchhhhhhhccCCCCCccCCCCCc-------cccCchhhhhhhhhccCCCcccCCc--cC----cCccC
Q psy7449         501 VCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSY-------KSTQSSCLGRHMRIHTGEKPYACSL--CD----LKFSQ  567 (596)
Q Consensus       501 ~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~-------~f~~~~~L~~H~~~H~~~~~~~C~~--C~----~~F~~  567 (596)
                      .|..|...|.+-..|..|+|.-+    =.|.+|++       -|.....|..|.+.-    -|.|.+  |-    ..|..
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H----E~ChICD~v~p~~~QYFK~Y~~Le~HF~~~----hy~ct~qtc~~~k~~vf~~  293 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH----EACHICDMVGPIRYQYFKSYEDLEAHFRNA----HYCCTFQTCRVGKCYVFPY  293 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh----hhhhhhhccCccchhhhhCHHHHHHHhhcC----ceEEEEEEEecCcEEEecc
Confidence            59999999999999999998533    24667765       366777888887632    266643  42    46888


Q ss_pred             hhhHHHHHhhcCCC
Q psy7449         568 NSQLKYHLTTRHDL  581 (596)
Q Consensus       568 ~~~l~~H~~~~H~~  581 (596)
                      ..+|+.|+...|+.
T Consensus       294 ~~el~~h~~~~h~~  307 (493)
T COG5236         294 HTELLEHLTRFHKV  307 (493)
T ss_pred             HHHHHHHHHHHhhc
Confidence            99999999999963


No 53 
>KOG2785|consensus
Probab=95.22  E-value=0.026  Score=54.17  Aligned_cols=26  Identities=15%  Similarity=0.270  Sum_probs=19.3

Q ss_pred             cccCCCCCccccccchhhhhhhccCC
Q psy7449         499 RFVCFTCNYHTYKSGHMRQHINGHVG  524 (596)
Q Consensus       499 ~~~C~~C~~~f~~~~~l~~H~~~H~~  524 (596)
                      |-.|.+|++.|.+...-..||..++|
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~Hg  191 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHG  191 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccC
Confidence            45678888888777777788876665


No 54 
>KOG2785|consensus
Probab=95.16  E-value=0.016  Score=55.65  Aligned_cols=54  Identities=19%  Similarity=0.327  Sum_probs=43.0

Q ss_pred             CccccCccccccccchhhhhhhhcccCCCC----------------------cccCCCCc---ccccchhhHHHHhhhc
Q psy7449         375 KPFKCTHCRYSASRRDTLDHHIQVSHLYKK----------------------RFQCPVCD---YRCTKKYNLQMHALTK  428 (596)
Q Consensus       375 k~~~C~~C~~~f~~~~~L~~H~~~~H~~~~----------------------~~~C~~C~---~~f~~~~~l~~H~~~~  428 (596)
                      -|-.|-.|++.|.+...-..||...|+---                      -|.|-.|.   +.|.+....+.||..+
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            356788888888888888888887775322                      27888888   9999999999999764


No 55 
>KOG2482|consensus
Probab=95.14  E-value=0.04  Score=51.79  Aligned_cols=23  Identities=35%  Similarity=0.733  Sum_probs=21.0

Q ss_pred             CccCCCCCccccCchhHHhHhhh
Q psy7449         143 AFKCEYCSYSSYSKSNLRTHMRT  165 (596)
Q Consensus       143 ~~~C~~C~~~f~~~~~L~~H~~~  165 (596)
                      .++|-+|.+.|.++..|+.||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999975


No 56 
>KOG2482|consensus
Probab=95.09  E-value=0.028  Score=52.76  Aligned_cols=181  Identities=18%  Similarity=0.259  Sum_probs=89.3

Q ss_pred             HHHHhhhhhcC-CCCCccCccCccccc-ChHHHHHHHHHhcCCCceeeCCCCCcccccccccccccccccccccCCcccc
Q psy7449         241 SRMIKHIRNHT-GERPFQCKICDSTFK-RKQTLDLHIKRHTGERTYKCEFCDYTAARKDTLGVHVRIKHKISICQNCGLI  318 (596)
Q Consensus       241 ~~l~~H~~~h~-~~~~~~C~~C~~~f~-~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~C~~C~~~  318 (596)
                      ..|..+++.-. .....+|-.|+..+. +++....|+-.-++-..   . =.-.......|..|++..-....|-.|.+.
T Consensus       129 eaLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lni---G-lpDniVyvnelLehLkekL~r~~CLyCeki  204 (423)
T KOG2482|consen  129 EALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNI---G-LPDNIVYVNELLEHLKEKLERLRCLYCEKI  204 (423)
T ss_pred             HHHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhcc---C-CCcceeeHHHHHHHHHHHHhhheeeeeccc
Confidence            34555554332 123457888877665 45666677543222100   0 000112233455666665556677777777


Q ss_pred             cchhhHHHHHHhhhcCC-CCCCCCCCCCCCCccc--CCCCCcccC-HHHHH-----Hhhhh--------cCCCCc--ccc
Q psy7449         319 LSTITEELLEHCRICSG-KERPDSSTDKSFNYVC--YTCDYHTGV-RECMK-----KHIRT--------HTGEKP--FKC  379 (596)
Q Consensus       319 ~~~~~~~l~~h~~~~~~-~~~~~~~~~~~~~~~C--~~C~~~f~~-~~~l~-----~H~~~--------h~~~k~--~~C  379 (596)
                      |.. +..|..||+.-.- +..|....-..+ |.=  ..=|++... .+.+.     .+...        -.+..+  ..|
T Consensus       205 frd-kntLkeHMrkK~HrrinPknreYDkf-yiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~C  282 (423)
T KOG2482|consen  205 FRD-KNTLKEHMRKKRHRRINPKNREYDKF-YIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDDAEALSVVC  282 (423)
T ss_pred             cCC-cHHHHHHHHhccCcccCCCccccceE-EEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCCCCccceEE
Confidence            777 7777777764221 112211110000 000  000111100 00000     00000        001112  578


Q ss_pred             CccccccccchhhhhhhhcccCC--------------------------CCcccCCCCcccccchhhHHHHhhh
Q psy7449         380 THCRYSASRRDTLDHHIQVSHLY--------------------------KKRFQCPVCDYRCTKKYNLQMHALT  427 (596)
Q Consensus       380 ~~C~~~f~~~~~L~~H~~~~H~~--------------------------~~~~~C~~C~~~f~~~~~l~~H~~~  427 (596)
                      -.|.....+...|..||..+|.-                          ...-.|-.|+-.|..+..|..||..
T Consensus       283 LfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  283 LFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             EeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            88888888888888888777721                          1124678888888888888888865


No 57 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.86  E-value=0.012  Score=33.75  Aligned_cols=22  Identities=23%  Similarity=0.585  Sum_probs=13.7

Q ss_pred             ccCCCCCccccccchhhhhhhc
Q psy7449         500 FVCFTCNYHTYKSGHMRQHING  521 (596)
Q Consensus       500 ~~C~~C~~~f~~~~~l~~H~~~  521 (596)
                      |.|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566666666666666666653


No 58 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.68  E-value=0.016  Score=33.24  Aligned_cols=22  Identities=23%  Similarity=0.466  Sum_probs=15.8

Q ss_pred             ccCCCCCccccCchhhhhhhhh
Q psy7449         528 YKCLHCSYKSTQSSCLGRHMRI  549 (596)
Q Consensus       528 ~~C~~C~~~f~~~~~L~~H~~~  549 (596)
                      |.|..|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777653


No 59 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.49  E-value=0.1  Score=54.42  Aligned_cols=158  Identities=22%  Similarity=0.361  Sum_probs=83.3

Q ss_pred             CccccCccccccccchhhhhhhhc-ccCCC--CcccCC--CCcccccchhhHHHHhhhcccCCCCCCCcccCCccccccc
Q psy7449         375 KPFKCTHCRYSASRRDTLDHHIQV-SHLYK--KRFQCP--VCDYRCTKKYNLQMHALTKHDLDIKSDGIIQDAGTYILDT  449 (596)
Q Consensus       375 k~~~C~~C~~~f~~~~~L~~H~~~-~H~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~~~~~~  449 (596)
                      .++.|..|...|.....|..|... .|.++  +++.|+  .|++.|.....+..|...+.........-..+...+....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            356677777777777777777543 56666  677777  5777777777777776663332211111111111111100


Q ss_pred             CCCCccccccCCccceecCCCCcccccchhhhccccccccCCCCCCCCCcccC--CCCCccccccchhhhhhhccCCCC-
Q psy7449         450 ALSPEKRVKSRGHETVICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRFVC--FTCNYHTYKSGHMRQHINGHVGIK-  526 (596)
Q Consensus       450 ~l~~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~~C--~~C~~~f~~~~~l~~H~~~H~~~~-  526 (596)
                      .-.....                              + ...........+.+  ..|-..+.....+..|...|...+ 
T Consensus       368 ~~~~~~~------------------------------~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  416 (467)
T COG5048         368 NNEPPQS------------------------------L-QQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRP  416 (467)
T ss_pred             CCCCccc------------------------------h-hhccCccCCccccccccchhhhhccccccccccccccccCC
Confidence            0000000                              0 00000011111222  224455666666667766666555 


Q ss_pred             -CccCCCCCccccCchhhhhhhhhccCCCcccCCccCc
Q psy7449         527 -PYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCDL  563 (596)
Q Consensus       527 -~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~  563 (596)
                       .+.+..|++.|.....|..|++.|....++.|..++.
T Consensus       417 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  454 (467)
T COG5048         417 YNCKNPPCSKSFNRHYNLIPHKKIHTNHAPLLCSILKS  454 (467)
T ss_pred             cCCCCCcchhhccCcccccccccccccCCceeeccccc
Confidence             4566778888888888888888887777666655443


No 60 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.62  E-value=0.07  Score=55.68  Aligned_cols=154  Identities=24%  Similarity=0.321  Sum_probs=90.4

Q ss_pred             CCcccCCCCccccChhHHHHHhh--hccCC--CCccCC--CCCccccCchhHHhHhhhccCCCceecCCCc--cccchhH
Q psy7449         114 KPYSCGHCPYTARSSSYMLTHLK--VHSGE--KAFKCE--YCSYSSYSKSNLRTHMRTHIGEKPYKCSSCD--FQATQKI  185 (596)
Q Consensus       114 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--~~~~C~--~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~--~~f~~~~  185 (596)
                      .++.|..|...|.....|..|.+  .|.++  +++.|+  .|++.|.....+..|...|.+..++.+..-.  ..+....
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  367 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLL  367 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCcccccccc
Confidence            46778888888888888888888  78888  888888  7888888888888888888877766554322  1111111


Q ss_pred             hhhcccccccccCCCccccchhhhhhhhcccCCCCCCCCCceeec--CCCCccCCChHHHHhhhhhcCCCC--CccCccC
Q psy7449         186 QVKKHVLIICQHCDQSLFGTTQQLADHCRTCDKMPRPDRSYQYQC--YSCEYHSLYSSRMIKHIRNHTGER--PFQCKIC  261 (596)
Q Consensus       186 ~l~~H~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~C--~~C~~~f~~~~~l~~H~~~h~~~~--~~~C~~C  261 (596)
                      .-..+                +.+...       ........+.+  ..|...+.....+..|...+....  .+.+..|
T Consensus       368 ~~~~~----------------~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  424 (467)
T COG5048         368 NNEPP----------------QSLQQY-------KDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPC  424 (467)
T ss_pred             CCCCc----------------cchhhc-------cCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcc
Confidence            10000                000000       00011111111  223444444455555555554443  4566778


Q ss_pred             cccccChHHHHHHHHHhcCCCceeeCCCC
Q psy7449         262 DSTFKRKQTLDLHIKRHTGERTYKCEFCD  290 (596)
Q Consensus       262 ~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  290 (596)
                      .+.|.....+..|++.|....++.|..+.
T Consensus       425 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  453 (467)
T COG5048         425 SKSFNRHYNLIPHKKIHTNHAPLLCSILK  453 (467)
T ss_pred             hhhccCcccccccccccccCCceeecccc
Confidence            88888888888888877766655554433


No 61 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=92.16  E-value=0.11  Score=29.04  Aligned_cols=21  Identities=33%  Similarity=0.468  Sum_probs=15.7

Q ss_pred             cccccccccccCchHHHhHHhh
Q psy7449          60 NTCCICGHVESGAWRLKRHFLK   81 (596)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~   81 (596)
                      ..|+.||+.| ...+|..|+.+
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            4688888888 56778888654


No 62 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=91.58  E-value=0.17  Score=28.21  Aligned_cols=20  Identities=35%  Similarity=0.747  Sum_probs=12.6

Q ss_pred             ccCccCcccccChHHHHHHHH
Q psy7449         256 FQCKICDSTFKRKQTLDLHIK  276 (596)
Q Consensus       256 ~~C~~C~~~f~~~~~l~~H~~  276 (596)
                      ..|+.||+.| ..+.|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566777777 5566666654


No 63 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=91.26  E-value=0.15  Score=31.26  Aligned_cols=24  Identities=25%  Similarity=0.746  Sum_probs=19.3

Q ss_pred             cccCCccCcCccChhhHHHHHhhc
Q psy7449         555 PYACSLCDLKFSQNSQLKYHLTTR  578 (596)
Q Consensus       555 ~~~C~~C~~~F~~~~~l~~H~~~~  578 (596)
                      +|.|++|++.|.+...+..|++..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHChH
Confidence            577888888888888888887643


No 64 
>KOG2893|consensus
Probab=90.07  E-value=0.12  Score=45.86  Aligned_cols=48  Identities=23%  Similarity=0.414  Sum_probs=41.1

Q ss_pred             cccCCCCCcccCHHHHHHhhhhcCCCCccccCccccccccchhhhhhhhccc
Q psy7449         349 YVCYTCDYHTGVRECMKKHIRTHTGEKPFKCTHCRYSASRRDTLDHHIQVSH  400 (596)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~L~~H~~~~H  400 (596)
                      -.|.+|+..|.+...|..|++.    |-|+|.+|.+...+--.|..|...+|
T Consensus        11 pwcwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             ceeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhh
Confidence            4699999999999999999875    44999999999888888888877666


No 65 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=88.95  E-value=0.3  Score=29.46  Aligned_cols=10  Identities=40%  Similarity=1.059  Sum_probs=4.7

Q ss_pred             ccCCCCCccc
Q psy7449         500 FVCFTCNYHT  509 (596)
Q Consensus       500 ~~C~~C~~~f  509 (596)
                      |.|..||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            4455555433


No 66 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=88.52  E-value=0.35  Score=29.16  Aligned_cols=10  Identities=20%  Similarity=0.697  Sum_probs=4.7

Q ss_pred             eecCCCCccc
Q psy7449         465 VICHHCRDLL  474 (596)
Q Consensus       465 ~~C~~C~~~~  474 (596)
                      |+|.+||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            4455555443


No 67 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=88.00  E-value=0.39  Score=29.31  Aligned_cols=21  Identities=29%  Similarity=0.490  Sum_probs=11.3

Q ss_pred             cccCCCCccccChhHHHHHhh
Q psy7449         116 YSCGHCPYTARSSSYMLTHLK  136 (596)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~  136 (596)
                      |.|++|++.|.+...+..|++
T Consensus         4 ~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        4 FYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             eEccccCCccCCHHHHHHHHC
Confidence            455555555555555555544


No 68 
>KOG4173|consensus
Probab=87.71  E-value=0.13  Score=44.80  Aligned_cols=83  Identities=24%  Similarity=0.424  Sum_probs=65.0

Q ss_pred             CcccCCC--CCccccccchhhhhhhccCCCCCccCCCCCccccCchhhhhhhh-hc---------cCCCcccCC--ccCc
Q psy7449         498 FRFVCFT--CNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCLGRHMR-IH---------TGEKPYACS--LCDL  563 (596)
Q Consensus       498 ~~~~C~~--C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~-~H---------~~~~~~~C~--~C~~  563 (596)
                      ..|.|.+  |...|.....+..|...-+|   ..|.+|.+.|++..-|-.|+. .|         -|...|+|-  -|+.
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~  154 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTE  154 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhh
Confidence            3467755  77888888888888865443   359999999999999998875 34         356679995  4999


Q ss_pred             CccChhhHHHHHhhcCCCCC
Q psy7449         564 KFSQNSQLKYHLTTRHDLPD  583 (596)
Q Consensus       564 ~F~~~~~l~~H~~~~H~~~~  583 (596)
                      .|.+...-+.|+-..|..+.
T Consensus       155 KFkT~r~RkdH~I~~Hk~Pa  174 (253)
T KOG4173|consen  155 KFKTSRDRKDHMIRMHKYPA  174 (253)
T ss_pred             hhhhhhhhhhHHHHhccCCc
Confidence            99999999999999997664


No 69 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=86.65  E-value=1.9  Score=34.36  Aligned_cols=23  Identities=22%  Similarity=0.556  Sum_probs=13.1

Q ss_pred             cccCCccCcCccChhhHHHHHhh
Q psy7449         555 PYACSLCDLKFSQNSQLKYHLTT  577 (596)
Q Consensus       555 ~~~C~~C~~~F~~~~~l~~H~~~  577 (596)
                      .|+|+.|...|=-.-++-.|...
T Consensus        81 ~y~C~~C~~~FC~dCD~fiHe~L  103 (112)
T TIGR00622        81 RYVCAVCKNVFCVDCDVFVHESL  103 (112)
T ss_pred             ceeCCCCCCccccccchhhhhhc
Confidence            46666666666555555555433


No 70 
>KOG2893|consensus
Probab=85.88  E-value=0.37  Score=42.93  Aligned_cols=42  Identities=24%  Similarity=0.578  Sum_probs=21.7

Q ss_pred             ecCCCCccCCChHHHHhhhhhcCCCCCccCccCcccccChHHHHHH
Q psy7449         229 QCYSCEYHSLYSSRMIKHIRNHTGERPFQCKICDSTFKRKQTLDLH  274 (596)
Q Consensus       229 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  274 (596)
                      .|-.|++.|.+..-|++|++.    +-|+|.+|.+...+--.|..|
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceee
Confidence            455555555555555555543    225555555554444444444


No 71 
>KOG4173|consensus
Probab=85.82  E-value=0.19  Score=43.66  Aligned_cols=81  Identities=22%  Similarity=0.414  Sum_probs=63.7

Q ss_pred             cccCC--CCCcccCHHHHHHhhhhcCCCCccccCccccccccchhhhhhhhccc---------CCCCcccCCC--Ccccc
Q psy7449         349 YVCYT--CDYHTGVRECMKKHIRTHTGEKPFKCTHCRYSASRRDTLDHHIQVSH---------LYKKRFQCPV--CDYRC  415 (596)
Q Consensus       349 ~~C~~--C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~L~~H~~~~H---------~~~~~~~C~~--C~~~f  415 (596)
                      +.|++  |...|.+......|..+-++   -.|.+|.+.|.+..-|..|+...|         .|...|+|-+  |+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            66776  77788888878888765444   369999999999999999987777         3455688855  99999


Q ss_pred             cchhhHHHHhhhcccCC
Q psy7449         416 TKKYNLQMHALTKHDLD  432 (596)
Q Consensus       416 ~~~~~l~~H~~~~H~~~  432 (596)
                      .+...-..|+...|...
T Consensus       157 kT~r~RkdH~I~~Hk~P  173 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMHKYP  173 (253)
T ss_pred             hhhhhhhhHHHHhccCC
Confidence            99999999998878643


No 72 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=84.74  E-value=0.35  Score=32.19  Aligned_cols=29  Identities=24%  Similarity=0.564  Sum_probs=16.9

Q ss_pred             CCCcccCCccCcCccChhhHHHHHhhcCC
Q psy7449         552 GEKPYACSLCDLKFSQNSQLKYHLTTRHD  580 (596)
Q Consensus       552 ~~~~~~C~~C~~~F~~~~~l~~H~~~~H~  580 (596)
                      ||..+.|+-||+.|....+..+|+...|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            44455666666666666666666655553


No 73 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=83.71  E-value=2.3  Score=33.84  Aligned_cols=19  Identities=32%  Similarity=0.476  Sum_probs=10.3

Q ss_pred             cccccCCcccccchhhHHHH
Q psy7449         308 KISICQNCGLILSTITEELL  327 (596)
Q Consensus       308 ~~~~C~~C~~~~~~~~~~l~  327 (596)
                      -+..|+.||..... +..|.
T Consensus        14 LP~~CpiCgLtLVs-s~HLA   32 (112)
T TIGR00622        14 LPVECPICGLTLIL-STHLA   32 (112)
T ss_pred             CCCcCCcCCCEEec-cchHH
Confidence            35566666666554 33443


No 74 
>KOG1280|consensus
Probab=83.37  E-value=1.3  Score=42.28  Aligned_cols=41  Identities=20%  Similarity=0.429  Sum_probs=29.2

Q ss_pred             CCcccCCccCcCccChhhHHHHHhhcCCCCCCcceeeeeccC
Q psy7449         553 EKPYACSLCDLKFSQNSQLKYHLTTRHDLPDMSTCLSIECGA  594 (596)
Q Consensus       553 ~~~~~C~~C~~~F~~~~~l~~H~~~~H~~~~~~~c~~~~c~~  594 (596)
                      ...|.|++|+..=.+...|..|+...|.+.++. ++|-.|++
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~-~icp~c~~  117 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTS-VICPLCAA  117 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcc-eeeecccc
Confidence            345788888887777888888888888776644 55566654


No 75 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=83.02  E-value=1.2  Score=35.91  Aligned_cols=25  Identities=28%  Similarity=0.696  Sum_probs=22.9

Q ss_pred             ccC----CCCcccccchhhHHHHhhhccc
Q psy7449         406 FQC----PVCDYRCTKKYNLQMHALTKHD  430 (596)
Q Consensus       406 ~~C----~~C~~~f~~~~~l~~H~~~~H~  430 (596)
                      |.|    +.|+..+.+...+..|.+.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            899    9999999999999999998774


No 76 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=82.04  E-value=0.65  Score=42.58  Aligned_cols=44  Identities=20%  Similarity=0.446  Sum_probs=27.7

Q ss_pred             CccccCccccccccchhhhhhhhccc---------CCCCc-----ccCCCCcccccch
Q psy7449         375 KPFKCTHCRYSASRRDTLDHHIQVSH---------LYKKR-----FQCPVCDYRCTKK  418 (596)
Q Consensus       375 k~~~C~~C~~~f~~~~~L~~H~~~~H---------~~~~~-----~~C~~C~~~f~~~  418 (596)
                      +.+.||+|+..|.++.-+....+...         .+..|     ..||.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            45778888888777665555544322         12223     5899999887654


No 77 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=81.13  E-value=1.3  Score=35.61  Aligned_cols=25  Identities=36%  Similarity=0.729  Sum_probs=16.0

Q ss_pred             Cccc----CCCCCcccCHHHHHHhhhhcC
Q psy7449         348 NYVC----YTCDYHTGVRECMKKHIRTHT  372 (596)
Q Consensus       348 ~~~C----~~C~~~f~~~~~l~~H~~~h~  372 (596)
                      .|.|    ..|++.+.+...+..|++.++
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            4666    666666666666666666554


No 78 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=80.91  E-value=0.76  Score=30.64  Aligned_cols=29  Identities=17%  Similarity=0.403  Sum_probs=17.7

Q ss_pred             CCCcccCCCCcccccchhhHHHHhhhccc
Q psy7449         402 YKKRFQCPVCDYRCTKKYNLQMHALTKHD  430 (596)
Q Consensus       402 ~~~~~~C~~C~~~f~~~~~l~~H~~~~H~  430 (596)
                      ++.-+.||-||..|....+..+|+...|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34446666666666666666666655554


No 79 
>PHA00626 hypothetical protein
Probab=80.69  E-value=1.3  Score=29.81  Aligned_cols=12  Identities=33%  Similarity=1.052  Sum_probs=5.8

Q ss_pred             cccCCCCCcccc
Q psy7449         499 RFVCFTCNYHTY  510 (596)
Q Consensus       499 ~~~C~~C~~~f~  510 (596)
                      .|+|+.||..|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            355555554443


No 80 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=77.84  E-value=1.7  Score=26.35  Aligned_cols=8  Identities=38%  Similarity=0.717  Sum_probs=3.5

Q ss_pred             ccCCCCCc
Q psy7449         528 YKCLHCSY  535 (596)
Q Consensus       528 ~~C~~C~~  535 (596)
                      ..|++||.
T Consensus        19 ~~CP~Cg~   26 (34)
T cd00729          19 EKCPICGA   26 (34)
T ss_pred             CcCcCCCC
Confidence            34444443


No 81 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=77.47  E-value=1.9  Score=24.34  Aligned_cols=11  Identities=27%  Similarity=0.694  Sum_probs=7.8

Q ss_pred             cccCCCCCccc
Q psy7449         349 YVCYTCDYHTG  359 (596)
Q Consensus       349 ~~C~~C~~~f~  359 (596)
                      -.|+.||+.|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            56778877774


No 82 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=75.44  E-value=1.6  Score=40.09  Aligned_cols=43  Identities=19%  Similarity=0.495  Sum_probs=25.0

Q ss_pred             CCccCCCCCccccCchhhhhhhhh---cc-------CCCc-----ccCCccCcCccCh
Q psy7449         526 KPYKCLHCSYKSTQSSCLGRHMRI---HT-------GEKP-----YACSLCDLKFSQN  568 (596)
Q Consensus       526 ~~~~C~~C~~~f~~~~~L~~H~~~---H~-------~~~~-----~~C~~C~~~F~~~  568 (596)
                      +.+.||+|+..|.+...+....++   .+       +.-|     -.|+.||.+|...
T Consensus         4 k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            446677777777666555444432   11       2223     3788888887654


No 83 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=74.18  E-value=2.3  Score=33.93  Aligned_cols=15  Identities=20%  Similarity=0.534  Sum_probs=7.3

Q ss_pred             CCccCCCCCccccCc
Q psy7449         526 KPYKCLHCSYKSTQS  540 (596)
Q Consensus       526 ~~~~C~~C~~~f~~~  540 (596)
                      .|-.|+.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            344455555555433


No 84 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=72.67  E-value=3.7  Score=28.15  Aligned_cols=9  Identities=33%  Similarity=0.936  Sum_probs=5.0

Q ss_pred             cccCCCCCc
Q psy7449         499 RFVCFTCNY  507 (596)
Q Consensus       499 ~~~C~~C~~  507 (596)
                      .|.|+.||.
T Consensus        27 ~F~CPnCGe   35 (61)
T COG2888          27 KFPCPNCGE   35 (61)
T ss_pred             EeeCCCCCc
Confidence            355666653


No 85 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=72.44  E-value=1.4  Score=37.71  Aligned_cols=16  Identities=25%  Similarity=0.486  Sum_probs=9.7

Q ss_pred             ccCCCCCccccCchhh
Q psy7449         528 YKCLHCSYKSTQSSCL  543 (596)
Q Consensus       528 ~~C~~C~~~f~~~~~L  543 (596)
                      ++|+.||+.|.+...+
T Consensus        29 ~~c~~c~~~f~~~e~~   44 (154)
T PRK00464         29 RECLACGKRFTTFERV   44 (154)
T ss_pred             eeccccCCcceEeEec
Confidence            6666666666655443


No 86 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=70.77  E-value=3.5  Score=27.06  Aligned_cols=13  Identities=15%  Similarity=0.429  Sum_probs=8.3

Q ss_pred             ceecCCCCccccc
Q psy7449         464 TVICHHCRDLLPY  476 (596)
Q Consensus       464 ~~~C~~C~~~~~~  476 (596)
                      .|.|+.||..+..
T Consensus         3 ~y~C~~CG~~~~~   15 (46)
T PRK00398          3 EYKCARCGREVEL   15 (46)
T ss_pred             EEECCCCCCEEEE
Confidence            4677777766644


No 87 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=69.36  E-value=4.9  Score=23.96  Aligned_cols=12  Identities=25%  Similarity=0.614  Sum_probs=6.7

Q ss_pred             eecCCCCccccc
Q psy7449         465 VICHHCRDLLPY  476 (596)
Q Consensus       465 ~~C~~C~~~~~~  476 (596)
                      |.|..||..+..
T Consensus         1 Y~C~~Cg~~~~~   12 (32)
T PF03604_consen    1 YICGECGAEVEL   12 (32)
T ss_dssp             EBESSSSSSE-B
T ss_pred             CCCCcCCCeeEc
Confidence            456667666543


No 88 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=69.06  E-value=4.1  Score=32.52  Aligned_cols=30  Identities=17%  Similarity=0.399  Sum_probs=16.9

Q ss_pred             ccCccCcccccChHHHHHHHHHhcCCCceeeCCCCCccccc
Q psy7449         256 FQCKICDSTFKRKQTLDLHIKRHTGERTYKCEFCDYTAARK  296 (596)
Q Consensus       256 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  296 (596)
                      ..|+.||+.|-..           +..|-.|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            3566666666542           23455666666666554


No 89 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=67.76  E-value=8  Score=26.67  Aligned_cols=10  Identities=30%  Similarity=0.896  Sum_probs=5.5

Q ss_pred             cccCCCCCcc
Q psy7449         499 RFVCFTCNYH  508 (596)
Q Consensus       499 ~~~C~~C~~~  508 (596)
                      .|.|+.||..
T Consensus        25 ~F~CPnCG~~   34 (59)
T PRK14890         25 KFLCPNCGEV   34 (59)
T ss_pred             EeeCCCCCCe
Confidence            4566666543


No 90 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=66.87  E-value=3.8  Score=26.60  Aligned_cols=26  Identities=35%  Similarity=0.602  Sum_probs=12.3

Q ss_pred             CcccCCccCcCccCh----hhHHHHHhhcC
Q psy7449         554 KPYACSLCDLKFSQN----SQLKYHLTTRH  579 (596)
Q Consensus       554 ~~~~C~~C~~~F~~~----~~l~~H~~~~H  579 (596)
                      ....|.+|++.+...    ..|.+|++..|
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHHHTT
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhhhhC
Confidence            334566666655543    45666665544


No 91 
>KOG2186|consensus
Probab=66.43  E-value=3  Score=38.07  Aligned_cols=46  Identities=17%  Similarity=0.475  Sum_probs=29.0

Q ss_pred             ccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchhhhhhhh
Q psy7449         500 FVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCLGRHMR  548 (596)
Q Consensus       500 ~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~  548 (596)
                      |.|..||..... ..+.+|+-.-+| .-|.|--||+.|.. ..+..|..
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            667777766543 345557766655 45777777777766 55666654


No 92 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=66.12  E-value=5.2  Score=25.97  Aligned_cols=11  Identities=27%  Similarity=0.525  Sum_probs=6.3

Q ss_pred             eecCCCCcccc
Q psy7449         465 VICHHCRDLLP  475 (596)
Q Consensus       465 ~~C~~C~~~~~  475 (596)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            55666665554


No 93 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=65.70  E-value=3.9  Score=35.32  Aligned_cols=22  Identities=45%  Similarity=1.099  Sum_probs=14.4

Q ss_pred             cccCCCCCcccCHHHHHHhhhhcCCCCccccCccc
Q psy7449         349 YVCYTCDYHTGVRECMKKHIRTHTGEKPFKCTHCR  383 (596)
Q Consensus       349 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~  383 (596)
                      |.|++||+.             +.++.|-+||+||
T Consensus       135 ~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         135 WVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            777777764             3456666777776


No 94 
>KOG2186|consensus
Probab=65.62  E-value=3.2  Score=37.88  Aligned_cols=46  Identities=15%  Similarity=0.427  Sum_probs=22.8

Q ss_pred             cccCCCCccccChhHHHHHhhhccCCCCccCCCCCccccCchhHHhHhh
Q psy7449         116 YSCGHCPYTARSSSYMLTHLKVHSGEKAFKCEYCSYSSYSKSNLRTHMR  164 (596)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  164 (596)
                      |.|..||.... +..+.+|+..-.+ .-|.|-.|++.|.. .++..|..
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhhh
Confidence            44555555444 2334445554444 33555556655555 44455543


No 95 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=65.11  E-value=6.7  Score=24.32  Aligned_cols=10  Identities=30%  Similarity=0.959  Sum_probs=4.6

Q ss_pred             ccCccCcccc
Q psy7449         256 FQCKICDSTF  265 (596)
Q Consensus       256 ~~C~~C~~~f  265 (596)
                      .+|+.|+..|
T Consensus        26 vrC~~C~~~f   35 (37)
T PF13719_consen   26 VRCPKCGHVF   35 (37)
T ss_pred             EECCCCCcEe
Confidence            4444444443


No 96 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=65.03  E-value=3.6  Score=27.81  Aligned_cols=11  Identities=18%  Similarity=0.558  Sum_probs=5.6

Q ss_pred             ccCCCCCcccc
Q psy7449         500 FVCFTCNYHTY  510 (596)
Q Consensus       500 ~~C~~C~~~f~  510 (596)
                      |+|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            45555555444


No 97 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=64.81  E-value=4.2  Score=34.81  Aligned_cols=19  Identities=16%  Similarity=0.308  Sum_probs=14.1

Q ss_pred             cccCCCCCccccccchhhh
Q psy7449         499 RFVCFTCNYHTYKSGHMRQ  517 (596)
Q Consensus       499 ~~~C~~C~~~f~~~~~l~~  517 (596)
                      .++|+.||++|.+...+..
T Consensus        28 ~~~c~~c~~~f~~~e~~~~   46 (154)
T PRK00464         28 RRECLACGKRFTTFERVEL   46 (154)
T ss_pred             eeeccccCCcceEeEeccC
Confidence            4889999999977665443


No 98 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=63.33  E-value=3.3  Score=26.55  Aligned_cols=13  Identities=23%  Similarity=0.759  Sum_probs=6.5

Q ss_pred             eecCCCccccchh
Q psy7449         172 YKCSSCDFQATQK  184 (596)
Q Consensus       172 ~~C~~C~~~f~~~  184 (596)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            4555555555443


No 99 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=63.26  E-value=2.1  Score=31.17  Aligned_cols=40  Identities=15%  Similarity=0.175  Sum_probs=18.1

Q ss_pred             ccCCCCCccccccchhhhhhhccCCCCCccCC--CCCccccCch
Q psy7449         500 FVCFTCNYHTYKSGHMRQHINGHVGIKPYKCL--HCSYKSTQSS  541 (596)
Q Consensus       500 ~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~--~C~~~f~~~~  541 (596)
                      +.|+.||....-..+-.....  ..++-++|.  .||..|.+..
T Consensus         2 m~CP~Cg~~a~irtSr~~s~~--~~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYITDT--TKERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             ccCCCCCCccEEEEChhcChh--hheeeeecCCCCCCCEEEEEE
Confidence            456666654432222222211  233445665  5666665544


No 100
>PF12907 zf-met2:  Zinc-binding
Probab=63.15  E-value=4  Score=25.75  Aligned_cols=32  Identities=28%  Similarity=0.664  Sum_probs=20.9

Q ss_pred             ccCCccCcCc---cChhhHHHHHhhcCCCCCCcce
Q psy7449         556 YACSLCDLKF---SQNSQLKYHLTTRHDLPDMSTC  587 (596)
Q Consensus       556 ~~C~~C~~~F---~~~~~l~~H~~~~H~~~~~~~c  587 (596)
                      +.|.+|-..|   .+...|..|....|+..++..|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~C   36 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKNTFEEC   36 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHc
Confidence            4677777444   3445688888888876655544


No 101
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=63.00  E-value=8.5  Score=23.69  Aligned_cols=10  Identities=30%  Similarity=0.982  Sum_probs=4.6

Q ss_pred             ccCccCcccc
Q psy7449         256 FQCKICDSTF  265 (596)
Q Consensus       256 ~~C~~C~~~f  265 (596)
                      .+|+.|+..|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            4444444443


No 102
>PF01352 KRAB:  KRAB box;  InterPro: IPR001909 The Krueppel-associated box (KRAB) is a domain of around 75 amino acids that is found in the N-terminal part of about one third of eukaryotic Krueppel-type C2H2 zinc finger proteins (ZFPs) []. It is enriched in charged amino acids and can be divided into subregions A and B, which are predicted to fold into two amphipathic alpha-helices. The KRAB A and B boxes can be separated by variable spacer segments and many KRAB proteins contain only the A box []. The functions currently known for members of the KRAB-containing protein family include transcriptional repression of RNA polymerase I, II, and III promoters, binding and splicing of RNA, and control of nucleolus function. The KRAB domain functions as a transcriptional repressor when tethered to the template DNA by a DNA-binding domain. A sequence of 45 amino acids in the KRAB A subdomain has been shown to be necessary and sufficient for transcriptional repression. The B box does not repress by itself but does potentiate the repression exerted by the KRAB A subdomain [, ]. Gene silencing requires the binding of the KRAB domain to the RING-B box-coiled coil (RBCC) domain of the KAP-1/TIF1-beta corepressor. As KAP-1 binds to the heterochromatin proteins HP1, it has been proposed that the KRAB-ZFP-bound target gene could be silenced following recruitment to heterochromatin [, ]. KRAB-ZFPs probably constitute the single largest class of transcription factors within the human genome []. Although the function of KRAB-ZFPs is largely unknown, they appear to play important roles during cell differentiation and development. The KRAB domain is generally encoded by two exons. The regions coded by the two exons are known as KRAB-A and KRAB-B.; GO: 0003676 nucleic acid binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1V65_A.
Probab=62.77  E-value=3.5  Score=26.30  Aligned_cols=20  Identities=15%  Similarity=0.154  Sum_probs=14.6

Q ss_pred             chhHHHHhhccccccccccc
Q psy7449          19 DYTSLFRRSKQKHVLHLWPC   38 (596)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~~   38 (596)
                      ...+||+++|+||+.++.+.
T Consensus        21 ~Qk~ly~dvm~Eny~~l~sl   40 (41)
T PF01352_consen   21 AQKNLYRDVMLENYRNLVSL   40 (41)
T ss_dssp             HHHHHHHHHHHHTTTS---S
T ss_pred             eecccchhHHHHhhcccEec
Confidence            36789999999999887764


No 103
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=61.63  E-value=3.2  Score=30.20  Aligned_cols=17  Identities=12%  Similarity=0.139  Sum_probs=9.1

Q ss_pred             CcccCC--CCCccccccch
Q psy7449         498 FRFVCF--TCNYHTYKSGH  514 (596)
Q Consensus       498 ~~~~C~--~C~~~f~~~~~  514 (596)
                      .-++|.  .||.+|.....
T Consensus        26 ~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678         26 RYHQCQNVNCSATFITYES   44 (72)
T ss_pred             eeeecCCCCCCCEEEEEEE
Confidence            345565  56666654443


No 104
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=61.09  E-value=3.7  Score=34.05  Aligned_cols=25  Identities=44%  Similarity=0.703  Sum_probs=11.4

Q ss_pred             ccCCccCcCccChhhHHHHHhhcCCCCC
Q psy7449         556 YACSLCDLKFSQNSQLKYHLTTRHDLPD  583 (596)
Q Consensus       556 ~~C~~C~~~F~~~~~l~~H~~~~H~~~~  583 (596)
                      -.|-.||+.|..   |++|++.|||+.|
T Consensus        73 i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             eEEccCCcccch---HHHHHHHccCCCH
Confidence            355556665554   3666666666543


No 105
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=60.88  E-value=5.8  Score=33.92  Aligned_cols=13  Identities=15%  Similarity=0.350  Sum_probs=6.2

Q ss_pred             cccCCCCCccccc
Q psy7449         499 RFVCFTCNYHTYK  511 (596)
Q Consensus       499 ~~~C~~C~~~f~~  511 (596)
                      .|.|+.|+..|..
T Consensus        99 ~Y~Cp~C~~~y~~  111 (147)
T smart00531       99 YYKCPNCQSKYTF  111 (147)
T ss_pred             EEECcCCCCEeeH
Confidence            3445555544443


No 106
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=59.40  E-value=9  Score=23.77  Aligned_cols=10  Identities=20%  Similarity=0.830  Sum_probs=4.4

Q ss_pred             ccCccCcccc
Q psy7449         256 FQCKICDSTF  265 (596)
Q Consensus       256 ~~C~~C~~~f  265 (596)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            3444444443


No 107
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=59.24  E-value=6.5  Score=34.02  Aligned_cols=24  Identities=38%  Similarity=0.827  Sum_probs=14.9

Q ss_pred             cccCCCCCccccccchhhhhhhccCCCCCccCCCCCc
Q psy7449         499 RFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSY  535 (596)
Q Consensus       499 ~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~  535 (596)
                      .|.|++||..             +.|+.|-+||+||.
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            4677777642             44556677777763


No 108
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=58.65  E-value=7.7  Score=31.51  Aligned_cols=12  Identities=8%  Similarity=-0.128  Sum_probs=5.7

Q ss_pred             CccCCCCCcccc
Q psy7449         527 PYKCLHCSYKST  538 (596)
Q Consensus       527 ~~~C~~C~~~f~  538 (596)
                      |-.|+.||..|.
T Consensus        26 p~vcP~cg~~~~   37 (129)
T TIGR02300        26 PAVSPYTGEQFP   37 (129)
T ss_pred             CccCCCcCCccC
Confidence            444555554443


No 109
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=57.96  E-value=6.3  Score=34.13  Aligned_cols=17  Identities=12%  Similarity=0.235  Sum_probs=8.6

Q ss_pred             CccCCCCCccccCchhh
Q psy7449         527 PYKCLHCSYKSTQSSCL  543 (596)
Q Consensus       527 ~~~C~~C~~~f~~~~~L  543 (596)
                      -|.|+.|+..|+...++
T Consensus       109 ~Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       109 FFICPNMCVRFTFNEAM  125 (158)
T ss_pred             eEECCCCCcEeeHHHHH
Confidence            35555555555554444


No 110
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=57.62  E-value=9.2  Score=33.15  Aligned_cols=16  Identities=19%  Similarity=0.376  Sum_probs=7.4

Q ss_pred             cccCCCCCcccCHHHH
Q psy7449         349 YVCYTCDYHTGVRECM  364 (596)
Q Consensus       349 ~~C~~C~~~f~~~~~l  364 (596)
                      |.|+.|+..|+...++
T Consensus       110 Y~Cp~c~~r~tf~eA~  125 (158)
T TIGR00373       110 FICPNMCVRFTFNEAM  125 (158)
T ss_pred             EECCCCCcEeeHHHHH
Confidence            4444444444444444


No 111
>KOG2807|consensus
Probab=56.06  E-value=13  Score=35.47  Aligned_cols=24  Identities=21%  Similarity=0.513  Sum_probs=14.7

Q ss_pred             CccCccCcccccChHHHHHHHHHh
Q psy7449         255 PFQCKICDSTFKRKQTLDLHIKRH  278 (596)
Q Consensus       255 ~~~C~~C~~~f~~~~~l~~H~~~h  278 (596)
                      .|.|..|...|-..=..-.|...|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             cEEchhccceeeccchHHHHhhhh
Confidence            466777766666555555565554


No 112
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=55.83  E-value=5.8  Score=25.05  Aligned_cols=10  Identities=30%  Similarity=0.949  Sum_probs=4.7

Q ss_pred             ccCCCCCccc
Q psy7449         144 FKCEYCSYSS  153 (596)
Q Consensus       144 ~~C~~C~~~f  153 (596)
                      |+|..||..|
T Consensus         6 y~C~~Cg~~f   15 (41)
T smart00834        6 YRCEDCGHTF   15 (41)
T ss_pred             EEcCCCCCEE
Confidence            4444444444


No 113
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=55.52  E-value=15  Score=23.47  Aligned_cols=27  Identities=22%  Similarity=0.728  Sum_probs=21.0

Q ss_pred             CCCCCcccCCCCCcccCHHHHHHhhhh
Q psy7449         344 DKSFNYVCYTCDYHTGVRECMKKHIRT  370 (596)
Q Consensus       344 ~~~~~~~C~~C~~~f~~~~~l~~H~~~  370 (596)
                      .+.+.|+|-+|+++....+.|-.||+.
T Consensus        16 gkp~~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   16 GKPFKYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             CCCccceeecCCcccchHHHHHHHHHH
Confidence            445668888888888888888888763


No 114
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=55.44  E-value=8.9  Score=31.16  Aligned_cols=31  Identities=13%  Similarity=0.029  Sum_probs=17.4

Q ss_pred             ccccccccccccCchHHHhHHhhhcCCCCcccCcCcccccCh
Q psy7449          59 KNTCCICGHVESGAWRLKRHFLKHTGEKSYECCWCTYKTAYE  100 (596)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  100 (596)
                      +..|+.||+.|...           +..|-.|+.||..|.-.
T Consensus         9 Kr~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300         9 KRICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             cccCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            34566666666542           23456666666665443


No 115
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=55.32  E-value=6.3  Score=26.11  Aligned_cols=10  Identities=20%  Similarity=0.763  Sum_probs=5.4

Q ss_pred             ccCCCCCccc
Q psy7449         500 FVCFTCNYHT  509 (596)
Q Consensus       500 ~~C~~C~~~f  509 (596)
                      |.|..||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5555555555


No 116
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=55.12  E-value=13  Score=31.87  Aligned_cols=13  Identities=23%  Similarity=0.649  Sum_probs=6.3

Q ss_pred             ccccCcccccccc
Q psy7449         376 PFKCTHCRYSASR  388 (596)
Q Consensus       376 ~~~C~~C~~~f~~  388 (596)
                      -|.|+.|+..|..
T Consensus        99 ~Y~Cp~C~~~y~~  111 (147)
T smart00531       99 YYKCPNCQSKYTF  111 (147)
T ss_pred             EEECcCCCCEeeH
Confidence            3455555554443


No 117
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=55.06  E-value=8.1  Score=30.72  Aligned_cols=11  Identities=27%  Similarity=0.957  Sum_probs=6.8

Q ss_pred             ccCCccCcCcc
Q psy7449         556 YACSLCDLKFS  566 (596)
Q Consensus       556 ~~C~~C~~~F~  566 (596)
                      |.|..|+..+.
T Consensus        91 y~C~~C~~~w~  101 (104)
T TIGR01384        91 YKCTKCGYVWR  101 (104)
T ss_pred             EEeCCCCCeeE
Confidence            66766665543


No 118
>PRK04023 DNA polymerase II large subunit; Validated
Probab=54.92  E-value=12  Score=41.71  Aligned_cols=11  Identities=18%  Similarity=0.459  Sum_probs=6.9

Q ss_pred             ccCCccCcCcc
Q psy7449         556 YACSLCDLKFS  566 (596)
Q Consensus       556 ~~C~~C~~~F~  566 (596)
                      |.|+.||..-.
T Consensus       664 y~CPKCG~El~  674 (1121)
T PRK04023        664 DECEKCGREPT  674 (1121)
T ss_pred             CcCCCCCCCCC
Confidence            56777775443


No 119
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=54.79  E-value=11  Score=21.27  Aligned_cols=19  Identities=21%  Similarity=0.550  Sum_probs=13.4

Q ss_pred             cCCccCcCccChhhHHHHHh
Q psy7449         557 ACSLCDLKFSQNSQLKYHLT  576 (596)
Q Consensus       557 ~C~~C~~~F~~~~~l~~H~~  576 (596)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577787776 5567777764


No 120
>PF14353 CpXC:  CpXC protein
Probab=54.22  E-value=2.2  Score=35.52  Aligned_cols=13  Identities=23%  Similarity=0.892  Sum_probs=8.2

Q ss_pred             eecCCCCcccccc
Q psy7449         465 VICHHCRDLLPYK  477 (596)
Q Consensus       465 ~~C~~C~~~~~~~  477 (596)
                      ..|+.|+..|...
T Consensus         2 itCP~C~~~~~~~   14 (128)
T PF14353_consen    2 ITCPHCGHEFEFE   14 (128)
T ss_pred             cCCCCCCCeeEEE
Confidence            3577777776553


No 121
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=53.26  E-value=8.3  Score=28.89  Aligned_cols=13  Identities=15%  Similarity=0.575  Sum_probs=7.0

Q ss_pred             CcccCCCCccccc
Q psy7449         404 KRFQCPVCDYRCT  416 (596)
Q Consensus       404 ~~~~C~~C~~~f~  416 (596)
                      ..+.|..|+..|.
T Consensus        52 GIW~C~kCg~~fA   64 (89)
T COG1997          52 GIWKCRKCGAKFA   64 (89)
T ss_pred             CeEEcCCCCCeec
Confidence            3455555555554


No 122
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=51.19  E-value=9.2  Score=33.85  Aligned_cols=16  Identities=19%  Similarity=0.555  Sum_probs=7.6

Q ss_pred             ccCCCCCccccCchhh
Q psy7449         528 YKCLHCSYKSTQSSCL  543 (596)
Q Consensus       528 ~~C~~C~~~f~~~~~L  543 (596)
                      |.|+.|+..|+...++
T Consensus       118 Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        118 FFCPNCHIRFTFDEAM  133 (178)
T ss_pred             EECCCCCcEEeHHHHh
Confidence            4455555554444443


No 123
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=50.90  E-value=10  Score=25.31  Aligned_cols=23  Identities=39%  Similarity=0.820  Sum_probs=11.5

Q ss_pred             cCCccCcCccCh-----hhHHHHHhhcC
Q psy7449         557 ACSLCDLKFSQN-----SQLKYHLTTRH  579 (596)
Q Consensus       557 ~C~~C~~~F~~~-----~~l~~H~~~~H  579 (596)
                      .|.+|++.+...     +.|.+|++..|
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~~~h   47 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLRRKH   47 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHHhHC
Confidence            455555554433     35666665433


No 124
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=50.42  E-value=14  Score=32.73  Aligned_cols=16  Identities=19%  Similarity=0.478  Sum_probs=7.7

Q ss_pred             ccccCccccccccchh
Q psy7449         376 PFKCTHCRYSASRRDT  391 (596)
Q Consensus       376 ~~~C~~C~~~f~~~~~  391 (596)
                      -|.|+.|+..|+....
T Consensus       117 ~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        117 FFFCPNCHIRFTFDEA  132 (178)
T ss_pred             EEECCCCCcEEeHHHH
Confidence            3555555555444443


No 125
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=48.05  E-value=16  Score=20.12  Aligned_cols=10  Identities=30%  Similarity=0.986  Sum_probs=6.2

Q ss_pred             CcccCCCCCc
Q psy7449         498 FRFVCFTCNY  507 (596)
Q Consensus       498 ~~~~C~~C~~  507 (596)
                      .+|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            3567777763


No 126
>PF14353 CpXC:  CpXC protein
Probab=47.81  E-value=4.7  Score=33.56  Aligned_cols=19  Identities=26%  Similarity=0.378  Sum_probs=8.9

Q ss_pred             ccCCCCCccccCchhhhhh
Q psy7449         528 YKCLHCSYKSTQSSCLGRH  546 (596)
Q Consensus       528 ~~C~~C~~~f~~~~~L~~H  546 (596)
                      |.|+.||..|.-...+..|
T Consensus        39 ~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen   39 FTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             EECCCCCCceecCCCEEEE
Confidence            4455555555444444433


No 127
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=47.01  E-value=13  Score=34.22  Aligned_cols=14  Identities=50%  Similarity=1.232  Sum_probs=9.6

Q ss_pred             hcCCCceeeCCCCC
Q psy7449         278 HTGERTYKCEFCDY  291 (596)
Q Consensus       278 h~~~~~~~C~~C~~  291 (596)
                      .+|.+.|+|.+|..
T Consensus       137 ~hGGrif~CsfC~~  150 (314)
T PF06524_consen  137 DHGGRIFKCSFCDN  150 (314)
T ss_pred             cCCCeEEEeecCCC
Confidence            34667788887764


No 128
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=46.86  E-value=14  Score=23.54  Aligned_cols=24  Identities=25%  Similarity=0.811  Sum_probs=19.9

Q ss_pred             CcccCCCCCccccccchhhhhhhc
Q psy7449         498 FRFVCFTCNYHTYKSGHMRQHING  521 (596)
Q Consensus       498 ~~~~C~~C~~~f~~~~~l~~H~~~  521 (596)
                      ..|+|-+|.++...++.|.+||+-
T Consensus        19 ~~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   19 FKYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ccceeecCCcccchHHHHHHHHHH
Confidence            347899999999999999999863


No 129
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=46.85  E-value=13  Score=34.17  Aligned_cols=60  Identities=18%  Similarity=0.459  Sum_probs=32.1

Q ss_pred             ceeecCCCCccCCChHHHHhhhhhcCCCCCccCccCcccccChHHHHHHHHHhcCCCceeeCCCCCcccccccccccc
Q psy7449         226 YQYQCYSCEYHSLYSSRMIKHIRNHTGERPFQCKICDSTFKRKQTLDLHIKRHTGERTYKCEFCDYTAARKDTLGVHV  303 (596)
Q Consensus       226 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~  303 (596)
                      ..|+|..|++.-                 .|.|-.|...|-.....+.=.+. ...+++.|+.|+........|..-.
T Consensus       170 E~~KC~SCNrlG-----------------q~sCLRCK~cfCddHvrrKg~ky-~k~k~~PCPKCg~et~eTkdLSmSt  229 (314)
T PF06524_consen  170 ETFKCQSCNRLG-----------------QYSCLRCKICFCDDHVRRKGFKY-EKGKPIPCPKCGYETQETKDLSMST  229 (314)
T ss_pred             cccccccccccc-----------------chhhhheeeeehhhhhhhccccc-ccCCCCCCCCCCCcccccccceeee
Confidence            457888886532                 24555555445442222211221 2336788888887776666665433


No 130
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=45.98  E-value=22  Score=40.92  Aligned_cols=41  Identities=27%  Similarity=0.656  Sum_probs=25.4

Q ss_pred             ccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchhhhhhhhhccCCCcccCCccCcCcc
Q psy7449         500 FVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCDLKFS  566 (596)
Q Consensus       500 ~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~  566 (596)
                      ..|+.||...               +.+|.|+.||.......         ++  ...|+.|+....
T Consensus       680 ~fCP~CGs~t---------------e~vy~CPsCGaev~~de---------s~--a~~CP~CGtplv  720 (1337)
T PRK14714        680 NRCPDCGTHT---------------EPVYVCPDCGAEVPPDE---------SG--RVECPRCDVELT  720 (1337)
T ss_pred             ccCcccCCcC---------------CCceeCccCCCccCCCc---------cc--cccCCCCCCccc
Confidence            3688888643               23578888888654321         12  346888885443


No 131
>KOG2593|consensus
Probab=44.99  E-value=14  Score=36.99  Aligned_cols=37  Identities=22%  Similarity=0.512  Sum_probs=22.7

Q ss_pred             CCCCCccCCCCCccccCchhhhhhhhhccCCCcccCCccC
Q psy7449         523 VGIKPYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCD  562 (596)
Q Consensus       523 ~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~  562 (596)
                      +....|.|+.|++.|+...+|+.   +-.....|.|..|+
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCG  160 (436)
T ss_pred             cccccccCCccccchhhhHHHHh---hcccCceEEEecCC
Confidence            34456777777777776665543   22233457777775


No 132
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=44.97  E-value=21  Score=33.70  Aligned_cols=47  Identities=15%  Similarity=0.323  Sum_probs=29.0

Q ss_pred             ccCccccccccchhhhhhhhcccCCCCcccCCCCcccccchhhHHHHhhh
Q psy7449         378 KCTHCRYSASRRDTLDHHIQVSHLYKKRFQCPVCDYRCTKKYNLQMHALT  427 (596)
Q Consensus       378 ~C~~C~~~f~~~~~L~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~  427 (596)
                      .|-.|.-.|+....   |-.-.-+....|+|+.|...|-..-+.-.|...
T Consensus       364 ~Cf~CQ~~fp~~~~---~~~~~~~ss~rY~Ce~CK~~FC~dCdvfiHe~L  410 (421)
T COG5151         364 HCFVCQGPFPKPPV---SPFDESTSSGRYQCELCKSTFCSDCDVFIHETL  410 (421)
T ss_pred             cceeccCCCCCCCC---CcccccccccceechhhhhhhhhhhHHHHHHHH
Confidence            47677766654332   211122334568888888888887777777655


No 133
>KOG2071|consensus
Probab=44.38  E-value=16  Score=38.26  Aligned_cols=26  Identities=19%  Similarity=0.259  Sum_probs=22.0

Q ss_pred             CcccCCCCCccccccchhhhhhhccC
Q psy7449         498 FRFVCFTCNYHTYKSGHMRQHINGHV  523 (596)
Q Consensus       498 ~~~~C~~C~~~f~~~~~l~~H~~~H~  523 (596)
                      .+-.|..||.+|........||..|.
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CcchhcccccccccchhhhhHhhhhh
Confidence            46789999999999998888887774


No 134
>KOG2593|consensus
Probab=43.79  E-value=27  Score=34.96  Aligned_cols=15  Identities=13%  Similarity=0.228  Sum_probs=7.4

Q ss_pred             CccccccccccccCc
Q psy7449          58 NKNTCCICGHVESGA   72 (596)
Q Consensus        58 ~~~~C~~C~~~f~~~   72 (596)
                      ..|.|+.|++.|..-
T Consensus       127 ~~Y~Cp~C~kkyt~L  141 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSL  141 (436)
T ss_pred             ccccCCccccchhhh
Confidence            345555555555433


No 135
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=43.60  E-value=11  Score=27.55  Aligned_cols=11  Identities=18%  Similarity=0.489  Sum_probs=5.6

Q ss_pred             eecCCCCcccc
Q psy7449         465 VICHHCRDLLP  475 (596)
Q Consensus       465 ~~C~~C~~~~~  475 (596)
                      .+++-|++.|+
T Consensus        11 ~~~~cC~~~y~   21 (71)
T PF05495_consen   11 IRFPCCGKYYP   21 (71)
T ss_dssp             EEETTTTEEES
T ss_pred             EECCcccCeec
Confidence            44555555554


No 136
>PRK04023 DNA polymerase II large subunit; Validated
Probab=42.10  E-value=23  Score=39.71  Aligned_cols=8  Identities=25%  Similarity=0.970  Sum_probs=4.1

Q ss_pred             ccCccCcc
Q psy7449         256 FQCKICDS  263 (596)
Q Consensus       256 ~~C~~C~~  263 (596)
                      +.|+.||.
T Consensus       639 frCP~CG~  646 (1121)
T PRK04023        639 RRCPFCGT  646 (1121)
T ss_pred             ccCCCCCC
Confidence            45555554


No 137
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=42.05  E-value=11  Score=34.20  Aligned_cols=26  Identities=23%  Similarity=0.597  Sum_probs=14.9

Q ss_pred             cccCCccCcCccChhhHHHHHhhcCC
Q psy7449         555 PYACSLCDLKFSQNSQLKYHLTTRHD  580 (596)
Q Consensus       555 ~~~C~~C~~~F~~~~~l~~H~~~~H~  580 (596)
                      .|.|..|+|.|....-+.+|+...|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            46666666666666666666666664


No 138
>KOG4124|consensus
Probab=42.00  E-value=7.3  Score=37.31  Aligned_cols=54  Identities=28%  Similarity=0.570  Sum_probs=41.0

Q ss_pred             CCccccCc--cccccccchhhhhhhhcccC------------------CCCcccCCCCcccccchhhHHHHhhh
Q psy7449         374 EKPFKCTH--CRYSASRRDTLDHHIQVSHL------------------YKKRFQCPVCDYRCTKKYNLQMHALT  427 (596)
Q Consensus       374 ~k~~~C~~--C~~~f~~~~~L~~H~~~~H~------------------~~~~~~C~~C~~~f~~~~~l~~H~~~  427 (596)
                      +++|.|++  |.+.......|..|....|.                  ..++|.|++|.+.+.....|..|+..
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~~  420 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRTH  420 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceeeh
Confidence            47888976  99999988899888655552                  23678999999888887777777654


No 139
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=41.30  E-value=19  Score=39.55  Aligned_cols=9  Identities=22%  Similarity=0.549  Sum_probs=4.4

Q ss_pred             CceeeCCCC
Q psy7449         282 RTYKCEFCD  290 (596)
Q Consensus       282 ~~~~C~~C~  290 (596)
                      .|..|+.|+
T Consensus       474 ~p~~Cp~Cg  482 (730)
T COG1198         474 IPQSCPECG  482 (730)
T ss_pred             CCCCCCCCC
Confidence            344555554


No 140
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=40.51  E-value=9.9  Score=28.95  Aligned_cols=13  Identities=15%  Similarity=0.585  Sum_probs=8.2

Q ss_pred             CcccCCCCccccc
Q psy7449         404 KRFQCPVCDYRCT  416 (596)
Q Consensus       404 ~~~~C~~C~~~f~  416 (596)
                      ..+.|..|++.|+
T Consensus        52 GIW~C~~C~~~~A   64 (90)
T PF01780_consen   52 GIWKCKKCGKKFA   64 (90)
T ss_dssp             TEEEETTTTEEEE
T ss_pred             EEeecCCCCCEEe
Confidence            3466777776664


No 141
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=40.23  E-value=21  Score=24.73  Aligned_cols=6  Identities=33%  Similarity=0.545  Sum_probs=2.3

Q ss_pred             HHHHHh
Q psy7449         103 LKKHQR  108 (596)
Q Consensus       103 l~~H~~  108 (596)
                      |..|+.
T Consensus        26 l~~H~~   31 (60)
T PF02176_consen   26 LDDHLE   31 (60)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            333333


No 142
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=39.17  E-value=27  Score=22.82  Aligned_cols=11  Identities=27%  Similarity=0.761  Sum_probs=6.4

Q ss_pred             CCcccCCccCc
Q psy7449         553 EKPYACSLCDL  563 (596)
Q Consensus       553 ~~~~~C~~C~~  563 (596)
                      ...|+|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            44566666654


No 143
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=38.93  E-value=15  Score=29.98  Aligned_cols=23  Identities=43%  Similarity=0.495  Sum_probs=11.9

Q ss_pred             cCCccCcCccChhhHHHHHhhcCCCC
Q psy7449         557 ACSLCDLKFSQNSQLKYHLTTRHDLP  582 (596)
Q Consensus       557 ~C~~C~~~F~~~~~l~~H~~~~H~~~  582 (596)
                      .|-.+|+.|.   +|++|+.+|+|+.
T Consensus        78 icLEDGkkfK---SLKRHL~t~~gmT  100 (148)
T COG4957          78 ICLEDGKKFK---SLKRHLTTHYGLT  100 (148)
T ss_pred             EEeccCcchH---HHHHHHhcccCCC
Confidence            4444555543   3555666655544


No 144
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=38.52  E-value=14  Score=28.13  Aligned_cols=14  Identities=14%  Similarity=0.439  Sum_probs=8.4

Q ss_pred             CcccCCCCcccccc
Q psy7449         404 KRFQCPVCDYRCTK  417 (596)
Q Consensus       404 ~~~~C~~C~~~f~~  417 (596)
                      ..+.|..|++.|+-
T Consensus        53 GIW~C~~C~~~~AG   66 (90)
T PTZ00255         53 GIWRCKGCKKTVAG   66 (90)
T ss_pred             EEEEcCCCCCEEeC
Confidence            45666666666643


No 145
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=38.25  E-value=18  Score=19.68  Aligned_cols=8  Identities=25%  Similarity=0.908  Sum_probs=3.8

Q ss_pred             cCCCCccc
Q psy7449         467 CHHCRDLL  474 (596)
Q Consensus       467 C~~C~~~~  474 (596)
                      |+.||...
T Consensus         2 Cp~CG~~~    9 (23)
T PF13240_consen    2 CPNCGAEI    9 (23)
T ss_pred             CcccCCCC
Confidence            45555443


No 146
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=38.05  E-value=12  Score=30.98  Aligned_cols=24  Identities=42%  Similarity=0.743  Sum_probs=12.7

Q ss_pred             ccCCCCCccccCchhhhhhhhhccCCC
Q psy7449         528 YKCLHCSYKSTQSSCLGRHMRIHTGEK  554 (596)
Q Consensus       528 ~~C~~C~~~f~~~~~L~~H~~~H~~~~  554 (596)
                      ..|-+||+.|..   |++|++.|+|-.
T Consensus        73 i~clecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   73 IICLECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             EE-TBT--EESB---HHHHHHHTT-S-
T ss_pred             eEEccCCcccch---HHHHHHHccCCC
Confidence            567777777754   477777776643


No 147
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=37.82  E-value=24  Score=21.76  Aligned_cols=10  Identities=20%  Similarity=0.335  Sum_probs=4.9

Q ss_pred             ccCCCCCccc
Q psy7449         528 YKCLHCSYKS  537 (596)
Q Consensus       528 ~~C~~C~~~f  537 (596)
                      -.|+.||-.+
T Consensus        22 ~~Cd~cg~~L   31 (36)
T PF05191_consen   22 GVCDNCGGEL   31 (36)
T ss_dssp             TBCTTTTEBE
T ss_pred             CccCCCCCee
Confidence            4455555443


No 148
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=37.48  E-value=35  Score=21.06  Aligned_cols=19  Identities=26%  Similarity=0.611  Sum_probs=9.9

Q ss_pred             cccCCCCCCCCCcccCCCC
Q psy7449         487 LCSGVPRPDGSFRFVCFTC  505 (596)
Q Consensus       487 l~~h~~~~~~~~~~~C~~C  505 (596)
                      +..|-....|...|.|..|
T Consensus        17 v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen   17 VKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             ceeCCCCCCCCEeEecCcC
Confidence            3344444455555666655


No 149
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=36.98  E-value=17  Score=21.36  Aligned_cols=11  Identities=27%  Similarity=0.682  Sum_probs=2.3

Q ss_pred             ecCCCCccccc
Q psy7449         466 ICHHCRDLLPY  476 (596)
Q Consensus       466 ~C~~C~~~~~~  476 (596)
                      .|+.|+..+.+
T Consensus         4 ~Cp~C~se~~y   14 (30)
T PF08274_consen    4 KCPLCGSEYTY   14 (30)
T ss_dssp             --TTT-----E
T ss_pred             CCCCCCCccee
Confidence            45666655544


No 150
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=36.68  E-value=15  Score=28.09  Aligned_cols=15  Identities=13%  Similarity=0.443  Sum_probs=8.9

Q ss_pred             CCcccCCCCcccccc
Q psy7449         403 KKRFQCPVCDYRCTK  417 (596)
Q Consensus       403 ~~~~~C~~C~~~f~~  417 (596)
                      ...+.|..|++.|.-
T Consensus        51 ~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        51 TGIWTCRKCGAKFAG   65 (91)
T ss_pred             eEEEEcCCCCCEEeC
Confidence            345667777666643


No 151
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=36.30  E-value=19  Score=32.79  Aligned_cols=26  Identities=23%  Similarity=0.589  Sum_probs=11.5

Q ss_pred             cccCCCCcccccchhhHHHHhhhccc
Q psy7449         405 RFQCPVCDYRCTKKYNLQMHALTKHD  430 (596)
Q Consensus       405 ~~~C~~C~~~f~~~~~l~~H~~~~H~  430 (596)
                      .|.|++|+|.|.-..-...|+...|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            35555555555555555555554443


No 152
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=36.16  E-value=36  Score=22.50  Aligned_cols=12  Identities=17%  Similarity=0.310  Sum_probs=8.1

Q ss_pred             eecCCCCccccc
Q psy7449         465 VICHHCRDLLPY  476 (596)
Q Consensus       465 ~~C~~C~~~~~~  476 (596)
                      |+|.+||..+..
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            677777766654


No 153
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.64  E-value=23  Score=27.67  Aligned_cols=12  Identities=8%  Similarity=-0.299  Sum_probs=5.9

Q ss_pred             CcccCCCCCccc
Q psy7449         498 FRFVCFTCNYHT  509 (596)
Q Consensus       498 ~~~~C~~C~~~f  509 (596)
                      .|..|++||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            344455555554


No 154
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=34.25  E-value=37  Score=39.22  Aligned_cols=11  Identities=18%  Similarity=0.673  Sum_probs=7.5

Q ss_pred             ccccCcccccc
Q psy7449         376 PFKCTHCRYSA  386 (596)
Q Consensus       376 ~~~C~~C~~~f  386 (596)
                      +|.|+.||...
T Consensus       692 vy~CPsCGaev  702 (1337)
T PRK14714        692 VYVCPDCGAEV  702 (1337)
T ss_pred             ceeCccCCCcc
Confidence            56777777754


No 155
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=33.94  E-value=32  Score=37.78  Aligned_cols=9  Identities=22%  Similarity=1.021  Sum_probs=5.2

Q ss_pred             eecCCCCcc
Q psy7449         465 VICHHCRDL  473 (596)
Q Consensus       465 ~~C~~C~~~  473 (596)
                      ..|..||..
T Consensus       436 l~C~~Cg~v  444 (730)
T COG1198         436 LLCRDCGYI  444 (730)
T ss_pred             eecccCCCc
Confidence            356666644


No 156
>KOG2272|consensus
Probab=33.60  E-value=23  Score=32.42  Aligned_cols=28  Identities=14%  Similarity=0.610  Sum_probs=14.4

Q ss_pred             eecCCCccccchhHhhhcccccccccCC
Q psy7449         172 YKCSSCDFQATQKIQVKKHVLIICQHCD  199 (596)
Q Consensus       172 ~~C~~C~~~f~~~~~l~~H~~~~c~~c~  199 (596)
                      |.|++|.+...+...++.--+..|..|+
T Consensus       100 F~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn  127 (332)
T KOG2272|consen  100 FRCDLCNKHLADQGFYRNQGRALCRECN  127 (332)
T ss_pred             chhHHHHHHHhhhhhHhhcchHHhhhhh
Confidence            5566666555555555444444444443


No 157
>KOG4377|consensus
Probab=33.50  E-value=32  Score=34.03  Aligned_cols=64  Identities=23%  Similarity=0.365  Sum_probs=37.7

Q ss_pred             ccc--ccccccccCchHHHhHHhhhcC------------CCCccc--CcCcccccChhHHHHHHhhcCCC-------CCc
Q psy7449          60 NTC--CICGHVESGAWRLKRHFLKHTG------------EKSYEC--CWCTYKTAYENDLKKHQRKHTGE-------KPY  116 (596)
Q Consensus        60 ~~C--~~C~~~f~~~~~l~~H~~~h~~------------~~~~~C--~~C~~~f~~~~~l~~H~~~h~~~-------~~~  116 (596)
                      |.|  +.|+-.+.++..+.+|...|..            ...|.|  ..|.+   +-++...|...|+..       --|
T Consensus       272 yhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gfrrthf  348 (480)
T KOG4377|consen  272 YHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTHF  348 (480)
T ss_pred             hcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceeccee
Confidence            445  4677777778888888887752            123566  34777   344566666655321       125


Q ss_pred             ccCCCC--cccc
Q psy7449         117 SCGHCP--YTAR  126 (596)
Q Consensus       117 ~C~~C~--~~f~  126 (596)
                      .|..++  .+|.
T Consensus       349 hC~r~gCTdtfK  360 (480)
T KOG4377|consen  349 HCQRIGCTDTFK  360 (480)
T ss_pred             EEeccCCccccc
Confidence            676666  5555


No 158
>KOG2272|consensus
Probab=33.36  E-value=37  Score=31.10  Aligned_cols=127  Identities=15%  Similarity=0.231  Sum_probs=60.0

Q ss_pred             CccccccccccccCchHHHhHHh----------hhcCCCCcccCcCcccccChhHHHHHHhhcCCCCCcccCCCCccccC
Q psy7449          58 NKNTCCICGHVESGAWRLKRHFL----------KHTGEKSYECCWCTYKTAYENDLKKHQRKHTGEKPYSCGHCPYTARS  127 (596)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~----------~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  127 (596)
                      .-|.|++|.+...+...++.--+          .-.+...|.|..|-..... ..|.---..-+ .--|+|..|++...+
T Consensus        98 ~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~-~~l~fr~d~yH-~yHFkCt~C~keL~s  175 (332)
T KOG2272|consen   98 ACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDE-QPLTFRGDPYH-PYHFKCTTCGKELTS  175 (332)
T ss_pred             ccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhccc-ccccccCCCCC-ccceecccccccccc
Confidence            34678899887777655543221          1112336777777544333 11111000011 122679999888775


Q ss_pred             hhHHHHH----hhhccCCCCccCCCCCccccCch-hHHhHhhhccCCCceecCCCccccchhHhhhc
Q psy7449         128 SSYMLTH----LKVHSGEKAFKCEYCSYSSYSKS-NLRTHMRTHIGEKPYKCSSCDFQATQKIQVKK  189 (596)
Q Consensus       128 ~~~l~~H----~~~h~~~~~~~C~~C~~~f~~~~-~L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  189 (596)
                      .+.-..-    ++-|   ..+.+++||.-=.-.. ....-|-.|-...-|.|..|.+.|.......+
T Consensus       176 daRevk~eLyClrCh---D~mgipiCgaC~rpIeervi~amgKhWHveHFvCa~CekPFlGHrHYEk  239 (332)
T KOG2272|consen  176 DAREVKGELYCLRCH---DKMGIPICGACRRPIEERVIFAMGKHWHVEHFVCAKCEKPFLGHRHYEK  239 (332)
T ss_pred             hhhhhccceeccccc---cccCCcccccccCchHHHHHHHhccccchhheeehhcCCcccchhhhhh
Confidence            4432111    0111   1244555553221111 11112223333445888888888876554443


No 159
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=33.19  E-value=33  Score=23.03  Aligned_cols=11  Identities=36%  Similarity=0.969  Sum_probs=6.1

Q ss_pred             cccCCCCCccc
Q psy7449         499 RFVCFTCNYHT  509 (596)
Q Consensus       499 ~~~C~~C~~~f  509 (596)
                      .+.|..||.++
T Consensus        37 r~~C~~Cgyt~   47 (50)
T PRK00432         37 RWHCGKCGYTE   47 (50)
T ss_pred             cEECCCcCCEE
Confidence            45666666543


No 160
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=32.27  E-value=30  Score=23.52  Aligned_cols=25  Identities=20%  Similarity=0.562  Sum_probs=13.6

Q ss_pred             cccCCCCccccChhHHHHHhhhccCCCCccCCCCCcc
Q psy7449         116 YSCGHCPYTARSSSYMLTHLKVHSGEKAFKCEYCSYS  152 (596)
Q Consensus       116 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  152 (596)
                      .+|+.|++.|..            ++....|+.|+..
T Consensus         6 ~~C~~Cg~~~~~------------~dDiVvCp~Cgap   30 (54)
T PF14446_consen    6 CKCPVCGKKFKD------------GDDIVVCPECGAP   30 (54)
T ss_pred             ccChhhCCcccC------------CCCEEECCCCCCc
Confidence            356666666643            2334566666654


No 161
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=32.17  E-value=73  Score=30.27  Aligned_cols=25  Identities=20%  Similarity=0.149  Sum_probs=13.4

Q ss_pred             CCcccCCCCCcccCHHHHHHhhhhc
Q psy7449         347 FNYVCYTCDYHTGVRECMKKHIRTH  371 (596)
Q Consensus       347 ~~~~C~~C~~~f~~~~~l~~H~~~h  371 (596)
                      ..|.|+.|...|-..-+.-.|...|
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHHHHh
Confidence            3466666655555555555554443


No 162
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=32.15  E-value=26  Score=22.20  Aligned_cols=20  Identities=15%  Similarity=0.292  Sum_probs=12.6

Q ss_pred             CcccCCccCcCccChhhHHH
Q psy7449         554 KPYACSLCDLKFSQNSQLKY  573 (596)
Q Consensus       554 ~~~~C~~C~~~F~~~~~l~~  573 (596)
                      ..+.|+.|+-.+....+|.+
T Consensus        18 ~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   18 EIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEECCCCCeEEccHHHHHH
Confidence            34567777776666666543


No 163
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=31.29  E-value=19  Score=27.46  Aligned_cols=15  Identities=13%  Similarity=0.481  Sum_probs=9.0

Q ss_pred             CCcccCCCCcccccc
Q psy7449         403 KKRFQCPVCDYRCTK  417 (596)
Q Consensus       403 ~~~~~C~~C~~~f~~  417 (596)
                      ...+.|..|++.|.-
T Consensus        52 ~GIW~C~~C~~~~AG   66 (90)
T PRK03976         52 TGIWECRKCGAKFAG   66 (90)
T ss_pred             EEEEEcCCCCCEEeC
Confidence            345667777666643


No 164
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=30.94  E-value=22  Score=22.31  Aligned_cols=11  Identities=27%  Similarity=0.706  Sum_probs=6.6

Q ss_pred             cccCCCCCccc
Q psy7449         499 RFVCFTCNYHT  509 (596)
Q Consensus       499 ~~~C~~C~~~f  509 (596)
                      -|.|..||..|
T Consensus        28 fy~C~~C~~~w   38 (39)
T PF01096_consen   28 FYVCCNCGHRW   38 (39)
T ss_dssp             EEEESSSTEEE
T ss_pred             EEEeCCCCCee
Confidence            36666666554


No 165
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=30.58  E-value=38  Score=28.41  Aligned_cols=14  Identities=14%  Similarity=0.539  Sum_probs=7.8

Q ss_pred             cceecCCCCccccc
Q psy7449         463 ETVICHHCRDLLPY  476 (596)
Q Consensus       463 ~~~~C~~C~~~~~~  476 (596)
                      ..+.|..||..|..
T Consensus        69 ~~~~C~~CG~~~~~   82 (135)
T PRK03824         69 AVLKCRNCGNEWSL   82 (135)
T ss_pred             eEEECCCCCCEEec
Confidence            34566666655543


No 166
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=30.37  E-value=53  Score=22.65  Aligned_cols=21  Identities=19%  Similarity=0.550  Sum_probs=10.0

Q ss_pred             chhHHhHhhhccCCCceecCC
Q psy7449         156 KSNLRTHMRTHIGEKPYKCSS  176 (596)
Q Consensus       156 ~~~L~~H~~~h~~~~~~~C~~  176 (596)
                      +..|..|+...-...+..|+.
T Consensus        23 r~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen   23 RKELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             CCCHHHHHHTTSTTSEEE-SS
T ss_pred             HHHHHHHHHccCCCCcEECCC
Confidence            445555555433444455555


No 167
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=29.93  E-value=43  Score=22.47  Aligned_cols=12  Identities=17%  Similarity=0.357  Sum_probs=7.7

Q ss_pred             eecCCCCccccc
Q psy7449         465 VICHHCRDLLPY  476 (596)
Q Consensus       465 ~~C~~C~~~~~~  476 (596)
                      |+|.+||..+..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            567777766653


No 168
>KOG2807|consensus
Probab=29.58  E-value=63  Score=31.08  Aligned_cols=20  Identities=15%  Similarity=0.386  Sum_probs=10.0

Q ss_pred             ccccCccccccccchhhhhh
Q psy7449         376 PFKCTHCRYSASRRDTLDHH  395 (596)
Q Consensus       376 ~~~C~~C~~~f~~~~~L~~H  395 (596)
                      .|.|+.|...|-.--..-.|
T Consensus       345 ~y~C~~Ck~~FCldCDv~iH  364 (378)
T KOG2807|consen  345 RYRCESCKNVFCLDCDVFIH  364 (378)
T ss_pred             cEEchhccceeeccchHHHH
Confidence            35555555555544444444


No 169
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=28.28  E-value=30  Score=19.94  Aligned_cols=9  Identities=22%  Similarity=0.741  Sum_probs=4.3

Q ss_pred             cCCCCCccc
Q psy7449         501 VCFTCNYHT  509 (596)
Q Consensus       501 ~C~~C~~~f  509 (596)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344455544


No 170
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=28.26  E-value=34  Score=28.15  Aligned_cols=13  Identities=15%  Similarity=0.480  Sum_probs=9.1

Q ss_pred             ceecCCCCccccc
Q psy7449         464 TVICHHCRDLLPY  476 (596)
Q Consensus       464 ~~~C~~C~~~~~~  476 (596)
                      |.+|..||+.|.+
T Consensus         1 PH~Ct~Cg~~f~d   13 (131)
T PF09845_consen    1 PHQCTKCGRVFED   13 (131)
T ss_pred             CcccCcCCCCcCC
Confidence            4567777777766


No 171
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=28.13  E-value=47  Score=20.99  Aligned_cols=11  Identities=27%  Similarity=0.652  Sum_probs=6.1

Q ss_pred             cccCCCCCccc
Q psy7449         499 RFVCFTCNYHT  509 (596)
Q Consensus       499 ~~~C~~C~~~f  509 (596)
                      -|.|..|+..+
T Consensus        28 fy~C~~C~~~w   38 (40)
T smart00440       28 FYVCTKCGHRW   38 (40)
T ss_pred             EEEeCCCCCEe
Confidence            35666666544


No 172
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=28.09  E-value=65  Score=29.68  Aligned_cols=12  Identities=17%  Similarity=0.426  Sum_probs=7.0

Q ss_pred             cccCCCCCcccC
Q psy7449         349 YVCYTCDYHTGV  360 (596)
Q Consensus       349 ~~C~~C~~~f~~  360 (596)
                      |.|+.|+..|..
T Consensus       156 f~C~~C~h~F~G  167 (278)
T PF15135_consen  156 FHCPKCRHNFRG  167 (278)
T ss_pred             eecccccccchh
Confidence            566666665554


No 173
>KOG4167|consensus
Probab=27.29  E-value=17  Score=38.68  Aligned_cols=25  Identities=28%  Similarity=0.677  Sum_probs=23.3

Q ss_pred             CccCccCcccccChHHHHHHHHHhc
Q psy7449         255 PFQCKICDSTFKRKQTLDLHIKRHT  279 (596)
Q Consensus       255 ~~~C~~C~~~f~~~~~l~~H~~~h~  279 (596)
                      -|.|..|++.|.....+..||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3899999999999999999999985


No 174
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=27.02  E-value=53  Score=21.88  Aligned_cols=13  Identities=46%  Similarity=0.981  Sum_probs=7.7

Q ss_pred             cccCCCCCccccc
Q psy7449         499 RFVCFTCNYHTYK  511 (596)
Q Consensus       499 ~~~C~~C~~~f~~  511 (596)
                      .|.|+.||..+.-
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            4666666655543


No 175
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=26.67  E-value=32  Score=23.17  Aligned_cols=20  Identities=15%  Similarity=0.413  Sum_probs=7.7

Q ss_pred             ccccCccccccccchhhhhh
Q psy7449         376 PFKCTHCRYSASRRDTLDHH  395 (596)
Q Consensus       376 ~~~C~~C~~~f~~~~~L~~H  395 (596)
                      .|+|+.|...|-..-.+-.|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTT
T ss_pred             eEECCCCCCccccCcChhhh
Confidence            45555555555554444444


No 176
>KOG3362|consensus
Probab=25.98  E-value=25  Score=29.13  Aligned_cols=22  Identities=14%  Similarity=0.508  Sum_probs=16.6

Q ss_pred             cccCCCCCccccccchhhhhhh
Q psy7449         499 RFVCFTCNYHTYKSGHMRQHIN  520 (596)
Q Consensus       499 ~~~C~~C~~~f~~~~~l~~H~~  520 (596)
                      +|.|.-||-.+-+..-|..|..
T Consensus       129 ~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  129 KYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             hhHHHhcCCceeechhhhhccc
Confidence            4778888888877777777754


No 177
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=25.84  E-value=29  Score=23.07  Aligned_cols=10  Identities=20%  Similarity=0.677  Sum_probs=4.0

Q ss_pred             cccCcccccc
Q psy7449         377 FKCTHCRYSA  386 (596)
Q Consensus       377 ~~C~~C~~~f  386 (596)
                      +.|..||..|
T Consensus         5 l~C~dCg~~F   14 (49)
T PF13451_consen    5 LTCKDCGAEF   14 (49)
T ss_pred             EEcccCCCeE
Confidence            3344444333


No 178
>KOG4167|consensus
Probab=25.49  E-value=19  Score=38.37  Aligned_cols=27  Identities=22%  Similarity=0.262  Sum_probs=23.6

Q ss_pred             CCccccccccccccCchHHHhHHhhhc
Q psy7449          57 QNKNTCCICGHVESGAWRLKRHFLKHT   83 (596)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~   83 (596)
                      .+.|.|.+|+++|....++..||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            567889999999999999999999886


No 179
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=25.40  E-value=48  Score=32.17  Aligned_cols=75  Identities=19%  Similarity=0.267  Sum_probs=39.5

Q ss_pred             cceecCCCCcccccchhhhccccccccCCCCCCCCCcccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchh
Q psy7449         463 ETVICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSC  542 (596)
Q Consensus       463 ~~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~  542 (596)
                      ..-.|++||..-..        +.+ .......|.+-..|..|+-.-            |.  ..-+|+.||..    ..
T Consensus       183 ~~~~CPvCGs~P~~--------s~~-~~~~~~~G~RyL~CslC~teW------------~~--~R~~C~~Cg~~----~~  235 (305)
T TIGR01562       183 SRTLCPACGSPPVA--------SMV-RQGGKETGLRYLSCSLCATEW------------HY--VRVKCSHCEES----KH  235 (305)
T ss_pred             CCCcCCCCCChhhh--------hhh-cccCCCCCceEEEcCCCCCcc------------cc--cCccCCCCCCC----Cc
Confidence            34579999954311        000 111123566778899997422            21  23679999974    22


Q ss_pred             hhhhhhh----ccCCCcccCCccCcC
Q psy7449         543 LGRHMRI----HTGEKPYACSLCDLK  564 (596)
Q Consensus       543 L~~H~~~----H~~~~~~~C~~C~~~  564 (596)
                      |......    ..+.+...|..|+--
T Consensus       236 l~y~~~e~~~~~~~~r~e~C~~C~~Y  261 (305)
T TIGR01562       236 LAYLSLEHDAEKAVLKAETCDSCQGY  261 (305)
T ss_pred             eeeEeecCCCCCcceEEeeccccccc
Confidence            3222211    123355789988743


No 180
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=25.11  E-value=50  Score=19.15  Aligned_cols=11  Identities=27%  Similarity=1.219  Sum_probs=4.4

Q ss_pred             ceeecCCCCcc
Q psy7449         226 YQYQCYSCEYH  236 (596)
Q Consensus       226 ~~~~C~~C~~~  236 (596)
                      ..|.|.+|+..
T Consensus        14 ~~Y~C~~Cdf~   24 (30)
T PF07649_consen   14 WFYRCSECDFD   24 (30)
T ss_dssp             -EEE-TTT---
T ss_pred             ceEECccCCCc
Confidence            56777777654


No 181
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=24.44  E-value=38  Score=21.69  Aligned_cols=9  Identities=33%  Similarity=0.999  Sum_probs=4.2

Q ss_pred             ccCCCCccc
Q psy7449         406 FQCPVCDYR  414 (596)
Q Consensus       406 ~~C~~C~~~  414 (596)
                      +.|+.||..
T Consensus        20 ~vC~~CG~V   28 (43)
T PF08271_consen   20 LVCPNCGLV   28 (43)
T ss_dssp             EEETTT-BB
T ss_pred             EECCCCCCE
Confidence            455555544


No 182
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=24.13  E-value=16  Score=35.45  Aligned_cols=75  Identities=16%  Similarity=0.237  Sum_probs=28.6

Q ss_pred             ceecCCCCcccccchhhhccccccccCCCCCCCCCcccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchhh
Q psy7449         464 TVICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCL  543 (596)
Q Consensus       464 ~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L  543 (596)
                      .-.|++||..-.        .+.+.....  .|.+-..|..|+-..            +.  ...+|+.||..-...-.+
T Consensus       172 ~g~CPvCGs~P~--------~s~l~~~~~--~G~R~L~Cs~C~t~W------------~~--~R~~Cp~Cg~~~~~~l~~  227 (290)
T PF04216_consen  172 RGYCPVCGSPPV--------LSVLRGGER--EGKRYLHCSLCGTEW------------RF--VRIKCPYCGNTDHEKLEY  227 (290)
T ss_dssp             -SS-TTT---EE--------EEEEE--------EEEEEETTT--EE------------E----TTS-TTT---SS-EEE-
T ss_pred             CCcCCCCCCcCc--------eEEEecCCC--CccEEEEcCCCCCee------------ee--cCCCCcCCCCCCCcceee
Confidence            357999995432        112221111  256677899997432            11  235799999875433222


Q ss_pred             hhhhhhccCCCcccCCccCc
Q psy7449         544 GRHMRIHTGEKPYACSLCDL  563 (596)
Q Consensus       544 ~~H~~~H~~~~~~~C~~C~~  563 (596)
                      .. ...-.+.+.+.|..|+-
T Consensus       228 ~~-~e~~~~~rve~C~~C~~  246 (290)
T PF04216_consen  228 FT-VEGEPAYRVEVCESCGS  246 (290)
T ss_dssp             --------SEEEEEETTTTE
T ss_pred             Ee-cCCCCcEEEEECCcccc
Confidence            10 11222445578988874


No 183
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=23.79  E-value=54  Score=27.26  Aligned_cols=13  Identities=23%  Similarity=0.534  Sum_probs=7.1

Q ss_pred             CcccCCCCCcccc
Q psy7449         498 FRFVCFTCNYHTY  510 (596)
Q Consensus       498 ~~~~C~~C~~~f~  510 (596)
                      ..|+|..|++.|.
T Consensus        52 qRyrC~~C~~tf~   64 (129)
T COG3677          52 QRYKCKSCGSTFT   64 (129)
T ss_pred             cccccCCcCccee
Confidence            3455666655554


No 184
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=23.54  E-value=73  Score=30.99  Aligned_cols=78  Identities=19%  Similarity=0.352  Sum_probs=41.9

Q ss_pred             CccceecCCCCcccccchhhhccccccccCCCCCCCCCcccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCc
Q psy7449         461 GHETVICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQS  540 (596)
Q Consensus       461 ~~~~~~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~  540 (596)
                      ++..-.|++||..-..        +.+  +.....|.+-..|..|+-.-            |.  ..-+|+.||..    
T Consensus       184 ~~~~~~CPvCGs~P~~--------s~v--~~~~~~G~RyL~CslC~teW------------~~--~R~~C~~Cg~~----  235 (309)
T PRK03564        184 GEQRQFCPVCGSMPVS--------SVV--QIGTTQGLRYLHCNLCESEW------------HV--VRVKCSNCEQS----  235 (309)
T ss_pred             ccCCCCCCCCCCcchh--------hee--eccCCCCceEEEcCCCCCcc------------cc--cCccCCCCCCC----
Confidence            3445689999964321        111  11223566778899997422            21  23679999962    


Q ss_pred             hhhhhhhh-h-ccCCCcccCCccCcCcc
Q psy7449         541 SCLGRHMR-I-HTGEKPYACSLCDLKFS  566 (596)
Q Consensus       541 ~~L~~H~~-~-H~~~~~~~C~~C~~~F~  566 (596)
                      ..|..... . ..+.+...|..|+--.+
T Consensus       236 ~~l~y~~~~~~~~~~r~e~C~~C~~YlK  263 (309)
T PRK03564        236 GKLHYWSLDSEQAAVKAESCGDCGTYLK  263 (309)
T ss_pred             CceeeeeecCCCcceEeeecccccccce
Confidence            22332211 1 12345578999975433


No 185
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.33  E-value=40  Score=24.57  Aligned_cols=10  Identities=20%  Similarity=0.750  Sum_probs=6.2

Q ss_pred             ccCCCCCccc
Q psy7449         144 FKCEYCSYSS  153 (596)
Q Consensus       144 ~~C~~C~~~f  153 (596)
                      |+|..|+..|
T Consensus        13 Y~c~~cg~~~   22 (82)
T COG2331          13 YECTECGNRF   22 (82)
T ss_pred             EeecccchHH
Confidence            6666666554


No 186
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=23.26  E-value=52  Score=26.65  Aligned_cols=11  Identities=18%  Similarity=0.776  Sum_probs=5.9

Q ss_pred             eecCCCCcccc
Q psy7449         465 VICHHCRDLLP  475 (596)
Q Consensus       465 ~~C~~C~~~~~  475 (596)
                      ..|..||..|+
T Consensus        71 ~~C~~Cg~~~~   81 (114)
T PRK03681         71 CWCETCQQYVT   81 (114)
T ss_pred             EEcccCCCeee
Confidence            45555555544


No 187
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=22.88  E-value=28  Score=38.24  Aligned_cols=11  Identities=27%  Similarity=0.766  Sum_probs=0.0

Q ss_pred             CccCCCCCccc
Q psy7449         527 PYKCLHCSYKS  537 (596)
Q Consensus       527 ~~~C~~C~~~f  537 (596)
                      -|.|+.|+...
T Consensus       680 ~~~Cp~C~~~~  690 (900)
T PF03833_consen  680 VYVCPDCGIEV  690 (900)
T ss_dssp             -----------
T ss_pred             ceecccccccc
Confidence            36677776654


No 188
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=22.76  E-value=56  Score=34.61  Aligned_cols=47  Identities=23%  Similarity=0.684  Sum_probs=0.0

Q ss_pred             cccccCCCccccchhhhhhhhcccCCCCCCCCCceeecCCCCccCCChHHHHhhhhhcCCCCCccCccCcccccChHHHH
Q psy7449         193 IICQHCDQSLFGTTQQLADHCRTCDKMPRPDRSYQYQCYSCEYHSLYSSRMIKHIRNHTGERPFQCKICDSTFKRKQTLD  272 (596)
Q Consensus       193 ~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  272 (596)
                      +.|..||..                          ..|+.|+-....          |.......|..||          
T Consensus       214 ~~C~~Cg~~--------------------------~~C~~C~~~l~~----------h~~~~~l~Ch~Cg----------  247 (505)
T TIGR00595       214 LLCRSCGYI--------------------------LCCPNCDVSLTY----------HKKEGKLRCHYCG----------  247 (505)
T ss_pred             eEhhhCcCc--------------------------cCCCCCCCceEE----------ecCCCeEEcCCCc----------


Q ss_pred             HHHHHhcCCCceeeCCCC
Q psy7449         273 LHIKRHTGERTYKCEFCD  290 (596)
Q Consensus       273 ~H~~~h~~~~~~~C~~C~  290 (596)
                           +...-|..|+.|+
T Consensus       248 -----~~~~~~~~Cp~C~  260 (505)
T TIGR00595       248 -----YQEPIPKTCPQCG  260 (505)
T ss_pred             -----CcCCCCCCCCCCC


No 189
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=22.24  E-value=27  Score=37.58  Aligned_cols=73  Identities=18%  Similarity=0.303  Sum_probs=0.0

Q ss_pred             ecCCCCcccccchhhhccccccccCCCCCCCCCcc-----cCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCc
Q psy7449         466 ICHHCRDLLPYKIKDLVSHGELCSGVPRPDGSFRF-----VCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQS  540 (596)
Q Consensus       466 ~C~~C~~~~~~~~~~~~~~~~l~~h~~~~~~~~~~-----~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~  540 (596)
                      .|+.|-+.+.+                  .+++.|     .|..||=+|+-...|---...-+-..--.|+.|.+.|...
T Consensus       103 ~C~~Cl~Ei~d------------------p~~rrY~YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~dP  164 (750)
T COG0068         103 TCEDCLEEIFD------------------PNSRRYLYPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKDP  164 (750)
T ss_pred             hhHHHHHHhcC------------------CCCcceeccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcCc


Q ss_pred             hhhhhhhhhccCCCcccCCccC
Q psy7449         541 SCLGRHMRIHTGEKPYACSLCD  562 (596)
Q Consensus       541 ~~L~~H~~~H~~~~~~~C~~C~  562 (596)
                      .+-+-|      ..|..|+.||
T Consensus       165 ~nRRfH------AQp~aCp~CG  180 (750)
T COG0068         165 LNRRFH------AQPIACPKCG  180 (750)
T ss_pred             cccccc------cccccCcccC


No 190
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=22.20  E-value=50  Score=26.81  Aligned_cols=12  Identities=17%  Similarity=0.348  Sum_probs=6.3

Q ss_pred             ccCCCCCccccc
Q psy7449         500 FVCFTCNYHTYK  511 (596)
Q Consensus       500 ~~C~~C~~~f~~  511 (596)
                      ..|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            455556555433


No 191
>KOG4124|consensus
Probab=22.09  E-value=28  Score=33.53  Aligned_cols=24  Identities=42%  Similarity=0.959  Sum_probs=16.1

Q ss_pred             CCcccCCccCcCccChhhHHHHHh
Q psy7449         553 EKPYACSLCDLKFSQNSQLKYHLT  576 (596)
Q Consensus       553 ~~~~~C~~C~~~F~~~~~l~~H~~  576 (596)
                      .|+|+|++|.+.+.....|.-|..
T Consensus       396 nk~~r~~i~~~~~k~~~~l~~~~~  419 (442)
T KOG4124|consen  396 NKPYRCEVCSKRYKNLNGLKYHRT  419 (442)
T ss_pred             cCcccChhhhhhhccCCCCCceee
Confidence            567788888777776666655544


No 192
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=22.05  E-value=49  Score=27.23  Aligned_cols=15  Identities=40%  Similarity=0.669  Sum_probs=8.1

Q ss_pred             CCCcccCcCcccccC
Q psy7449          85 EKSYECCWCTYKTAY   99 (596)
Q Consensus        85 ~~~~~C~~C~~~f~~   99 (596)
                      .+.|.|.+|..+...
T Consensus        78 ~~lYeCnIC~etS~e   92 (140)
T PF05290_consen   78 PKLYECNICKETSAE   92 (140)
T ss_pred             CCceeccCcccccch
Confidence            355666666555443


No 193
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=21.90  E-value=65  Score=21.95  Aligned_cols=11  Identities=18%  Similarity=0.410  Sum_probs=6.5

Q ss_pred             cCCCCCccccc
Q psy7449         501 VCFTCNYHTYK  511 (596)
Q Consensus       501 ~C~~C~~~f~~  511 (596)
                      .|..|++.|..
T Consensus         4 ~C~~C~~~F~~   14 (57)
T cd00065           4 SCMGCGKPFTL   14 (57)
T ss_pred             cCcccCccccC
Confidence            36666666654


No 194
>KOG3408|consensus
Probab=21.81  E-value=34  Score=27.52  Aligned_cols=25  Identities=20%  Similarity=0.526  Sum_probs=17.9

Q ss_pred             CCCCccCCCCCccccCchhhhhhhh
Q psy7449         524 GIKPYKCLHCSYKSTQSSCLGRHMR  548 (596)
Q Consensus       524 ~~~~~~C~~C~~~f~~~~~L~~H~~  548 (596)
                      |...|.|-.|.+-|.+..+|..|.+
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHh
Confidence            4455777777777777777777765


No 195
>KOG2461|consensus
Probab=21.62  E-value=2.2e+02  Score=28.91  Aligned_cols=69  Identities=10%  Similarity=-0.161  Sum_probs=33.6

Q ss_pred             CCCCCcccCCCCCccccccchhhhhhhccCCCCCccCCCCCccccCchhhhhhhhhccCCCcccCCccC
Q psy7449         494 PDGSFRFVCFTCNYHTYKSGHMRQHINGHVGIKPYKCLHCSYKSTQSSCLGRHMRIHTGEKPYACSLCD  562 (596)
Q Consensus       494 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~  562 (596)
                      +.+..+..+.++.+.+.....+..|...+.++.++.+..+...+.....+..+..+|+....+.+..|+
T Consensus       326 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  394 (396)
T KOG2461|consen  326 ATVSVWTGETIPVRTPAGQLIYTQSHSMEVAEPTDMAPNQIWKIYHTGVLGFLIITTDESECNNMSFVC  394 (396)
T ss_pred             ccccccCcCcccccccccccchhhhhhcccCCCCcccccccccceeccccceeeeeccccccccccccC
Confidence            333444444555555555555555555555554444444444444444444455555555555554443


No 196
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=21.42  E-value=39  Score=20.51  Aligned_cols=8  Identities=25%  Similarity=0.957  Sum_probs=1.9

Q ss_pred             cCCCCccc
Q psy7449         467 CHHCRDLL  474 (596)
Q Consensus       467 C~~C~~~~  474 (596)
                      |.+|++.|
T Consensus         6 C~eC~~~f   13 (34)
T PF01286_consen    6 CDECGKPF   13 (34)
T ss_dssp             -TTT--EE
T ss_pred             HhHhCCHH
Confidence            33333333


No 197
>KOG1701|consensus
Probab=21.04  E-value=20  Score=35.68  Aligned_cols=36  Identities=31%  Similarity=0.704  Sum_probs=18.4

Q ss_pred             eeCCCCCcccccccccccccc-------cccccccCCcccccc
Q psy7449         285 KCEFCDYTAARKDTLGVHVRI-------KHKISICQNCGLILS  320 (596)
Q Consensus       285 ~C~~C~~~f~~~~~l~~H~~~-------~h~~~~C~~C~~~~~  320 (596)
                      +|.+|++-..-...-..=+++       |..-|.|+.||..++
T Consensus       396 rCs~C~~PI~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS  438 (468)
T KOG1701|consen  396 RCSVCGNPILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLS  438 (468)
T ss_pred             chhhccCCccCCCCCcceEEEEEccccccccceehhhcCcccc
Confidence            577776655444333322222       334566666666654


No 198
>PRK14873 primosome assembly protein PriA; Provisional
Probab=21.02  E-value=64  Score=35.41  Aligned_cols=46  Identities=17%  Similarity=0.585  Sum_probs=0.0

Q ss_pred             cccccCCCccccchhhhhhhhcccCCCCCCCCCceeecCCCCccCCChHHHHhhhhhcCCCCCccCccCcccccChHHHH
Q psy7449         193 IICQHCDQSLFGTTQQLADHCRTCDKMPRPDRSYQYQCYSCEYHSLYSSRMIKHIRNHTGERPFQCKICDSTFKRKQTLD  272 (596)
Q Consensus       193 ~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  272 (596)
                      +.|..||..                          ..|+.|+-....          |.......|..||..        
T Consensus       384 l~C~~Cg~~--------------------------~~C~~C~~~L~~----------h~~~~~l~Ch~CG~~--------  419 (665)
T PRK14873        384 LACARCRTP--------------------------ARCRHCTGPLGL----------PSAGGTPRCRWCGRA--------  419 (665)
T ss_pred             eEhhhCcCe--------------------------eECCCCCCceeE----------ecCCCeeECCCCcCC--------


Q ss_pred             HHHHHhcCCCceeeCCCC
Q psy7449         273 LHIKRHTGERTYKCEFCD  290 (596)
Q Consensus       273 ~H~~~h~~~~~~~C~~C~  290 (596)
                              ..++.|+.|+
T Consensus       420 --------~~p~~Cp~Cg  429 (665)
T PRK14873        420 --------APDWRCPRCG  429 (665)
T ss_pred             --------CcCccCCCCc


No 199
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=20.92  E-value=53  Score=22.73  Aligned_cols=15  Identities=13%  Similarity=0.064  Sum_probs=7.0

Q ss_pred             cccCCCCCccccccc
Q psy7449         499 RFVCFTCNYHTYKSG  513 (596)
Q Consensus       499 ~~~C~~C~~~f~~~~  513 (596)
                      |++...||-.|...+
T Consensus        24 PV~s~~C~H~fek~a   38 (57)
T PF11789_consen   24 PVKSKKCGHTFEKEA   38 (57)
T ss_dssp             EEEESSS--EEEHHH
T ss_pred             CcCcCCCCCeecHHH
Confidence            455556666665443


No 200
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=20.74  E-value=54  Score=25.42  Aligned_cols=14  Identities=29%  Similarity=0.650  Sum_probs=8.5

Q ss_pred             ccccCccccccccc
Q psy7449         376 PFKCTHCRYSASRR  389 (596)
Q Consensus       376 ~~~C~~C~~~f~~~  389 (596)
                      |.+|..||..|.+-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            45666666666654


No 201
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=20.60  E-value=73  Score=19.89  Aligned_cols=22  Identities=27%  Similarity=0.492  Sum_probs=7.9

Q ss_pred             cccCCccCcCcc-Ch-hhHHHHHh
Q psy7449         555 PYACSLCDLKFS-QN-SQLKYHLT  576 (596)
Q Consensus       555 ~~~C~~C~~~F~-~~-~~l~~H~~  576 (596)
                      .|-|++|+..|. +. ..-+.|.+
T Consensus         3 ryyCdyC~~~~~~d~~~~Rk~H~~   26 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDSPSIRKQHER   26 (38)
T ss_dssp             S-B-TTT--B-S--SHHHHHHHT-
T ss_pred             CeecccccceecCCChHHHHHhhc
Confidence            366777777773 32 23355543


No 202
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=20.22  E-value=64  Score=26.08  Aligned_cols=11  Identities=18%  Similarity=0.749  Sum_probs=5.3

Q ss_pred             eecCCCCcccc
Q psy7449         465 VICHHCRDLLP  475 (596)
Q Consensus       465 ~~C~~C~~~~~  475 (596)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            44555554443


No 203
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=20.16  E-value=55  Score=23.47  Aligned_cols=10  Identities=20%  Similarity=0.504  Sum_probs=2.9

Q ss_pred             eecCCCCccc
Q psy7449         465 VICHHCRDLL  474 (596)
Q Consensus       465 ~~C~~C~~~~  474 (596)
                      -.|.+|++.|
T Consensus        10 ~~C~~C~~~F   19 (69)
T PF01363_consen   10 SNCMICGKKF   19 (69)
T ss_dssp             SB-TTT--B-
T ss_pred             CcCcCcCCcC
Confidence            3455555555


No 205
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=20.08  E-value=49  Score=22.61  Aligned_cols=10  Identities=30%  Similarity=0.816  Sum_probs=5.3

Q ss_pred             ccCCCCCccc
Q psy7449         144 FKCEYCSYSS  153 (596)
Q Consensus       144 ~~C~~C~~~f  153 (596)
                      ++|+.||..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            4555555544


No 206
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=20.07  E-value=82  Score=20.04  Aligned_cols=10  Identities=20%  Similarity=0.570  Sum_probs=5.0

Q ss_pred             ccCCCCcccc
Q psy7449         117 SCGHCPYTAR  126 (596)
Q Consensus       117 ~C~~C~~~f~  126 (596)
                      .|+.||..|.
T Consensus        15 ~C~~CgM~Y~   24 (41)
T PF13878_consen   15 TCPTCGMLYS   24 (41)
T ss_pred             CCCCCCCEEC
Confidence            4555555443


Done!