Query         psy7453
Match_columns 200
No_of_seqs    225 out of 2274
Neff          9.2 
Searched_HMMs 46136
Date          Fri Aug 16 18:43:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7453.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7453hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9   2E-28 4.4E-33  188.5   5.6  116   73-196   127-264 (279)
  2 KOG2462|consensus               99.9 3.1E-24 6.6E-29  165.4   5.4  100   91-200   129-240 (279)
  3 KOG3608|consensus               99.7 2.3E-18 5.1E-23  136.7   2.0  133   54-197   188-343 (467)
  4 KOG3576|consensus               99.7 5.6E-18 1.2E-22  125.3   1.9   85  108-200   114-198 (267)
  5 KOG3623|consensus               99.7   8E-18 1.7E-22  144.0   2.2   81  108-196   891-971 (1007)
  6 KOG1074|consensus               99.7 1.3E-17 2.8E-22  144.6   2.5   83  110-200   604-693 (958)
  7 KOG1074|consensus               99.6 9.9E-17 2.1E-21  139.2   3.7   53  148-200   880-932 (958)
  8 KOG3623|consensus               99.6 1.2E-16 2.6E-21  136.9  -0.4  114   77-196   211-330 (1007)
  9 KOG3576|consensus               99.6 3.3E-16 7.2E-21  116.0   1.1  113   72-199   113-236 (267)
 10 KOG3608|consensus               99.5   3E-15 6.4E-20  119.2   3.8  137   53-199   215-376 (467)
 11 PHA00733 hypothetical protein   99.4 2.8E-13   6E-18   96.1   4.9   88  108-200    37-124 (128)
 12 PHA02768 hypothetical protein;  99.2 1.4E-11   3E-16   73.1   2.0   42  148-191     6-47  (55)
 13 PLN03086 PRLI-interacting fact  99.1 1.2E-10 2.6E-15  100.2   6.4   74   98-185   441-514 (567)
 14 PLN03086 PRLI-interacting fact  99.1 1.9E-10 4.2E-15   98.9   6.2  111   75-197   432-562 (567)
 15 PHA00733 hypothetical protein   99.0 1.9E-10 4.2E-15   81.6   3.6   90   71-172    35-124 (128)
 16 PF13465 zf-H2C2_2:  Zinc-finge  99.0 2.4E-10 5.3E-15   58.1   2.4   26  162-187     1-26  (26)
 17 PHA02768 hypothetical protein;  98.9 3.4E-10 7.4E-15   67.2   0.9   43  111-163     5-47  (55)
 18 KOG3993|consensus               98.7 7.8E-09 1.7E-13   84.7   1.6   82  110-199   266-380 (500)
 19 PF13465 zf-H2C2_2:  Zinc-finge  98.6 1.2E-08 2.6E-13   51.8   1.5   26  127-159     1-26  (26)
 20 KOG3993|consensus               98.6 8.1E-09 1.8E-13   84.6   0.6   88   76-171   267-380 (500)
 21 PHA00616 hypothetical protein   98.6   3E-08 6.5E-13   56.1   1.8   33  147-179     1-33  (44)
 22 PHA00732 hypothetical protein   98.5 8.3E-08 1.8E-12   62.1   2.7   48  111-172     1-49  (79)
 23 PHA00616 hypothetical protein   98.4 1.6E-07 3.5E-12   53.1   1.4   39  111-157     1-39  (44)
 24 PHA00732 hypothetical protein   98.3 4.1E-07 8.9E-12   58.9   2.5   46  147-198     1-47  (79)
 25 PF05605 zf-Di19:  Drought indu  98.3 1.3E-06 2.8E-11   52.5   4.4   51  147-200     2-54  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  98.2   1E-06 2.2E-11   43.3   2.0   23  176-198     1-23  (23)
 27 PF05605 zf-Di19:  Drought indu  98.1 4.5E-06 9.8E-11   50.1   3.6   51  111-171     2-53  (54)
 28 PF00096 zf-C2H2:  Zinc finger,  98.0 4.9E-06 1.1E-10   40.7   2.4   23  148-170     1-23  (23)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.9   7E-06 1.5E-10   40.3   2.1   24  176-199     1-24  (24)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.9 6.8E-06 1.5E-10   41.9   1.9   25  175-199     1-25  (27)
 31 PF12756 zf-C2H2_2:  C2H2 type   97.9 7.7E-06 1.7E-10   55.1   2.6   73  113-198     1-73  (100)
 32 COG5189 SFP1 Putative transcri  97.8 2.3E-06   5E-11   68.1  -1.0   71  108-197   346-420 (423)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.6 7.1E-05 1.5E-09   36.6   2.7   23  148-170     1-23  (24)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.6 4.7E-05   1E-09   38.7   1.8   25  147-171     1-25  (27)
 35 smart00355 ZnF_C2H2 zinc finge  97.5 0.00011 2.4E-09   36.4   2.3   23  176-198     1-23  (26)
 36 COG5189 SFP1 Putative transcri  97.4 5.5E-05 1.2E-09   60.5   1.3   58   73-131   346-417 (423)
 37 PRK04860 hypothetical protein;  97.3 0.00014   3E-09   53.5   2.5   37  147-187   119-155 (160)
 38 PF09237 GAGA:  GAGA factor;  I  97.1 0.00065 1.4E-08   39.4   3.3   33  143-175    20-52  (54)
 39 PF13909 zf-H2C2_5:  C2H2-type   97.1 0.00036 7.8E-09   34.3   1.9   24  176-200     1-24  (24)
 40 smart00355 ZnF_C2H2 zinc finge  97.0 0.00063 1.4E-08   33.5   2.5   24  148-171     1-24  (26)
 41 PF09237 GAGA:  GAGA factor;  I  97.0 0.00064 1.4E-08   39.5   2.5   30  171-200    20-49  (54)
 42 PF12874 zf-met:  Zinc-finger o  96.8   0.001 2.2E-08   32.9   1.7   22  176-197     1-22  (25)
 43 PF12874 zf-met:  Zinc-finger o  96.6  0.0016 3.4E-08   32.2   1.7   23  148-170     1-23  (25)
 44 PRK04860 hypothetical protein;  96.5  0.0011 2.5E-08   48.7   1.2   39  110-160   118-156 (160)
 45 PF12756 zf-C2H2_2:  C2H2 type   96.3  0.0043 9.4E-08   41.4   3.0   73   78-170     1-73  (100)
 46 PF13909 zf-H2C2_5:  C2H2-type   96.1  0.0061 1.3E-07   29.8   2.2   23  148-171     1-23  (24)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.0  0.0028   6E-08   32.1   0.8   22  176-197     2-23  (27)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  95.1   0.015 3.3E-07   29.3   1.6   19  112-131     2-20  (27)
 49 PF13913 zf-C2HC_2:  zinc-finge  95.0   0.021 4.6E-07   28.3   2.0   19  177-196     4-22  (25)
 50 KOG2231|consensus               94.6   0.032   7E-07   49.6   3.2   22   77-98    100-121 (669)
 51 COG5048 FOG: Zn-finger [Genera  94.2   0.012 2.5E-07   49.4  -0.2   63  110-180   288-356 (467)
 52 KOG1146|consensus               94.1   0.029 6.2E-07   53.1   2.0   25  173-197   516-540 (1406)
 53 PF13913 zf-C2HC_2:  zinc-finge  94.0   0.056 1.2E-06   26.8   2.1   19  149-168     4-22  (25)
 54 smart00451 ZnF_U1 U1-like zinc  93.8   0.052 1.1E-06   28.9   1.9   22  175-196     3-24  (35)
 55 COG5048 FOG: Zn-finger [Genera  93.7   0.011 2.4E-07   49.5  -1.4   55  146-200   288-348 (467)
 56 TIGR00622 ssl1 transcription f  93.5   0.078 1.7E-06   36.5   2.8   79  109-198    13-104 (112)
 57 smart00451 ZnF_U1 U1-like zinc  93.1    0.08 1.7E-06   28.1   1.9   23  147-169     3-25  (35)
 58 cd00350 rubredoxin_like Rubred  92.6   0.078 1.7E-06   28.1   1.4   24  148-183     2-25  (33)
 59 COG4049 Uncharacterized protei  90.7    0.12 2.6E-06   30.7   0.9   29  141-169    11-39  (65)
 60 PF14446 Prok-RING_1:  Prokaryo  90.1    0.13 2.8E-06   30.5   0.7   28   77-104     6-33  (54)
 61 PF09538 FYDLN_acid:  Protein o  90.0    0.18 3.9E-06   34.6   1.5   28   94-123    11-38  (108)
 62 cd00729 rubredoxin_SM Rubredox  89.3     0.2 4.4E-06   26.7   1.0    9  111-119    18-26  (34)
 63 PF13719 zinc_ribbon_5:  zinc-r  89.2    0.31 6.7E-06   26.5   1.7   32  149-185     4-35  (37)
 64 PF10571 UPF0547:  Uncharacteri  89.0    0.25 5.5E-06   24.7   1.2   22   79-102     3-24  (26)
 65 KOG1146|consensus               88.7   0.083 1.8E-06   50.1  -1.2   73  112-197  1261-1350(1406)
 66 TIGR02098 MJ0042_CXXC MJ0042 f  88.6    0.34 7.4E-06   26.3   1.7   33  148-185     3-35  (38)
 67 KOG2231|consensus               88.5    0.78 1.7E-05   41.2   4.6   34   93-131   100-133 (669)
 68 PRK14890 putative Zn-ribbon RN  88.4    0.47   1E-05   28.6   2.3    8  147-154    48-55  (59)
 69 PHA00626 hypothetical protein   88.3    0.21 4.6E-06   29.6   0.7   13  111-123    23-35  (59)
 70 PRK00398 rpoP DNA-directed RNA  87.6    0.27 5.8E-06   28.1   0.9   26   76-101     3-30  (46)
 71 PF09845 DUF2072:  Zn-ribbon co  87.4    0.27 5.9E-06   34.7   1.0   26   76-101     1-28  (131)
 72 COG1198 PriA Primosomal protei  87.0    0.53 1.1E-05   42.9   2.8   48   94-184   437-484 (730)
 73 PF13717 zinc_ribbon_4:  zinc-r  86.8     0.6 1.3E-05   25.2   1.9   32  149-185     4-35  (36)
 74 TIGR01384 TFS_arch transcripti  86.7    0.32   7E-06   33.0   1.0   35  148-186    63-101 (104)
 75 PF09538 FYDLN_acid:  Protein o  85.9     0.5 1.1E-05   32.4   1.6   30  148-188    10-39  (108)
 76 TIGR02605 CxxC_CxxC_SSSS putat  85.6    0.37 7.9E-06   28.2   0.7   13   77-89      6-18  (52)
 77 KOG2482|consensus               85.4    0.76 1.6E-05   37.7   2.7   50  148-197   280-356 (423)
 78 COG2888 Predicted Zn-ribbon RN  85.3    0.93   2E-05   27.3   2.3    8  147-154    50-57  (61)
 79 PF09986 DUF2225:  Uncharacteri  85.2    0.24 5.3E-06   38.3  -0.2   13  148-160    49-61  (214)
 80 COG4049 Uncharacterized protei  84.4    0.51 1.1E-05   28.0   0.9   24  107-131    13-36  (65)
 81 PF09986 DUF2225:  Uncharacteri  84.3    0.55 1.2E-05   36.3   1.4   19   74-92      3-21  (214)
 82 PF09723 Zn-ribbon_8:  Zinc rib  83.6    0.44 9.6E-06   26.7   0.5   12  112-123     6-17  (42)
 83 KOG2893|consensus               82.9     0.3 6.4E-06   38.0  -0.6   41  114-166    13-53  (341)
 84 PF02892 zf-BED:  BED zinc fing  82.6     1.1 2.4E-05   25.2   1.9   22  174-195    15-40  (45)
 85 COG1592 Rubrerythrin [Energy p  82.3    0.75 1.6E-05   34.0   1.4   23  147-182   134-156 (166)
 86 smart00834 CxxC_CXXC_SSSS Puta  82.2    0.65 1.4E-05   25.5   0.8   12   77-88      6-17  (41)
 87 smart00659 RPOLCX RNA polymera  81.4    0.74 1.6E-05   26.1   0.8   24   77-100     3-27  (44)
 88 TIGR02300 FYDLN_acid conserved  81.3    0.92   2E-05   31.9   1.4   28   94-123    11-38  (129)
 89 TIGR00622 ssl1 transcription f  80.6     2.1 4.5E-05   29.5   2.9   54  113-182    57-110 (112)
 90 PF03604 DNA_RNApol_7kD:  DNA d  80.0     1.2 2.6E-05   23.4   1.3   11   77-87      1-11  (32)
 91 PRK03824 hypA hydrogenase nick  79.9    0.85 1.8E-05   32.6   0.9   16   74-89     68-83  (135)
 92 PF12013 DUF3505:  Protein of u  79.9     1.5 3.2E-05   30.0   2.1   25  176-200    81-109 (109)
 93 COG3364 Zn-ribbon containing p  78.9    0.76 1.6E-05   30.9   0.4   26   76-101     2-29  (112)
 94 PRK12380 hydrogenase nickel in  78.6    0.97 2.1E-05   31.3   0.9   28   74-101    68-95  (113)
 95 PRK00464 nrdR transcriptional   78.5    0.79 1.7E-05   33.6   0.4   13  111-123    28-40  (154)
 96 TIGR02300 FYDLN_acid conserved  78.2     1.5 3.3E-05   30.8   1.7   30  148-188    10-39  (129)
 97 PF05443 ROS_MUCR:  ROS/MUCR tr  78.0     1.3 2.8E-05   31.5   1.3   22  147-171    72-93  (132)
 98 TIGR00100 hypA hydrogenase nic  77.6     1.1 2.4E-05   31.1   0.9   29   74-102    68-96  (115)
 99 KOG4173|consensus               77.6     2.1 4.4E-05   32.7   2.4   48  113-167   108-166 (253)
100 smart00614 ZnF_BED BED zinc fi  77.3     1.6 3.5E-05   25.3   1.4   19  178-196    21-44  (50)
101 smart00531 TFIIE Transcription  77.3     1.6 3.6E-05   31.6   1.8   11  148-158   100-110 (147)
102 PF14445 Prok-RING_2:  Prokaryo  77.3    0.22 4.7E-06   28.9  -2.2   44   76-120     7-50  (57)
103 PRK06266 transcription initiat  77.1    0.63 1.4E-05   34.9  -0.4   14  110-123   116-129 (178)
104 TIGR00373 conserved hypothetic  77.1     2.7 5.9E-05   30.9   2.9   34  142-184   104-137 (158)
105 smart00531 TFIIE Transcription  75.9    0.68 1.5E-05   33.6  -0.5   13  111-123    99-111 (147)
106 COG1996 RPC10 DNA-directed RNA  75.0     1.4   3E-05   25.6   0.7   26   75-100     5-32  (49)
107 TIGR00373 conserved hypothetic  74.7    0.74 1.6E-05   33.9  -0.6   13  111-123   109-121 (158)
108 PRK06266 transcription initiat  74.6     3.2 6.9E-05   31.2   2.8   35  142-185   112-146 (178)
109 smart00734 ZnF_Rad18 Rad18-lik  73.8     3.1 6.7E-05   20.6   1.7   19  177-196     3-21  (26)
110 PF05290 Baculo_IE-1:  Baculovi  73.7     2.7 5.8E-05   29.8   2.0   33   61-93     65-97  (140)
111 PF01155 HypA:  Hydrogenase exp  73.4       1 2.2E-05   31.1  -0.1   28   75-102    69-96  (113)
112 KOG2482|consensus               73.2     5.2 0.00011   33.0   3.8   23  176-198   280-302 (423)
113 KOG1280|consensus               73.0     2.4 5.2E-05   34.9   1.9   38  145-182    77-116 (381)
114 PRK12496 hypothetical protein;  72.6       2 4.3E-05   31.8   1.2   26   77-102   128-153 (164)
115 smart00661 RPOL9 RNA polymeras  71.9     2.3   5E-05   24.6   1.2   13  111-123    20-32  (52)
116 KOG2186|consensus               71.7     1.7 3.8E-05   34.2   0.8   46  112-168     4-49  (276)
117 COG3357 Predicted transcriptio  71.6     2.6 5.7E-05   27.7   1.4   14   75-88     57-70  (97)
118 KOG4167|consensus               71.4       1 2.2E-05   40.6  -0.6   24  176-199   793-816 (907)
119 COG0068 HypF Hydrogenase matur  71.3     1.3 2.9E-05   39.9   0.1   66   77-156   102-182 (750)
120 PF14353 CpXC:  CpXC protein     70.7       2 4.2E-05   30.3   0.8   20  111-131    38-57  (128)
121 PRK03681 hypA hydrogenase nick  70.7       2 4.3E-05   29.8   0.8   28   74-101    68-96  (114)
122 PRK09678 DNA-binding transcrip  69.9       1 2.3E-05   28.4  -0.7   15  145-159    25-41  (72)
123 PF15135 UPF0515:  Uncharacteri  69.9       3 6.6E-05   32.8   1.7   51   73-123   109-167 (278)
124 PF13240 zinc_ribbon_2:  zinc-r  69.7     2.7 5.8E-05   20.2   0.9    6  114-119    16-21  (23)
125 TIGR00595 priA primosomal prot  69.5       4 8.6E-05   35.9   2.6   10  145-154   238-247 (505)
126 PRK00564 hypA hydrogenase nick  69.4     2.2 4.8E-05   29.7   0.8   29   74-102    69-98  (117)
127 PF06524 NOA36:  NOA36 protein;  69.2     1.7 3.6E-05   34.4   0.2   95   94-198   127-232 (314)
128 PF05290 Baculo_IE-1:  Baculovi  68.8     3.1 6.8E-05   29.5   1.5   60   84-161    73-135 (140)
129 PF12773 DZR:  Double zinc ribb  68.2     4.3 9.4E-05   23.3   1.8    8  112-119    30-37  (50)
130 COG4957 Predicted transcriptio  68.0     2.4 5.3E-05   30.0   0.8   21  148-171    77-97  (148)
131 PF08271 TF_Zn_Ribbon:  TFIIB z  67.4     1.9 4.2E-05   24.1   0.1   11  111-121    19-29  (43)
132 COG1592 Rubrerythrin [Energy p  67.3       3 6.4E-05   30.9   1.1   11  109-119   147-157 (166)
133 COG1997 RPL43A Ribosomal prote  67.3     2.8   6E-05   27.4   0.9   10   76-85     35-44  (89)
134 PF03107 C1_2:  C1 domain;  Int  67.1     3.2   7E-05   21.2   1.0   22   77-99      1-22  (30)
135 PRK14714 DNA polymerase II lar  66.1     4.8  0.0001   38.9   2.5   37   77-123   668-704 (1337)
136 COG5236 Uncharacterized conser  66.1     8.1 0.00018   32.0   3.5   71  112-198   221-304 (493)
137 PRK14873 primosome assembly pr  64.1     5.1 0.00011   36.5   2.2   14    2-15    298-311 (665)
138 PF05191 ADK_lid:  Adenylate ki  64.0     3.3 7.1E-05   22.4   0.6   11  111-121    21-31  (36)
139 PF07295 DUF1451:  Protein of u  63.9     4.4 9.6E-05   29.4   1.5   29   73-101   109-139 (146)
140 PF10083 DUF2321:  Uncharacteri  63.6     2.1 4.6E-05   31.2  -0.2   40   79-123    31-80  (158)
141 PF01363 FYVE:  FYVE zinc finge  63.4     3.2 6.9E-05   25.6   0.6   26   77-102    10-35  (69)
142 KOG2785|consensus               63.1     9.1  0.0002   32.1   3.3   51  147-197   166-242 (390)
143 PF00301 Rubredoxin:  Rubredoxi  63.0     4.5 9.7E-05   23.3   1.1    9  111-119    34-42  (47)
144 COG5236 Uncharacterized conser  62.9     6.6 0.00014   32.5   2.4   48  149-197   222-273 (493)
145 TIGR01206 lysW lysine biosynth  62.6       4 8.7E-05   24.2   0.9   26   77-102     3-32  (54)
146 cd00065 FYVE FYVE domain; Zinc  62.5     4.6  0.0001   23.7   1.2   13  111-123    18-30  (57)
147 cd00730 rubredoxin Rubredoxin;  62.0     6.7 0.00015   22.9   1.8    9  111-119    34-42  (50)
148 COG1594 RPB9 DNA-directed RNA   61.6     4.3 9.3E-05   28.1   1.0   11  176-186   101-111 (113)
149 PF07754 DUF1610:  Domain of un  61.6     3.4 7.4E-05   20.2   0.4    8  175-182    16-23  (24)
150 COG1198 PriA Primosomal protei  61.1     5.7 0.00012   36.5   2.0   22   93-120   463-484 (730)
151 PF05443 ROS_MUCR:  ROS/MUCR tr  60.9     6.5 0.00014   28.0   1.9   25  108-143    69-93  (132)
152 PF06524 NOA36:  NOA36 protein;  60.0     3.2   7E-05   32.9   0.2   26  145-170   207-232 (314)
153 COG4306 Uncharacterized protei  59.9     3.8 8.2E-05   28.7   0.5   32   92-123    39-80  (160)
154 PF07191 zinc-ribbons_6:  zinc-  59.4       2 4.3E-05   27.0  -0.9   39   77-118    18-57  (70)
155 PF07649 C1_3:  C1-like domain;  59.4     3.7 8.1E-05   20.9   0.3    8   79-86      3-10  (30)
156 COG0068 HypF Hydrogenase matur  58.9     1.7 3.8E-05   39.2  -1.6   80   90-184    99-182 (750)
157 smart00064 FYVE Protein presen  58.3     5.9 0.00013   24.3   1.2   24   78-101    12-35  (68)
158 PF12013 DUF3505:  Protein of u  58.1      10 0.00022   25.8   2.4   24  148-171    81-108 (109)
159 PF02176 zf-TRAF:  TRAF-type zi  57.8     5.5 0.00012   23.6   1.0   41  147-187     9-54  (60)
160 KOG2807|consensus               57.6     8.8 0.00019   31.5   2.3   33   93-131   277-309 (378)
161 COG5151 SSL1 RNA polymerase II  57.1     5.2 0.00011   32.6   0.9   91   93-198   309-411 (421)
162 PF08274 PhnA_Zn_Ribbon:  PhnA   56.8     4.7  0.0001   20.8   0.4   25  149-184     4-28  (30)
163 PF13248 zf-ribbon_3:  zinc-rib  56.0     7.5 0.00016   19.1   1.1    7   78-84      4-10  (26)
164 COG4530 Uncharacterized protei  55.3     7.1 0.00015   26.7   1.2   28   94-123    11-38  (129)
165 PRK05580 primosome assembly pr  54.8      10 0.00022   34.7   2.5    7  148-154   409-415 (679)
166 PF04959 ARS2:  Arsenite-resist  54.7      11 0.00025   29.1   2.4   26  144-169    74-99  (214)
167 KOG2893|consensus               54.5     2.9 6.3E-05   32.7  -0.8   42   78-131    12-53  (341)
168 KOG4167|consensus               54.5     3.4 7.3E-05   37.5  -0.5   25  147-171   792-816 (907)
169 PF11238 DUF3039:  Protein of u  54.3     8.9 0.00019   23.0   1.4   27   97-123    30-56  (58)
170 KOG4173|consensus               54.1     1.9 4.2E-05   32.9  -1.8   21  110-131   143-165 (253)
171 PF04641 Rtf2:  Rtf2 RING-finge  53.4     4.1   9E-05   32.5  -0.2   51   73-123   110-162 (260)
172 TIGR00686 phnA alkylphosphonat  53.3       7 0.00015   26.7   0.9   27   78-104     4-31  (109)
173 PRK10220 hypothetical protein;  53.2     7.6 0.00017   26.5   1.1   29   77-105     4-33  (111)
174 COG3091 SprT Zn-dependent meta  52.3     7.3 0.00016   28.3   1.0   13  110-123   116-128 (156)
175 PF08792 A2L_zn_ribbon:  A2L zi  51.7       8 0.00017   20.4   0.8   12   90-101    19-30  (33)
176 PF12907 zf-met2:  Zinc-binding  51.0     9.5 0.00021   21.1   1.1   20  112-131     2-23  (40)
177 PF07975 C1_4:  TFIIH C1-like d  50.8     3.9 8.4E-05   24.0  -0.5   16  147-162    21-36  (51)
178 PF02150 RNA_POL_M_15KD:  RNA p  49.6     4.5 9.7E-05   21.6  -0.3    8  113-120    22-29  (35)
179 KOG2593|consensus               49.2      17 0.00036   31.1   2.8   36  144-182   125-160 (436)
180 smart00249 PHD PHD zinc finger  49.2      16 0.00036   19.7   2.0    9  113-121    16-24  (47)
181 PF14369 zf-RING_3:  zinc-finge  49.0      12 0.00027   19.9   1.3   10   77-86      3-12  (35)
182 PRK04023 DNA polymerase II lar  48.9      13 0.00027   35.4   2.1   23   75-101   625-647 (1121)
183 PF01286 XPA_N:  XPA protein N-  48.6      10 0.00022   20.2   0.9   16   77-92      4-19  (34)
184 PF07282 OrfB_Zn_ribbon:  Putat  48.2     8.6 0.00019   23.6   0.7   28   94-122    30-57  (69)
185 smart00154 ZnF_AN1 AN1-like Zi  48.1      13 0.00029   20.3   1.4   18   76-93     12-29  (39)
186 PF00628 PHD:  PHD-finger;  Int  47.8     8.5 0.00019   22.0   0.6   24   79-103     2-25  (51)
187 PF15269 zf-C2H2_7:  Zinc-finge  47.5      14  0.0003   20.9   1.4   21  176-196    21-41  (54)
188 PRK00420 hypothetical protein;  47.3      10 0.00022   26.2   1.0   27   77-103    24-51  (112)
189 PRK00432 30S ribosomal protein  46.9      11 0.00024   22.0   1.0   11  110-120    36-46  (50)
190 PRK11032 hypothetical protein;  46.2      11 0.00024   27.8   1.1   29   73-101   121-151 (160)
191 PF04959 ARS2:  Arsenite-resist  46.0      11 0.00023   29.3   1.1   26  172-197    74-99  (214)
192 COG0375 HybF Zn finger protein  45.6     8.7 0.00019   26.6   0.5   27   75-101    69-95  (115)
193 PRK04023 DNA polymerase II lar  45.6      14  0.0003   35.2   1.8   34   77-120   639-672 (1121)
194 COG5151 SSL1 RNA polymerase II  45.3      12 0.00026   30.5   1.3   47  114-170   365-411 (421)
195 COG2331 Uncharacterized protei  44.7     3.8 8.3E-05   26.0  -1.2   12   77-88     13-24  (82)
196 PF12760 Zn_Tnp_IS1595:  Transp  43.7      12 0.00025   21.2   0.8    8   77-84     19-26  (46)
197 KOG2593|consensus               43.6      14  0.0003   31.6   1.4   39  108-157   125-163 (436)
198 COG4888 Uncharacterized Zn rib  43.4      11 0.00024   25.4   0.7   30   74-103    20-57  (104)
199 TIGR00595 priA primosomal prot  43.0      17 0.00036   32.0   2.0   24   90-119   238-261 (505)
200 PRK05978 hypothetical protein;  41.8      16 0.00035   26.5   1.4   30   77-106    34-66  (148)
201 KOG4124|consensus               41.5     3.1 6.7E-05   34.4  -2.5   50  146-195   348-418 (442)
202 PRK14873 primosome assembly pr  40.4      17 0.00037   33.2   1.6   21   93-120   411-431 (665)
203 KOG2272|consensus               40.1      18 0.00039   28.7   1.5   15   76-90     99-113 (332)
204 TIGR00515 accD acetyl-CoA carb  40.1      13 0.00028   30.2   0.8   29   76-104    26-57  (285)
205 COG1571 Predicted DNA-binding   39.2      17 0.00036   31.1   1.3   28   94-123   352-379 (421)
206 COG1779 C4-type Zn-finger prot  38.9      14 0.00031   28.1   0.8   30   76-105    14-56  (201)
207 CHL00174 accD acetyl-CoA carbo  38.8     6.8 0.00015   31.9  -1.0   29   76-104    38-69  (296)
208 KOG4218|consensus               38.7     9.4  0.0002   31.6  -0.2   39   78-116    17-56  (475)
209 KOG2785|consensus               38.6      33 0.00071   28.9   2.9   51  111-169   166-242 (390)
210 PF14311 DUF4379:  Domain of un  38.0      26 0.00057   20.5   1.7   13  148-160    29-41  (55)
211 TIGR00515 accD acetyl-CoA carb  37.9     7.2 0.00016   31.6  -1.0   33   91-123    25-57  (285)
212 COG2051 RPS27A Ribosomal prote  37.6      18 0.00039   22.4   1.0   29   77-105    20-51  (67)
213 PTZ00255 60S ribosomal protein  37.3      12 0.00026   24.8   0.1    9   76-84     36-44  (90)
214 PRK05654 acetyl-CoA carboxylas  37.0     7.4 0.00016   31.6  -1.0   28   76-103    27-57  (292)
215 PF13878 zf-C2H2_3:  zinc-finge  37.0      40 0.00087   18.6   2.2   23  148-170    14-38  (41)
216 PF10263 SprT-like:  SprT-like   36.8      11 0.00023   27.3  -0.2   32  147-186   123-154 (157)
217 cd00924 Cyt_c_Oxidase_Vb Cytoc  36.7      17 0.00037   24.4   0.8   17  140-157    73-89  (97)
218 KOG0782|consensus               36.6     2.1 4.6E-05   37.7  -4.3   94   82-189   189-290 (1004)
219 PF01485 IBR:  IBR domain;  Int  36.6      23 0.00051   20.9   1.4   12  112-123    41-52  (64)
220 KOG3408|consensus               36.4      26 0.00056   24.5   1.7   21  148-168    58-78  (129)
221 PRK14714 DNA polymerase II lar  36.1      27 0.00058   34.2   2.2   40   77-121   680-719 (1337)
222 COG1773 Rubredoxin [Energy pro  35.9      16 0.00035   21.8   0.5   12  175-186     3-14  (55)
223 KOG3507|consensus               35.6      14 0.00031   22.2   0.2   13  111-123    37-49  (62)
224 PRK00762 hypA hydrogenase nick  35.6      17 0.00037   25.5   0.7   26   74-100    68-100 (124)
225 KOG2071|consensus               35.5      24 0.00052   31.4   1.7   26  173-198   416-441 (579)
226 PF08209 Sgf11:  Sgf11 (transcr  35.3      13 0.00028   19.6   0.1   19  112-132     5-23  (33)
227 COG1571 Predicted DNA-binding   35.2      22 0.00047   30.5   1.4   32   76-107   350-382 (421)
228 PRK06260 threonine synthase; V  35.2      19  0.0004   30.6   1.0   26   77-102     4-29  (397)
229 PF04810 zf-Sec23_Sec24:  Sec23  35.2      13 0.00028   20.4   0.1   12  144-155    21-32  (40)
230 TIGR00280 L37a ribosomal prote  35.0      11 0.00024   24.9  -0.2   10   76-85     35-44  (91)
231 COG1327 Predicted transcriptio  35.0      17 0.00037   26.5   0.6   11  113-123    30-40  (156)
232 PF01780 Ribosomal_L37ae:  Ribo  34.9      16 0.00034   24.2   0.4   28   76-103    35-64  (90)
233 COG1439 Predicted nucleic acid  34.9      18 0.00039   27.1   0.8   23   77-101   140-162 (177)
234 COG3677 Transposase and inacti  34.7      21 0.00045   25.3   1.1   15  109-123    51-65  (129)
235 smart00731 SprT SprT homologue  34.6      22 0.00048   25.5   1.2   12  111-122   112-123 (146)
236 PF13824 zf-Mss51:  Zinc-finger  34.2      28  0.0006   20.8   1.3   14  109-122    12-25  (55)
237 PF05495 zf-CHY:  CHY zinc fing  33.3      13 0.00029   23.2  -0.1   30  147-184    41-70  (71)
238 PRK05580 primosome assembly pr  32.7      30 0.00064   31.7   1.9   37   78-120   392-430 (679)
239 TIGR00244 transcriptional regu  32.3      20 0.00043   26.0   0.6   11  113-123    30-40  (147)
240 PF11023 DUF2614:  Protein of u  31.9      20 0.00044   24.7   0.6   29   75-103    68-96  (114)
241 PF10013 DUF2256:  Uncharacteri  31.9      30 0.00064   19.4   1.1   12  178-189    11-22  (42)
242 PRK14559 putative protein seri  31.7      32 0.00069   31.3   1.9   37   78-123    17-53  (645)
243 PTZ00303 phosphatidylinositol   31.6      18 0.00038   33.6   0.3   26   77-102   461-491 (1374)
244 COG1326 Uncharacterized archae  31.6      20 0.00043   27.2   0.5    7   77-83      7-13  (201)
245 COG1655 Uncharacterized protei  31.5      15 0.00032   28.7  -0.1   14  110-123    18-31  (267)
246 COG1675 TFA1 Transcription ini  31.2      12 0.00025   28.1  -0.7   13  111-123   113-125 (176)
247 PLN02294 cytochrome c oxidase   31.1      24 0.00053   26.2   0.9   13  174-186   140-152 (174)
248 PRK06450 threonine synthase; V  30.8      24 0.00052   29.3   1.0   26   77-103     4-29  (338)
249 PF04423 Rad50_zn_hook:  Rad50   30.3      19 0.00042   21.0   0.2   12  177-188    22-33  (54)
250 PRK14559 putative protein seri  29.9      36 0.00078   31.0   2.0   37   78-123     3-39  (645)
251 COG4640 Predicted membrane pro  29.8      33 0.00071   29.1   1.5   21  109-130    13-33  (465)
252 KOG1280|consensus               29.6      41 0.00088   28.0   2.0   39  109-154    77-116 (381)
253 KOG3408|consensus               29.6      33 0.00072   24.0   1.3   25  173-197    55-79  (129)
254 PF09332 Mcm10:  Mcm10 replicat  29.4     4.2 9.2E-05   33.8  -3.6   14  110-123   284-297 (344)
255 PF13453 zf-TFIIB:  Transcripti  29.3      50  0.0011   18.0   1.8   16  148-163    20-35  (41)
256 KOG0978|consensus               29.1      21 0.00045   32.7   0.3   21  173-193   676-696 (698)
257 PF10122 Mu-like_Com:  Mu-like   29.0      25 0.00055   20.5   0.6   29   76-104     4-36  (51)
258 PF01428 zf-AN1:  AN1-like Zinc  28.9      31 0.00068   19.1   0.9   19   75-93     12-30  (43)
259 PRK00415 rps27e 30S ribosomal   28.3      42 0.00091   20.3   1.5   28   77-104    12-42  (59)
260 TIGR00143 hypF [NiFe] hydrogen  28.3      17 0.00038   33.4  -0.3   68   76-157    68-150 (711)
261 PF08790 zf-LYAR:  LYAR-type C2  28.2      14  0.0003   18.7  -0.5    9  113-121     2-10  (28)
262 PF13451 zf-trcl:  Probable zin  27.7      22 0.00048   20.6   0.2   14  174-187     3-16  (49)
263 PRK07591 threonine synthase; V  27.7      29 0.00063   29.7   1.0   27   76-103    18-44  (421)
264 PF10276 zf-CHCC:  Zinc-finger   27.5      19 0.00042   19.9  -0.1   11  111-121    29-39  (40)
265 PRK04351 hypothetical protein;  27.4      27 0.00058   25.4   0.6   33  110-158   111-143 (149)
266 PF14206 Cys_rich_CPCC:  Cystei  27.4      35 0.00075   21.9   1.0   26   77-102     2-30  (78)
267 COG1998 RPS31 Ribosomal protei  27.3      31 0.00067   20.0   0.7    9  111-119    37-45  (51)
268 PF01927 Mut7-C:  Mut7-C RNAse   27.3      28  0.0006   25.1   0.7   12  112-123   125-136 (147)
269 PF14803 Nudix_N_2:  Nudix N-te  26.4      21 0.00046   18.9  -0.1    7  148-154    23-29  (34)
270 KOG3002|consensus               26.3      36 0.00078   27.8   1.2   61  109-181    78-142 (299)
271 TIGR00627 tfb4 transcription f  26.3      37 0.00081   27.5   1.3   24   93-121   256-279 (279)
272 COG1656 Uncharacterized conser  26.2      42 0.00091   24.8   1.4   12  112-123   131-142 (165)
273 PF04780 DUF629:  Protein of un  26.0      32 0.00069   29.9   0.9   28  111-145    57-84  (466)
274 PF04606 Ogr_Delta:  Ogr/Delta-  25.8      16 0.00034   20.8  -0.7    6  117-122    33-38  (47)
275 PF04780 DUF629:  Protein of un  25.7      57  0.0012   28.5   2.3   27  147-173    57-84  (466)
276 COG5152 Uncharacterized conser  25.5      17 0.00037   27.7  -0.7   16   75-90    195-210 (259)
277 KOG2636|consensus               25.5      50  0.0011   28.5   1.9   29  168-196   394-423 (497)
278 COG1379 PHP family phosphoeste  25.4      21 0.00045   29.5  -0.3   29   94-122   248-276 (403)
279 PF11789 zf-Nse:  Zinc-finger o  25.0      48   0.001   19.7   1.3   13  110-122    23-35  (57)
280 PF11781 RRN7:  RNA polymerase   24.9      42 0.00091   18.0   0.9   24   77-100     9-33  (36)
281 KOG2071|consensus               24.5      41  0.0009   30.0   1.3   28  145-172   416-443 (579)
282 PF03811 Zn_Tnp_IS1:  InsA N-te  23.7      11 0.00024   20.3  -1.5   30  148-181     6-35  (36)
283 PF05129 Elf1:  Transcription e  23.7      25 0.00054   22.7  -0.1   10   74-83     20-29  (81)
284 PRK03976 rpl37ae 50S ribosomal  23.6      40 0.00087   22.3   0.8   28   76-103    36-65  (90)
285 PF06397 Desulfoferrod_N:  Desu  23.3      18 0.00039   19.5  -0.7   10   93-102     7-16  (36)
286 KOG2906|consensus               23.1      31 0.00068   23.1   0.3   29   95-123     4-33  (105)
287 KOG1842|consensus               23.0      46 0.00099   28.7   1.3   29  110-145    14-42  (505)
288 COG4896 Uncharacterized protei  23.0      44 0.00096   20.3   0.9   10  147-156    31-40  (68)
289 PTZ00448 hypothetical protein;  23.0      59  0.0013   27.4   1.9   23  175-197   314-336 (373)
290 KOG1842|consensus               22.5      49  0.0011   28.5   1.4   28  146-173    14-42  (505)
291 PF07227 DUF1423:  Protein of u  22.3      75  0.0016   27.5   2.4   74   78-162   115-198 (446)
292 PF06220 zf-U1:  U1 zinc finger  22.3      60  0.0013   17.6   1.3   11  111-121     3-13  (38)
293 KOG2636|consensus               22.1      62  0.0013   28.0   1.8   27  142-168   396-423 (497)
294 KOG2907|consensus               22.0      32  0.0007   23.7   0.2   12  176-187   103-114 (116)
295 PRK12722 transcriptional activ  21.9      65  0.0014   24.4   1.8   26   94-119   136-162 (187)
296 PRK14892 putative transcriptio  21.8      58  0.0013   21.9   1.4    7  149-155    44-50  (99)
297 KOG0717|consensus               21.8      51  0.0011   28.6   1.3   20  178-197   295-314 (508)
298 TIGR03844 cysteate_syn cysteat  21.7      45 0.00097   28.4   1.0   22   77-99      3-24  (398)
299 COG0675 Transposase and inacti  21.5      46 0.00099   26.9   1.0   25  148-187   310-334 (364)
300 COG1645 Uncharacterized Zn-fin  21.3      43 0.00093   23.8   0.7   28   77-104    29-56  (131)
301 PF11672 DUF3268:  Protein of u  21.2      32  0.0007   23.3   0.0   13  110-122     1-13  (102)
302 KOG0957|consensus               20.9      42 0.00091   29.4   0.7   48   75-123   543-601 (707)
303 PF13901 DUF4206:  Domain of un  20.7      80  0.0017   24.1   2.1   30   75-104   151-184 (202)
304 KOG3183|consensus               20.6      46   0.001   26.2   0.8   28   74-101    21-48  (250)

No 1  
>KOG2462|consensus
Probab=99.95  E-value=2e-28  Score=188.46  Aligned_cols=116  Identities=24%  Similarity=0.362  Sum_probs=107.2

Q ss_pred             CCCCccccccccccccccccc---------------ccccccCcccCCCC-------CCCCcccccChhhhccCHHHHHh
Q psy7453          73 TQNHSLCKHCHSQLSHLDLLD---------------HCKTCSYMIRPNAN-------NTFSPFCIYCKAVLSTNLNELIE  130 (200)
Q Consensus        73 ~~~~~~C~~C~~~f~~~~~l~---------------~C~~C~~~f~~~~~-------~~~~~~C~~C~~~f~~~~~~l~~  130 (200)
                      ....|.|+.||+.+.+.++|.               .|++||+.|.....       ..-+++|.+|||.|+. .|-|+.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSR-PWLLQG  205 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSR-PWLLQG  205 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccc-hHHhhc
Confidence            344699999999999998873               79999999987654       5568999999999999 999999


Q ss_pred             chhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccCHHHHHHHHh
Q psy7453         131 HCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLK  196 (200)
Q Consensus       131 H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~  196 (200)
                      |      + |+|+|||||.|+.|+++|.+.++|+.|+++|.+.|+|+|+.|+|+|+.++-|.+|.-
T Consensus       206 H------i-RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  206 H------I-RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             c------c-ccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            9      9 999999999999999999999999999999999999999999999999999999974


No 2  
>KOG2462|consensus
Probab=99.90  E-value=3.1e-24  Score=165.43  Aligned_cols=100  Identities=28%  Similarity=0.475  Sum_probs=93.0

Q ss_pred             cccccccccCcccCCCC------------CCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccC
Q psy7453          91 LLDHCKTCSYMIRPNAN------------NTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSY  158 (200)
Q Consensus        91 ~l~~C~~C~~~f~~~~~------------~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~  158 (200)
                      ..++|++||+.+.+.++            ..+-+.|++|||.|.+ ...|+.|      + ++|+  -+++|.+|||.|.
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvS-mpALkMH------i-rTH~--l~c~C~iCGKaFS  198 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVS-MPALKMH------I-RTHT--LPCECGICGKAFS  198 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeee-hHHHhhH------h-hccC--CCccccccccccc
Confidence            44689999999988774            4678999999999999 9999999      9 9998  4799999999999


Q ss_pred             ChHHHHHHHHHcCCCCCcccccCcccccCHHHHHHHHhhhcC
Q psy7453         159 NIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKTYH  200 (200)
Q Consensus       159 ~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~h~g  200 (200)
                      +...|+-|+|+|+|||||.|+.|+|+|+.+++|+.||++|.+
T Consensus       199 RPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  199 RPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             chHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcC
Confidence            999999999999999999999999999999999999999975


No 3  
>KOG3608|consensus
Probab=99.71  E-value=2.3e-18  Score=136.71  Aligned_cols=133  Identities=17%  Similarity=0.344  Sum_probs=99.7

Q ss_pred             cccchhhhhhhhhhhcCCCCCCCccccccccccccccccc--------------ccccccCcccCCCC-------CCCCc
Q psy7453          54 SLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLLD--------------HCKTCSYMIRPNAN-------NTFSP  112 (200)
Q Consensus        54 ~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~--------------~C~~C~~~f~~~~~-------~~~~~  112 (200)
                      -++.++.|+.|.+.   |+++|...|+.||..|.++..|+              .|..|.+.|.+...       ....|
T Consensus       188 ~~~~k~~LreH~r~---Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~y  264 (467)
T KOG3608|consen  188 HMGNKYRLREHIRT---HSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCY  264 (467)
T ss_pred             hhccHHHHHHHHHh---cCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcc
Confidence            45677888888888   99999999999999999988773              68888888876543       34568


Q ss_pred             ccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCccccc--CcccccCHHH
Q psy7453         113 FCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQ--CAFRSASVAG  190 (200)
Q Consensus       113 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~--C~k~f~~~~~  190 (200)
                      +|+.|+.+.+. .++|..|      ++-.|...|||+|+.|++.|.+.+.|++|..+|+ +-.|+|+.  |...|.+..+
T Consensus       265 kCplCdmtc~~-~ssL~~H------~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q  336 (467)
T KOG3608|consen  265 KCPLCDMTCSS-ASSLTTH------IRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQ  336 (467)
T ss_pred             cccccccCCCC-hHHHHHH------HHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHH
Confidence            88888888888 8888888      8667888888888888888888888888887776 33344444  4444444444


Q ss_pred             HHHHHhh
Q psy7453         191 LHYHLKK  197 (200)
Q Consensus       191 L~~H~~~  197 (200)
                      +++|++.
T Consensus       337 ~~~H~~e  343 (467)
T KOG3608|consen  337 MRRHFLE  343 (467)
T ss_pred             HHHHHHH
Confidence            4444443


No 4  
>KOG3576|consensus
Probab=99.69  E-value=5.6e-18  Score=125.35  Aligned_cols=85  Identities=26%  Similarity=0.391  Sum_probs=76.4

Q ss_pred             CCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccC
Q psy7453         108 NTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSAS  187 (200)
Q Consensus       108 ~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~  187 (200)
                      +...|.|.+|+|.|.. ...|.+|      + +-|...+.+.|..||+.|...-+|++|+|+|+|.+||+|..|+|+|.+
T Consensus       114 d~d~ftCrvCgK~F~l-QRmlnrh------~-kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftq  185 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGL-QRMLNRH------L-KCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQ  185 (267)
T ss_pred             CCCeeeeehhhhhhhH-HHHHHHH------h-hhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHh
Confidence            5567899999999999 9999999      8 999988999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhhcC
Q psy7453         188 VAGLHYHLKKTYH  200 (200)
Q Consensus       188 ~~~L~~H~~~h~g  200 (200)
                      +.+|..|++..+|
T Consensus       186 rcsleshl~kvhg  198 (267)
T KOG3576|consen  186 RCSLESHLKKVHG  198 (267)
T ss_pred             hccHHHHHHHHcC
Confidence            9999999886554


No 5  
>KOG3623|consensus
Probab=99.68  E-value=8e-18  Score=144.02  Aligned_cols=81  Identities=21%  Similarity=0.406  Sum_probs=78.1

Q ss_pred             CCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccC
Q psy7453         108 NTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSAS  187 (200)
Q Consensus       108 ~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~  187 (200)
                      .+..|.|+.|+|.|.- .+.|.+|      . -.|+|.+||+|.+|.|+|+.+..|..|+|.|.|||||+|+.|+|+|+.
T Consensus       891 e~gmyaCDqCDK~FqK-qSSLaRH------K-YEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSH  962 (1007)
T KOG3623|consen  891 EDGMYACDQCDKAFQK-QSSLARH------K-YEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSH  962 (1007)
T ss_pred             ccccchHHHHHHHHHh-hHHHHHh------h-hhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhccc
Confidence            5578999999999999 9999999      8 999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHh
Q psy7453         188 VAGLHYHLK  196 (200)
Q Consensus       188 ~~~L~~H~~  196 (200)
                      ..+...||.
T Consensus       963 SGSYSQHMN  971 (1007)
T KOG3623|consen  963 SGSYSQHMN  971 (1007)
T ss_pred             ccchHhhhc
Confidence            999999984


No 6  
>KOG1074|consensus
Probab=99.67  E-value=1.3e-17  Score=144.60  Aligned_cols=83  Identities=24%  Similarity=0.422  Sum_probs=75.9

Q ss_pred             CCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCC----CCcccc---cCc
Q psy7453         110 FSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGE----KPYACG---QCA  182 (200)
Q Consensus       110 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~----k~~~C~---~C~  182 (200)
                      .|-+|.+|-++.+- ++.|+-|      . |+|+||+||+|.+||++|.++++|+.|+-+|...    -++.|+   +|.
T Consensus       604 dPNqCiiC~rVlSC-~saLqmH------y-rtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~  675 (958)
T KOG1074|consen  604 DPNQCIICLRVLSC-PSALQMH------Y-RTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQ  675 (958)
T ss_pred             Cccceeeeeecccc-hhhhhhh------h-hcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhc
Confidence            36789999999999 9999999      8 9999999999999999999999999999999654    348899   999


Q ss_pred             ccccCHHHHHHHHhhhcC
Q psy7453         183 FRSASVAGLHYHLKKTYH  200 (200)
Q Consensus       183 k~f~~~~~L~~H~~~h~g  200 (200)
                      +.|...-.|..|+++|.|
T Consensus       676 ~kftn~V~lpQhIriH~~  693 (958)
T KOG1074|consen  676 KKFTNAVTLPQHIRIHLG  693 (958)
T ss_pred             ccccccccccceEEeecC
Confidence            999999999999999974


No 7  
>KOG1074|consensus
Probab=99.64  E-value=9.9e-17  Score=139.22  Aligned_cols=53  Identities=28%  Similarity=0.528  Sum_probs=50.9

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccCHHHHHHHHhhhcC
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKTYH  200 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~h~g  200 (200)
                      ..|.+||+.|...++|+.|+|+|+|+|||.|..|++.|..+.+|++||.+|.+
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w  932 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMW  932 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccc
Confidence            58999999999999999999999999999999999999999999999999863


No 8  
>KOG3623|consensus
Probab=99.59  E-value=1.2e-16  Score=136.91  Aligned_cols=114  Identities=23%  Similarity=0.394  Sum_probs=85.7

Q ss_pred             cccccccccccccccccccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhh---hcCC---CCCceec
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMI---RTDP---FRHKFVC  150 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~---~~h~---~~k~~~C  150 (200)
                      ..|+.|++.+.....|.++    ..+. ....+..|.|..|..+|.. +..|.+|..+|+...   ..++   +-+.|+|
T Consensus       211 ltcpycdrgykrltslkeH----ikyr-hekne~nfsC~lCsytFAy-RtQLErhm~~hkpg~dqa~sltqsa~lRKFKC  284 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEH----IKYR-HEKNEPNFSCMLCSYTFAY-RTQLERHMQLHKPGGDQAISLTQSALLRKFKC  284 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHH----HHHH-HhhCCCCCcchhhhhhhhh-HHHHHHHHHhhcCCCcccccccchhhhccccc
Confidence            4566666666655555432    0111 1126678999999999999 999999944332220   0011   2357999


Q ss_pred             CccCcccCChHHHHHHHHHcCCCCCcccccCcccccCHHHHHHHHh
Q psy7453         151 YACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLK  196 (200)
Q Consensus       151 ~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~  196 (200)
                      ..|||+|+.+..|+.|+|+|.|||||.|+.|+|+|+...+...||-
T Consensus       285 tECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  285 TECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             cccchhhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            9999999999999999999999999999999999999999999974


No 9  
>KOG3576|consensus
Probab=99.58  E-value=3.3e-16  Score=115.99  Aligned_cols=113  Identities=21%  Similarity=0.439  Sum_probs=97.3

Q ss_pred             CCCCCcccccccccccccccccccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecC
Q psy7453          72 PTQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCY  151 (200)
Q Consensus        72 ~~~~~~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~  151 (200)
                      .+...|.|.+|++.|.....|.++-.|.       ...+.+-|..||+.|.. .-.|++|      + ++|+|.+||+|.
T Consensus       113 sd~d~ftCrvCgK~F~lQRmlnrh~kch-------~~vkr~lct~cgkgfnd-tfdlkrh------~-rthtgvrpykc~  177 (267)
T KOG3576|consen  113 SDQDSFTCRVCGKKFGLQRMLNRHLKCH-------SDVKRHLCTFCGKGFND-TFDLKRH------T-RTHTGVRPYKCS  177 (267)
T ss_pred             CCCCeeeeehhhhhhhHHHHHHHHhhhc-------cHHHHHHHhhccCcccc-hhhhhhh------h-ccccCccccchh
Confidence            3456799999999999888886654443       34567899999999999 9999999      9 999999999999


Q ss_pred             ccCcccCChHHHHHHHH-HcC----------CCCCcccccCcccccCHHHHHHHHhhhc
Q psy7453         152 ACDYFSYNIGCMRSHIR-THT----------GEKPYACGQCAFRSASVAGLHYHLKKTY  199 (200)
Q Consensus       152 ~C~~~f~~~~~l~~H~~-~H~----------~~k~~~C~~C~k~f~~~~~L~~H~~~h~  199 (200)
                      .|+++|...-+|..|.+ +|-          .+|.|.|+.||.+-.....+..|++.|+
T Consensus       178 ~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  178 LCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHH  236 (267)
T ss_pred             hhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcC
Confidence            99999999999999976 452          2567999999999999999999998875


No 10 
>KOG3608|consensus
Probab=99.55  E-value=3e-15  Score=119.21  Aligned_cols=137  Identities=22%  Similarity=0.331  Sum_probs=112.6

Q ss_pred             ccccchhhhhhhhhhhcCCCCCCCcccccccccccccccc----------cccccccCcccCCC----------CCCCCc
Q psy7453          53 MSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLL----------DHCKTCSYMIRPNA----------NNTFSP  112 (200)
Q Consensus        53 ~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l----------~~C~~C~~~f~~~~----------~~~~~~  112 (200)
                      .-|.++..|..|.+..+ .-...+|.|..|.|.|.+...|          |+|+.|+-.-...+          ...|||
T Consensus       215 ~~F~~~tkl~DH~rRqt-~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpf  293 (467)
T KOG3608|consen  215 ELFRTKTKLFDHLRRQT-ELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPF  293 (467)
T ss_pred             HHhccccHHHHHHHhhh-hhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChHHHHHHHHhhhccCCCc
Confidence            34555666666766544 3456699999999999999888          58999986544332          268999


Q ss_pred             ccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCc--cCcccCChHHHHHHHHH-cCCCC--CcccccCcccccC
Q psy7453         113 FCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYA--CDYFSYNIGCMRSHIRT-HTGEK--PYACGQCAFRSAS  187 (200)
Q Consensus       113 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~--C~~~f~~~~~l~~H~~~-H~~~k--~~~C~~C~k~f~~  187 (200)
                      +|+.|++.|.+ .+.|.+|      . .+|+ +--|.|+.  |...|.....+++|++- |.|..  +|.|-.|++.|.+
T Consensus       294 KCd~Cd~~c~~-esdL~kH------~-~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~  364 (467)
T KOG3608|consen  294 KCDECDTRCVR-ESDLAKH------V-QVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTS  364 (467)
T ss_pred             cccchhhhhcc-HHHHHHH------H-Hhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhcc
Confidence            99999999999 9999999      8 8998 66799988  99999999999999885 55654  5999999999999


Q ss_pred             HHHHHHHHhhhc
Q psy7453         188 VAGLHYHLKKTY  199 (200)
Q Consensus       188 ~~~L~~H~~~h~  199 (200)
                      ..+|.+|+..-+
T Consensus       365 G~~L~~HL~kkH  376 (467)
T KOG3608|consen  365 GKSLSAHLMKKH  376 (467)
T ss_pred             chhHHHHHHHhh
Confidence            999999987644


No 11 
>PHA00733 hypothetical protein
Probab=99.41  E-value=2.8e-13  Score=96.08  Aligned_cols=88  Identities=17%  Similarity=0.164  Sum_probs=67.1

Q ss_pred             CCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccC
Q psy7453         108 NTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSAS  187 (200)
Q Consensus       108 ~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~  187 (200)
                      .++++.|.+|++.|.. ...|..|......+ ..+ +++||.|+.||+.|.....|..|++.|  +.+|.|++|++.|..
T Consensus        37 ~~~~~~~~~~~~~~~~-~~~l~~~~~l~~~~-~~~-~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~  111 (128)
T PHA00733         37 EQKRLIRAVVKTLIYN-PQLLDESSYLYKLL-TSK-AVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRN  111 (128)
T ss_pred             hhhhHHHHHHhhhccC-hhhhcchHHHHhhc-ccC-CCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCC
Confidence            4566777777766666 55554442211114 444 478999999999999999999999987  467999999999999


Q ss_pred             HHHHHHHHhhhcC
Q psy7453         188 VAGLHYHLKKTYH  200 (200)
Q Consensus       188 ~~~L~~H~~~h~g  200 (200)
                      ...|..|+...+|
T Consensus       112 ~~sL~~H~~~~h~  124 (128)
T PHA00733        112 TDSTLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHHHHhcC
Confidence            9999999987664


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.16  E-value=1.4e-11  Score=73.12  Aligned_cols=42  Identities=19%  Similarity=0.346  Sum_probs=34.1

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccCHHHH
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGL  191 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L  191 (200)
                      |+|+.||+.|...++|..|+++|+  ++|+|..|++.|.+.+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            678888888888888888888887  688888888888876655


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.11  E-value=1.2e-10  Score=100.24  Aligned_cols=74  Identities=18%  Similarity=0.332  Sum_probs=32.3

Q ss_pred             ccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcc
Q psy7453          98 CSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYA  177 (200)
Q Consensus        98 C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~  177 (200)
                      ||..|... ..+..+.|+.|++.|.  ...|..|      + .+|+  +|+.|+ ||+.+ ....|..|+++|.+++++.
T Consensus       441 Cg~v~~r~-el~~H~~C~~Cgk~f~--~s~LekH------~-~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~  506 (567)
T PLN03086        441 CGIVLRVE-EAKNHVHCEKCGQAFQ--QGEMEKH------M-KVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLIT  506 (567)
T ss_pred             ccceeecc-ccccCccCCCCCCccc--hHHHHHH------H-HhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCcee
Confidence            44444222 2334444555554442  2334444      4 3332  344444 44322 3344444444444444444


Q ss_pred             cccCcccc
Q psy7453         178 CGQCAFRS  185 (200)
Q Consensus       178 C~~C~k~f  185 (200)
                      |+.|++.|
T Consensus       507 C~fC~~~v  514 (567)
T PLN03086        507 CRFCGDMV  514 (567)
T ss_pred             CCCCCCcc
Confidence            44444444


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.08  E-value=1.9e-10  Score=98.95  Aligned_cols=111  Identities=18%  Similarity=0.349  Sum_probs=87.8

Q ss_pred             CCccccc--ccccccccc--cccccccccCcccCCCC------CCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCC
Q psy7453          75 NHSLCKH--CHSQLSHLD--LLDHCKTCSYMIRPNAN------NTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPF  144 (200)
Q Consensus        75 ~~~~C~~--C~~~f~~~~--~l~~C~~C~~~f~~~~~------~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~  144 (200)
                      ..-.|+.  |+..|....  ....|+.|++.|.....      -.+++.|+ ||+.+ . +..|..|      + .+|.+
T Consensus       432 ~~V~Cp~~~Cg~v~~r~el~~H~~C~~Cgk~f~~s~LekH~~~~Hkpv~Cp-Cg~~~-~-R~~L~~H------~-~thCp  501 (567)
T PLN03086        432 HNVVCPHDGCGIVLRVEEAKNHVHCEKCGQAFQQGEMEKHMKVFHEPLQCP-CGVVL-E-KEQMVQH------Q-ASTCP  501 (567)
T ss_pred             cceeCCcccccceeeccccccCccCCCCCCccchHHHHHHHHhcCCCccCC-CCCCc-c-hhHHHhh------h-hccCC
Confidence            4456874  999886543  22479999998863211      23789999 99755 6 7899999      8 99999


Q ss_pred             CCceecCccCcccC----------ChHHHHHHHHHcCCCCCcccccCcccccCHHHHHHHHhh
Q psy7453         145 RHKFVCYACDYFSY----------NIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       145 ~k~~~C~~C~~~f~----------~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      ++++.|+.|++.|.          ..+.|..|..++ |.+++.|..||+.+..+ .|..|+..
T Consensus       502 ~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlr-dm~~H~~~  562 (567)
T PLN03086        502 LRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLK-EMDIHQIA  562 (567)
T ss_pred             CCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeeeh-hHHHHHHH
Confidence            99999999999995          245899999986 99999999999999887 56678754


No 15 
>PHA00733 hypothetical protein
Probab=99.03  E-value=1.9e-10  Score=81.56  Aligned_cols=90  Identities=19%  Similarity=0.237  Sum_probs=70.0

Q ss_pred             CCCCCCcccccccccccccccccccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceec
Q psy7453          71 IPTQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVC  150 (200)
Q Consensus        71 ~~~~~~~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C  150 (200)
                      ..+++++.|.+|++.|.....|..-..=-+  .....+++||.|+.|++.|.+ ...|..|      + +.|  +.+|.|
T Consensus        35 ~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~--~~~~~~~kPy~C~~Cgk~Fss-~s~L~~H------~-r~h--~~~~~C  102 (128)
T PHA00733         35 TPEQKRLIRAVVKTLIYNPQLLDESSYLYK--LLTSKAVSPYVCPLCLMPFSS-SVSLKQH------I-RYT--EHSKVC  102 (128)
T ss_pred             ChhhhhHHHHHHhhhccChhhhcchHHHHh--hcccCCCCCccCCCCCCcCCC-HHHHHHH------H-hcC--CcCccC
Confidence            345788999999999998877743100000  012235789999999999999 9999999      8 766  457999


Q ss_pred             CccCcccCChHHHHHHHHHcCC
Q psy7453         151 YACDYFSYNIGCMRSHIRTHTG  172 (200)
Q Consensus       151 ~~C~~~f~~~~~l~~H~~~H~~  172 (200)
                      +.|++.|.....|..|++...+
T Consensus       103 ~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        103 PVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCHHHHHHHHHHhcC
Confidence            9999999999999999886543


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.00  E-value=2.4e-10  Score=58.15  Aligned_cols=26  Identities=50%  Similarity=0.948  Sum_probs=20.9

Q ss_pred             HHHHHHHHcCCCCCcccccCcccccC
Q psy7453         162 CMRSHIRTHTGEKPYACGQCAFRSAS  187 (200)
Q Consensus       162 ~l~~H~~~H~~~k~~~C~~C~k~f~~  187 (200)
                      +|.+|+++|+|++||+|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47788888888888888888888863


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.91  E-value=3.4e-10  Score=67.20  Aligned_cols=43  Identities=19%  Similarity=0.355  Sum_probs=39.4

Q ss_pred             CcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHH
Q psy7453         111 SPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCM  163 (200)
Q Consensus       111 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l  163 (200)
                      -|+|+.||+.|+. .++|..|      + ++|+  ++++|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~-~~~L~~H------~-r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIK-RKSMITH------L-RKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeecc-HHHHHHH------H-HhcC--CcccCCcccceeccccee
Confidence            4899999999999 9999999      9 9998  799999999999987765


No 18 
>KOG3993|consensus
Probab=98.66  E-value=7.8e-09  Score=84.66  Aligned_cols=82  Identities=21%  Similarity=0.267  Sum_probs=66.2

Q ss_pred             CCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCC--------C--------
Q psy7453         110 FSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTG--------E--------  173 (200)
Q Consensus       110 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~--------~--------  173 (200)
                      ..|.|..|...|.+ .-.|.+|      . =.-.-.--|+|+.|+|.|+...+|..|.|.|..        .        
T Consensus       266 GdyiCqLCK~kYeD-~F~LAQH------r-C~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~  337 (500)
T KOG3993|consen  266 GDYICQLCKEKYED-AFALAQH------R-CPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVE  337 (500)
T ss_pred             HHHHHHHHHHhhhh-HHHHhhc------c-CCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhh
Confidence            35899999999999 9999999      3 111112248999999999999999999998842        1        


Q ss_pred             -----------------CCcccccCcccccCHHHHHHHHhhhc
Q psy7453         174 -----------------KPYACGQCAFRSASVAGLHYHLKKTY  199 (200)
Q Consensus       174 -----------------k~~~C~~C~k~f~~~~~L~~H~~~h~  199 (200)
                                       --|.|..|+|.|.+...|+.|+-+|+
T Consensus       338 ~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  338 TRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             hhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                             13899999999999999999988774


No 19 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.65  E-value=1.2e-08  Score=51.83  Aligned_cols=26  Identities=31%  Similarity=0.405  Sum_probs=23.7

Q ss_pred             HHHhchhhhhhhhhcCCCCCceecCccCcccCC
Q psy7453         127 ELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYN  159 (200)
Q Consensus       127 ~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~  159 (200)
                      +|.+|      + ++|++++||.|+.|++.|.+
T Consensus         1 ~l~~H------~-~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRH------M-RTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHH------H-HHHSSSSSEEESSSSEEESS
T ss_pred             CHHHH------h-hhcCCCCCCCCCCCcCeeCc
Confidence            58899      9 99999999999999999974


No 20 
>KOG3993|consensus
Probab=98.62  E-value=8.1e-09  Score=84.57  Aligned_cols=88  Identities=23%  Similarity=0.338  Sum_probs=62.6

Q ss_pred             CcccccccccccccccccccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhh------------h---
Q psy7453          76 HSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMI------------R---  140 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~------------~---  140 (200)
                      -|.|..|...|.+.-.|.++ .|...      --..|+|++|+|.|+- ..+|..|||-|+-..            +   
T Consensus       267 dyiCqLCK~kYeD~F~LAQH-rC~RI------V~vEYrCPEC~KVFsC-PANLASHRRWHKPR~eaa~a~~~P~k~~~~~  338 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQH-RCPRI------VHVEYRCPECDKVFSC-PANLASHRRWHKPRPEAAKAGSPPPKQAVET  338 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhc-cCCee------EEeeecCCcccccccC-chhhhhhhcccCCchhhhhcCCCChhhhhhh
Confidence            38899999988888777542 12211      2246899999999999 999999988882110            0   


Q ss_pred             -----------cCCCCCceecCccCcccCChHHHHHHHHHcC
Q psy7453         141 -----------TDPFRHKFVCYACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       141 -----------~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~  171 (200)
                                 ....+.-|.|..|++.|.+...|+.|+.+|.
T Consensus       339 rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq  380 (500)
T KOG3993|consen  339 RAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQ  380 (500)
T ss_pred             hhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHhHHhhh
Confidence                       0012235899999999999999999987763


No 21 
>PHA00616 hypothetical protein
Probab=98.57  E-value=3e-08  Score=56.13  Aligned_cols=33  Identities=9%  Similarity=0.163  Sum_probs=19.4

Q ss_pred             ceecCccCcccCChHHHHHHHHHcCCCCCcccc
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYACG  179 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~  179 (200)
                      ||+|+.||+.|...+.|.+|++.|+|++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            455666666666666666666666666555554


No 22 
>PHA00732 hypothetical protein
Probab=98.50  E-value=8.3e-08  Score=62.12  Aligned_cols=48  Identities=21%  Similarity=0.296  Sum_probs=33.9

Q ss_pred             CcccccChhhhccCHHHHHhchhhhhhhhh-cCCCCCceecCccCcccCChHHHHHHHHHcCC
Q psy7453         111 SPFCIYCKAVLSTNLNELIEHCRTCKSMIR-TDPFRHKFVCYACDYFSYNIGCMRSHIRTHTG  172 (200)
Q Consensus       111 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~-~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~  172 (200)
                      ||.|+.|++.|.+ ...|..|      + + .|.+   +.|+.||+.|.   .+..|++++.+
T Consensus         1 py~C~~Cgk~F~s-~s~Lk~H------~-r~~H~~---~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVT-LFALKQH------A-RRNHTL---TKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCC-HHHHHHH------h-hcccCC---CccCCCCCEeC---ChhhhhcccCC
Confidence            5778888888888 8888888      7 5 3543   46888888887   46677765543


No 23 
>PHA00616 hypothetical protein
Probab=98.36  E-value=1.6e-07  Score=53.13  Aligned_cols=39  Identities=18%  Similarity=0.286  Sum_probs=34.2

Q ss_pred             CcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCccc
Q psy7453         111 SPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFS  157 (200)
Q Consensus       111 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f  157 (200)
                      ||+|+.||+.|.. ++.|..|      + +.|++++++.|+.--..|
T Consensus         1 pYqC~~CG~~F~~-~s~l~~H------~-r~~hg~~~~~~~~~y~~f   39 (44)
T PHA00616          1 MYQCLRCGGIFRK-KKEVIEH------L-LSVHKQNKLTLEYFYIYF   39 (44)
T ss_pred             CCccchhhHHHhh-HHHHHHH------H-HHhcCCCccceeEEEEEE
Confidence            6899999999999 9999999      9 999999999998643333


No 24 
>PHA00732 hypothetical protein
Probab=98.31  E-value=4.1e-07  Score=58.89  Aligned_cols=46  Identities=24%  Similarity=0.488  Sum_probs=39.0

Q ss_pred             ceecCccCcccCChHHHHHHHHH-cCCCCCcccccCcccccCHHHHHHHHhhh
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRT-HTGEKPYACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~-H~~~k~~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      ||.|+.||+.|...+.|+.|++. |.   ++.|+.||+.|.+   |..|.+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~~---l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYRR---LNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeCC---hhhhhccc
Confidence            68899999999999999999984 65   3689999999984   77787653


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.30  E-value=1.3e-06  Score=52.47  Aligned_cols=51  Identities=25%  Similarity=0.497  Sum_probs=33.5

Q ss_pred             ceecCccCcccCChHHHHHHHHH-cCCC-CCcccccCcccccCHHHHHHHHhhhcC
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRT-HTGE-KPYACGQCAFRSASVAGLHYHLKKTYH  200 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~-H~~~-k~~~C~~C~k~f~~~~~L~~H~~~h~g  200 (200)
                      .|.|+.|++ -.+...|..|... |.++ +.+.|++|...+.  .+|..|+..++|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            367777777 4455677777654 5544 4577888877544  377778777654


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.20  E-value=1e-06  Score=43.26  Aligned_cols=23  Identities=26%  Similarity=0.593  Sum_probs=14.7

Q ss_pred             cccccCcccccCHHHHHHHHhhh
Q psy7453         176 YACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      |+|+.|++.|.++..|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            45666666666666666666653


No 27 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.08  E-value=4.5e-06  Score=50.09  Aligned_cols=51  Identities=22%  Similarity=0.340  Sum_probs=40.7

Q ss_pred             CcccccChhhhccCHHHHHhchhhhhhhhhcCCCC-CceecCccCcccCChHHHHHHHHHcC
Q psy7453         111 SPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFR-HKFVCYACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       111 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~-k~~~C~~C~~~f~~~~~l~~H~~~H~  171 (200)
                      .|.|++|++ ..+ ...|..|      ....|..+ +.+.|++|...+.  .+|..|+..+.
T Consensus         2 ~f~CP~C~~-~~~-~~~L~~H------~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFS-ESSLVEH------CEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccC-HHHHHHH------HHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            589999999 455 6889999      86777764 5799999998655  48999988754


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.02  E-value=4.9e-06  Score=40.71  Aligned_cols=23  Identities=22%  Similarity=0.504  Sum_probs=16.3

Q ss_pred             eecCccCcccCChHHHHHHHHHc
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTH  170 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H  170 (200)
                      |+|+.|++.|.+...|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777777654


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.94  E-value=7e-06  Score=40.31  Aligned_cols=24  Identities=21%  Similarity=0.429  Sum_probs=14.3

Q ss_pred             cccccCcccccCHHHHHHHHhhhc
Q psy7453         176 YACGQCAFRSASVAGLHYHLKKTY  199 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~h~  199 (200)
                      |.|++|++.|.+...|..|+++|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            456666666666666666666653


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.92  E-value=6.8e-06  Score=41.90  Aligned_cols=25  Identities=24%  Similarity=0.616  Sum_probs=17.0

Q ss_pred             CcccccCcccccCHHHHHHHHhhhc
Q psy7453         175 PYACGQCAFRSASVAGLHYHLKKTY  199 (200)
Q Consensus       175 ~~~C~~C~k~f~~~~~L~~H~~~h~  199 (200)
                      ||.|+.|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4667777777777777777776654


No 31 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.91  E-value=7.7e-06  Score=55.07  Aligned_cols=73  Identities=18%  Similarity=0.457  Sum_probs=17.5

Q ss_pred             ccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccCHHHHH
Q psy7453         113 FCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLH  192 (200)
Q Consensus       113 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~  192 (200)
                      +|..|+..|.+ ...|..|      +...|.-.-+     ....+.....+..+.+.-. ...+.|..|++.|.+...|.
T Consensus         1 ~C~~C~~~f~~-~~~l~~H------~~~~H~~~~~-----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~   67 (100)
T PF12756_consen    1 QCLFCDESFSS-VDDLLQH------MKKKHGFDIP-----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQ   67 (100)
T ss_dssp             -------------------------------------------------------------SSEEBSSSS-EESSHHHHH
T ss_pred             Ccccccccccc-ccccccc------cccccccccc-----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHH
Confidence            48889999988 8889999      7444432221     1112223333333333211 22577777777777777777


Q ss_pred             HHHhhh
Q psy7453         193 YHLKKT  198 (200)
Q Consensus       193 ~H~~~h  198 (200)
                      .|++.+
T Consensus        68 ~Hm~~~   73 (100)
T PF12756_consen   68 EHMRSK   73 (100)
T ss_dssp             HHHHHT
T ss_pred             HHHcCc
Confidence            777753


No 32 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.84  E-value=2.3e-06  Score=68.08  Aligned_cols=71  Identities=24%  Similarity=0.354  Sum_probs=45.4

Q ss_pred             CCCCccccc--ChhhhccCHHHHHhchhhhhhhhhcCCCCCcee--cCccCcccCChHHHHHHHHHcCCCCCcccccCcc
Q psy7453         108 NTFSPFCIY--CKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFV--CYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAF  183 (200)
Q Consensus       108 ~~~~~~C~~--C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~--C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k  183 (200)
                      ++|||+|++  |.|.+.. ...|+-|      +..-|...+...  -++=-..|            -..+|||.|++|+|
T Consensus       346 d~KpykCpV~gC~K~Ykn-qnGLKYH------~lhGH~~~~~~~~p~p~~~~~F------------~~~~KPYrCevC~K  406 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKN-QNGLKYH------MLHGHQNQKLHENPSPEKMNIF------------SAKDKPYRCEVCDK  406 (423)
T ss_pred             cCceecCCCCCchhhhcc-ccchhhh------hhccccCcccCCCCCccccccc------------cccCCceeccccch
Confidence            458888876  8888888 8888888      422222211111  11111122            23469999999999


Q ss_pred             cccCHHHHHHHHhh
Q psy7453         184 RSASVAGLHYHLKK  197 (200)
Q Consensus       184 ~f~~~~~L~~H~~~  197 (200)
                      .|+...+|+.|+.-
T Consensus       407 RYKNlNGLKYHr~H  420 (423)
T COG5189         407 RYKNLNGLKYHRKH  420 (423)
T ss_pred             hhccCccceecccc
Confidence            99999999999753


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.61  E-value=7.1e-05  Score=36.56  Aligned_cols=23  Identities=35%  Similarity=0.592  Sum_probs=15.8

Q ss_pred             eecCccCcccCChHHHHHHHHHc
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTH  170 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H  170 (200)
                      |.|++|++.|.+...|..|+++|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            56777777777777777777765


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.57  E-value=4.7e-05  Score=38.67  Aligned_cols=25  Identities=28%  Similarity=0.583  Sum_probs=16.3

Q ss_pred             ceecCccCcccCChHHHHHHHHHcC
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~  171 (200)
                      ||.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4666666666766666666666553


No 35 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.46  E-value=0.00011  Score=36.44  Aligned_cols=23  Identities=26%  Similarity=0.546  Sum_probs=15.0

Q ss_pred             cccccCcccccCHHHHHHHHhhh
Q psy7453         176 YACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45666666666666666666654


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.43  E-value=5.5e-05  Score=60.45  Aligned_cols=58  Identities=17%  Similarity=0.222  Sum_probs=40.6

Q ss_pred             CCCCccccc--ccccccccccccccccccC---cccCC---------CCCCCCcccccChhhhccCHHHHHhc
Q psy7453          73 TQNHSLCKH--CHSQLSHLDLLDHCKTCSY---MIRPN---------ANNTFSPFCIYCKAVLSTNLNELIEH  131 (200)
Q Consensus        73 ~~~~~~C~~--C~~~f~~~~~l~~C~~C~~---~f~~~---------~~~~~~~~C~~C~~~f~~~~~~l~~H  131 (200)
                      +++||+|++  |.|.+.+...|.-+..-|.   .....         ....|||+|++|+|++.. ...|+-|
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKN-lNGLKYH  417 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKN-LNGLKYH  417 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhcc-Cccceec
Confidence            469999987  9999999887752222221   11110         115689999999999998 8888888


No 37 
>PRK04860 hypothetical protein; Provisional
Probab=97.34  E-value=0.00014  Score=53.51  Aligned_cols=37  Identities=27%  Similarity=0.524  Sum_probs=25.0

Q ss_pred             ceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccC
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSAS  187 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~  187 (200)
                      +|.|. |+.   ....+++|.++|+|+++|.|..|++.|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            57776 765   55566677777777777777777766654


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.14  E-value=0.00065  Score=39.45  Aligned_cols=33  Identities=18%  Similarity=0.287  Sum_probs=18.8

Q ss_pred             CCCCceecCccCcccCChHHHHHHHHHcCCCCC
Q psy7453         143 PFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKP  175 (200)
Q Consensus       143 ~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~  175 (200)
                      ..+.|-.|++|+..+....+|++|+.++.+.||
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            456677777777777777777777766655554


No 39 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.12  E-value=0.00036  Score=34.33  Aligned_cols=24  Identities=29%  Similarity=0.743  Sum_probs=15.1

Q ss_pred             cccccCcccccCHHHHHHHHhhhcC
Q psy7453         176 YACGQCAFRSASVAGLHYHLKKTYH  200 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~h~g  200 (200)
                      |+|+.|+.... ...|..|++.|+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            56777777766 6677777777654


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.05  E-value=0.00063  Score=33.54  Aligned_cols=24  Identities=25%  Similarity=0.552  Sum_probs=14.7

Q ss_pred             eecCccCcccCChHHHHHHHHHcC
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~  171 (200)
                      |.|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            356666666666666666666553


No 41 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.02  E-value=0.00064  Score=39.49  Aligned_cols=30  Identities=23%  Similarity=0.370  Sum_probs=22.0

Q ss_pred             CCCCCcccccCcccccCHHHHHHHHhhhcC
Q psy7453         171 TGEKPYACGQCAFRSASVAGLHYHLKKTYH  200 (200)
Q Consensus       171 ~~~k~~~C~~C~k~f~~~~~L~~H~~~h~g  200 (200)
                      ..+.|-.|++|+..+.+..+|++|+.+++|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhc
Confidence            456889999999999999999999988764


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.75  E-value=0.001  Score=32.93  Aligned_cols=22  Identities=27%  Similarity=0.526  Sum_probs=14.6

Q ss_pred             cccccCcccccCHHHHHHHHhh
Q psy7453         176 YACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      |.|++|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566677777777777766654


No 43 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.58  E-value=0.0016  Score=32.24  Aligned_cols=23  Identities=26%  Similarity=0.579  Sum_probs=16.8

Q ss_pred             eecCccCcccCChHHHHHHHHHc
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTH  170 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H  170 (200)
                      |.|++|++.|.+...|+.|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56777777777777777777643


No 44 
>PRK04860 hypothetical protein; Provisional
Probab=96.49  E-value=0.0011  Score=48.71  Aligned_cols=39  Identities=18%  Similarity=0.226  Sum_probs=34.1

Q ss_pred             CCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCCh
Q psy7453         110 FSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNI  160 (200)
Q Consensus       110 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~  160 (200)
                      -+|.|. |+.   . ...+.+|      . ++|+++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~-~~~~rrH------~-ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---H-QLTVRRH------N-RVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---e-eCHHHHH------H-HHhcCCccEECCCCCceeEEe
Confidence            579998 998   5 6779999      8 999999999999999988654


No 45 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.26  E-value=0.0043  Score=41.40  Aligned_cols=73  Identities=19%  Similarity=0.292  Sum_probs=21.0

Q ss_pred             ccccccccccccccccccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCccc
Q psy7453          78 LCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFS  157 (200)
Q Consensus        78 ~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f  157 (200)
                      .|..|+..|.+...|..+-.      ..+.    +..+ ....+.. ...+..+      . +... ...+.|..|++.|
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~------~~H~----~~~~-~~~~l~~-~~~~~~~------~-~~~~-~~~~~C~~C~~~f   60 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMK------KKHG----FDIP-DQKYLVD-PNRLLNY------L-RKKV-KESFRCPYCNKTF   60 (100)
T ss_dssp             --------------------------------------------------------------------SSEEBSSSS-EE
T ss_pred             Cccccccccccccccccccc------cccc----cccc-ccccccc-ccccccc------c-cccc-CCCCCCCccCCCC
Confidence            48888888888877765321      1111    1111 1112223 4444444      3 3222 2368999999999


Q ss_pred             CChHHHHHHHHHc
Q psy7453         158 YNIGCMRSHIRTH  170 (200)
Q Consensus       158 ~~~~~l~~H~~~H  170 (200)
                      .+...|..|++.+
T Consensus        61 ~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   61 RSREALQEHMRSK   73 (100)
T ss_dssp             SSHHHHHHHHHHT
T ss_pred             cCHHHHHHHHcCc
Confidence            9999999999874


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.08  E-value=0.0061  Score=29.78  Aligned_cols=23  Identities=22%  Similarity=0.673  Sum_probs=16.8

Q ss_pred             eecCccCcccCChHHHHHHHHHcC
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~  171 (200)
                      |+|+.|+.... ...|.+|++.|.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            67888888887 888888888753


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.03  E-value=0.0028  Score=32.07  Aligned_cols=22  Identities=27%  Similarity=0.496  Sum_probs=15.6

Q ss_pred             cccccCcccccCHHHHHHHHhh
Q psy7453         176 YACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      |-|+.|++.|.+...|..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777654


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.12  E-value=0.015  Score=29.28  Aligned_cols=19  Identities=32%  Similarity=0.620  Sum_probs=14.1

Q ss_pred             cccccChhhhccCHHHHHhc
Q psy7453         112 PFCIYCKAVLSTNLNELIEH  131 (200)
Q Consensus       112 ~~C~~C~~~f~~~~~~l~~H  131 (200)
                      |.|..|++.|.+ ...+..|
T Consensus         2 ~~C~~C~k~f~~-~~~~~~H   20 (27)
T PF12171_consen    2 FYCDACDKYFSS-ENQLKQH   20 (27)
T ss_dssp             CBBTTTTBBBSS-HHHHHCC
T ss_pred             CCcccCCCCcCC-HHHHHHH
Confidence            567777777777 7777777


No 49 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.05  E-value=0.021  Score=28.30  Aligned_cols=19  Identities=26%  Similarity=0.413  Sum_probs=10.4

Q ss_pred             ccccCcccccCHHHHHHHHh
Q psy7453         177 ACGQCAFRSASVAGLHYHLK  196 (200)
Q Consensus       177 ~C~~C~k~f~~~~~L~~H~~  196 (200)
                      +|+.||+.| ....|.+|++
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            456666666 4445555554


No 50 
>KOG2231|consensus
Probab=94.57  E-value=0.032  Score=49.64  Aligned_cols=22  Identities=23%  Similarity=0.597  Sum_probs=13.3

Q ss_pred             cccccccccccccccccccccc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTC   98 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C   98 (200)
                      +.|..|+..|.....-..|..|
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c  121 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHC  121 (669)
T ss_pred             hhcCccccchhhhcccCCCccc
Confidence            5677887777544444445555


No 51 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.24  E-value=0.012  Score=49.43  Aligned_cols=63  Identities=21%  Similarity=0.292  Sum_probs=55.3

Q ss_pred             CCcccccChhhhccCHHHHHhchhhhhhhhh--cCCCC--CceecC--ccCcccCChHHHHHHHHHcCCCCCccccc
Q psy7453         110 FSPFCIYCKAVLSTNLNELIEHCRTCKSMIR--TDPFR--HKFVCY--ACDYFSYNIGCMRSHIRTHTGEKPYACGQ  180 (200)
Q Consensus       110 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~--~h~~~--k~~~C~--~C~~~f~~~~~l~~H~~~H~~~k~~~C~~  180 (200)
                      .++.|..|...|.. ...|..|      . +  .|.++  +++.|+  .|++.|.....+..|..+|.+.+++.+..
T Consensus       288 ~~~~~~~~~~~~s~-~~~l~~~------~-~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  356 (467)
T COG5048         288 LPIKSKQCNISFSR-SSPLTRH------L-RSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKL  356 (467)
T ss_pred             cCCCCccccCCccc-ccccccc------c-cccccccccCCceeeeccCCCccccccccccCCcccccCCCcccccc
Confidence            47889999999999 9999999      8 7  79999  999999  79999999999999999998888777644


No 52 
>KOG1146|consensus
Probab=94.11  E-value=0.029  Score=53.09  Aligned_cols=25  Identities=32%  Similarity=0.820  Sum_probs=22.2

Q ss_pred             CCCcccccCcccccCHHHHHHHHhh
Q psy7453         173 EKPYACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       173 ~k~~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      .++|.|..|..++..+.+|..|++.
T Consensus       516 ~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  516 GKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCcccceeeeeeeecchHHHHHHHH
Confidence            3689999999999999999999874


No 53 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=94.02  E-value=0.056  Score=26.76  Aligned_cols=19  Identities=21%  Similarity=0.315  Sum_probs=10.6

Q ss_pred             ecCccCcccCChHHHHHHHH
Q psy7453         149 VCYACDYFSYNIGCMRSHIR  168 (200)
Q Consensus       149 ~C~~C~~~f~~~~~l~~H~~  168 (200)
                      .|+.||+.| ....|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            466666666 4455555543


No 54 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.76  E-value=0.052  Score=28.89  Aligned_cols=22  Identities=23%  Similarity=0.462  Sum_probs=15.1

Q ss_pred             CcccccCcccccCHHHHHHHHh
Q psy7453         175 PYACGQCAFRSASVAGLHYHLK  196 (200)
Q Consensus       175 ~~~C~~C~k~f~~~~~L~~H~~  196 (200)
                      +|-|++|++.|.....+..|++
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667777777777777777764


No 55 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.67  E-value=0.011  Score=49.50  Aligned_cols=55  Identities=22%  Similarity=0.382  Sum_probs=51.3

Q ss_pred             CceecCccCcccCChHHHHHHHH--HcCCC--CCcccc--cCcccccCHHHHHHHHhhhcC
Q psy7453         146 HKFVCYACDYFSYNIGCMRSHIR--THTGE--KPYACG--QCAFRSASVAGLHYHLKKTYH  200 (200)
Q Consensus       146 k~~~C~~C~~~f~~~~~l~~H~~--~H~~~--k~~~C~--~C~k~f~~~~~L~~H~~~h~g  200 (200)
                      .++.|..|...|.....+..|.+  .|+++  +++.|+  .|++.|.+...+..|..+|++
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~  348 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTS  348 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccC
Confidence            46899999999999999999999  89999  999999  799999999999999988764


No 56 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.52  E-value=0.078  Score=36.46  Aligned_cols=79  Identities=13%  Similarity=0.139  Sum_probs=46.5

Q ss_pred             CCCcccccChhhhccCHHHHHhchhhhhhhhhcCC-CCC------------ceecCccCcccCChHHHHHHHHHcCCCCC
Q psy7453         109 TFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDP-FRH------------KFVCYACDYFSYNIGCMRSHIRTHTGEKP  175 (200)
Q Consensus       109 ~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~-~~k------------~~~C~~C~~~f~~~~~l~~H~~~H~~~k~  175 (200)
                      +-|..|+.||-+... ...|.+-      .  -|. .-+            .-.|-.|+..|........-  .-.....
T Consensus        13 ~LP~~CpiCgLtLVs-s~HLARS------y--HHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~--~~~~~~~   81 (112)
T TIGR00622        13 ELPVECPICGLTLIL-STHLARS------Y--HHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD--ELKDSHR   81 (112)
T ss_pred             CCCCcCCcCCCEEec-cchHHHh------h--hccCCCcccccccccccCCCCcccCcCCCCCCccccccc--ccccccc
Confidence            346778888887777 7777653      1  111 011            12388888888754311100  0122346


Q ss_pred             cccccCcccccCHHHHHHHHhhh
Q psy7453         176 YACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      |+|+.|...|--....-.|...|
T Consensus        82 y~C~~C~~~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        82 YVCAVCKNVFCVDCDVFVHESLH  104 (112)
T ss_pred             eeCCCCCCccccccchhhhhhcc
Confidence            88888888888777777776655


No 57 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.10  E-value=0.08  Score=28.13  Aligned_cols=23  Identities=17%  Similarity=0.397  Sum_probs=17.6

Q ss_pred             ceecCccCcccCChHHHHHHHHH
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRT  169 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~  169 (200)
                      +|.|+.|++.|.+...+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788888888888888887653


No 58 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.60  E-value=0.078  Score=28.11  Aligned_cols=24  Identities=29%  Similarity=0.820  Sum_probs=16.4

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCCCcccccCcc
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAF  183 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k  183 (200)
                      |.|..||..+....            .++.|++||.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            67888887665332            5778888874


No 59 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=90.70  E-value=0.12  Score=30.66  Aligned_cols=29  Identities=10%  Similarity=0.075  Sum_probs=21.0

Q ss_pred             cCCCCCceecCccCcccCChHHHHHHHHH
Q psy7453         141 TDPFRHKFVCYACDYFSYNIGCMRSHIRT  169 (200)
Q Consensus       141 ~h~~~k~~~C~~C~~~f~~~~~l~~H~~~  169 (200)
                      .-.||--+.|+-||..|....++.+|...
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            34566677888888888877777777654


No 60 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=90.11  E-value=0.13  Score=30.48  Aligned_cols=28  Identities=18%  Similarity=0.387  Sum_probs=24.1

Q ss_pred             cccccccccccccccccccccccCcccC
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMIRP  104 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f~~  104 (200)
                      ..|+.|++.|....++..|+.|+..+.+
T Consensus         6 ~~C~~Cg~~~~~~dDiVvCp~CgapyHR   33 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDDIVVCPECGAPYHR   33 (54)
T ss_pred             ccChhhCCcccCCCCEEECCCCCCcccH
Confidence            4699999999988999999999987764


No 61 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.99  E-value=0.18  Score=34.60  Aligned_cols=28  Identities=18%  Similarity=0.377  Sum_probs=16.4

Q ss_pred             ccccccCcccCCCCCCCCcccccChhhhcc
Q psy7453          94 HCKTCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        94 ~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      .|+.||..|...  +..|..|+.||..|.-
T Consensus        11 ~Cp~CG~kFYDL--nk~PivCP~CG~~~~~   38 (108)
T PF09538_consen   11 TCPSCGAKFYDL--NKDPIVCPKCGTEFPP   38 (108)
T ss_pred             cCCCCcchhccC--CCCCccCCCCCCccCc
Confidence            455555555432  2356667777777766


No 62 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=89.30  E-value=0.2  Score=26.73  Aligned_cols=9  Identities=33%  Similarity=0.652  Sum_probs=4.8

Q ss_pred             CcccccChh
Q psy7453         111 SPFCIYCKA  119 (200)
Q Consensus       111 ~~~C~~C~~  119 (200)
                      |..|++|+.
T Consensus        18 p~~CP~Cg~   26 (34)
T cd00729          18 PEKCPICGA   26 (34)
T ss_pred             CCcCcCCCC
Confidence            445555554


No 63 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=89.17  E-value=0.31  Score=26.52  Aligned_cols=32  Identities=16%  Similarity=0.298  Sum_probs=16.9

Q ss_pred             ecCccCcccCChHHHHHHHHHcCCCCCcccccCcccc
Q psy7453         149 VCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRS  185 (200)
Q Consensus       149 ~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f  185 (200)
                      .|+.|+..|.-..+     ++-.+....+|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~-----~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----HcccCCcEEECCCCCcEe
Confidence            46666666654443     122333456666666555


No 64 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=89.00  E-value=0.25  Score=24.67  Aligned_cols=22  Identities=23%  Similarity=0.791  Sum_probs=10.4

Q ss_pred             cccccccccccccccccccccCcc
Q psy7453          79 CKHCHSQLSHLDLLDHCKTCSYMI  102 (200)
Q Consensus        79 C~~C~~~f~~~~~l~~C~~C~~~f  102 (200)
                      |+.|+......  ...|+.||..|
T Consensus         3 CP~C~~~V~~~--~~~Cp~CG~~F   24 (26)
T PF10571_consen    3 CPECGAEVPES--AKFCPHCGYDF   24 (26)
T ss_pred             CCCCcCCchhh--cCcCCCCCCCC
Confidence            55555544222  23455555554


No 65 
>KOG1146|consensus
Probab=88.73  E-value=0.083  Score=50.15  Aligned_cols=73  Identities=15%  Similarity=0.280  Sum_probs=38.5

Q ss_pred             cccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHH-----------------cCCCC
Q psy7453         112 PFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRT-----------------HTGEK  174 (200)
Q Consensus       112 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~-----------------H~~~k  174 (200)
                      +.|..|++.|.. .-.+. |      +    ....+|.|..|...|...+.|..|.+.                 +....
T Consensus      1261 ~~c~~~~~~~~~-~~~~~-~------l----~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~~~~~~~~~~~l~~~d~~ 1328 (1406)
T KOG1146|consen 1261 GECGAVDELLTP-SFGIS-T------L----DVTHRYLCRQCKMAFDGEAPLTAHQRKFCFAGRGSGGSMPPPLRVPDCT 1328 (1406)
T ss_pred             chhhhccccccC-cccee-e------c----ccchhHHHHHHHhhhcchhHHHHHHHHHHhccCccccCCCCcccCcccc
Confidence            445555555555 43333 3      3    123345555555555555555555431                 11123


Q ss_pred             CcccccCcccccCHHHHHHHHhh
Q psy7453         175 PYACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       175 ~~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      .| |..|...|.....|..|+++
T Consensus      1329 ~~-c~~c~~~~~~~~alqihm~~ 1350 (1406)
T KOG1146|consen 1329 YH-CLACEVLLSGREALQIHMRS 1350 (1406)
T ss_pred             cc-chHHHhhcchhHHHHHHHHH
Confidence            35 77777777777777777665


No 66 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=88.61  E-value=0.34  Score=26.32  Aligned_cols=33  Identities=15%  Similarity=0.302  Sum_probs=16.1

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCCCcccccCcccc
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRS  185 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f  185 (200)
                      +.|+.|+..|.-.....     ..+.....|+.|+..|
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGKVRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCEEECCCCCCEE
Confidence            45666666665444321     1112235566666555


No 67 
>KOG2231|consensus
Probab=88.48  E-value=0.78  Score=41.18  Aligned_cols=34  Identities=24%  Similarity=0.583  Sum_probs=23.4

Q ss_pred             cccccccCcccCCCCCCCCcccccChhhhccCHHHHHhc
Q psy7453          93 DHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEH  131 (200)
Q Consensus        93 ~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H  131 (200)
                      ..|.+|+..|.....+   -.|..| -.|.+ ...|++|
T Consensus       100 ~~C~~C~~~~~~~~~~---~~~~~c-~~~~s-~~~Lk~H  133 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNK---KECLHC-TEFKS-VENLKNH  133 (669)
T ss_pred             hhcCccccchhhhccc---CCCccc-cchhH-HHHHHHH
Confidence            3799999888644322   236677 67777 7778888


No 68 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=88.42  E-value=0.47  Score=28.59  Aligned_cols=8  Identities=25%  Similarity=1.003  Sum_probs=4.3

Q ss_pred             ceecCccC
Q psy7453         147 KFVCYACD  154 (200)
Q Consensus       147 ~~~C~~C~  154 (200)
                      +|.|+.||
T Consensus        48 ~Y~CP~CG   55 (59)
T PRK14890         48 PYTCPKCG   55 (59)
T ss_pred             ceECCCCC
Confidence            45555554


No 69 
>PHA00626 hypothetical protein
Probab=88.25  E-value=0.21  Score=29.64  Aligned_cols=13  Identities=23%  Similarity=0.243  Sum_probs=7.3

Q ss_pred             CcccccChhhhcc
Q psy7453         111 SPFCIYCKAVLST  123 (200)
Q Consensus       111 ~~~C~~C~~~f~~  123 (200)
                      .|.|+.||..|+.
T Consensus        23 rYkCkdCGY~ft~   35 (59)
T PHA00626         23 DYVCCDCGYNDSK   35 (59)
T ss_pred             ceEcCCCCCeech
Confidence            4556666655543


No 70 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=87.59  E-value=0.27  Score=28.12  Aligned_cols=26  Identities=19%  Similarity=0.498  Sum_probs=12.9

Q ss_pred             Cccccccccccccccc--ccccccccCc
Q psy7453          76 HSLCKHCHSQLSHLDL--LDHCKTCSYM  101 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~--l~~C~~C~~~  101 (200)
                      .|.|+.||..|.....  ..+|+.||..
T Consensus         3 ~y~C~~CG~~~~~~~~~~~~~Cp~CG~~   30 (46)
T PRK00398          3 EYKCARCGREVELDEYGTGVRCPYCGYR   30 (46)
T ss_pred             EEECCCCCCEEEECCCCCceECCCCCCe
Confidence            3566666665543322  2345555443


No 71 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=87.44  E-value=0.27  Score=34.69  Aligned_cols=26  Identities=19%  Similarity=0.498  Sum_probs=21.5

Q ss_pred             Ccccccccccccccc--cccccccccCc
Q psy7453          76 HSLCKHCHSQLSHLD--LLDHCKTCSYM  101 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~--~l~~C~~C~~~  101 (200)
                      |+.|..||+.|.+-+  .|.-|+.||-.
T Consensus         1 PH~Ct~Cg~~f~dgs~eil~GCP~CGg~   28 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGSKEILSGCPECGGN   28 (131)
T ss_pred             CcccCcCCCCcCCCcHHHHccCcccCCc
Confidence            678999999999865  56789999843


No 72 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=87.02  E-value=0.53  Score=42.95  Aligned_cols=48  Identities=27%  Similarity=0.738  Sum_probs=29.4

Q ss_pred             ccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCC
Q psy7453          94 HCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGE  173 (200)
Q Consensus        94 ~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~  173 (200)
                      .|..||..+          +|+.|+..+..       |      +     ..+...|..||.               ...
T Consensus       437 ~C~~Cg~v~----------~Cp~Cd~~lt~-------H------~-----~~~~L~CH~Cg~---------------~~~  473 (730)
T COG1198         437 LCRDCGYIA----------ECPNCDSPLTL-------H------K-----ATGQLRCHYCGY---------------QEP  473 (730)
T ss_pred             ecccCCCcc----------cCCCCCcceEE-------e------c-----CCCeeEeCCCCC---------------CCC
Confidence            576666554          47777655433       4      3     234567888863               334


Q ss_pred             CCcccccCccc
Q psy7453         174 KPYACGQCAFR  184 (200)
Q Consensus       174 k~~~C~~C~k~  184 (200)
                      .|..|+.||-.
T Consensus       474 ~p~~Cp~Cgs~  484 (730)
T COG1198         474 IPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCC
Confidence            67788888754


No 73 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.76  E-value=0.6  Score=25.23  Aligned_cols=32  Identities=13%  Similarity=0.178  Sum_probs=15.7

Q ss_pred             ecCccCcccCChHHHHHHHHHcCCCCCcccccCcccc
Q psy7453         149 VCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRS  185 (200)
Q Consensus       149 ~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f  185 (200)
                      .|+.|+..|.-....     +-.+....+|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            456666655544432     12223345566666554


No 74 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=86.65  E-value=0.32  Score=32.97  Aligned_cols=35  Identities=17%  Similarity=0.391  Sum_probs=19.5

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCC----CcccccCccccc
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEK----PYACGQCAFRSA  186 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k----~~~C~~C~k~f~  186 (200)
                      ..|+.||..-.....++    +-..+.    -|.|..|+..+.
T Consensus        63 ~~Cp~Cg~~~a~f~~~Q----~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        63 VECPKCGHKEAYYWLLQ----TRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             CCCCCCCCCeeEEEEec----cCCCCCCcEEEEEeCCCCCeeE
Confidence            67888876544333322    122222    288888887654


No 75 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.92  E-value=0.5  Score=32.42  Aligned_cols=30  Identities=20%  Similarity=0.546  Sum_probs=21.6

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccCH
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASV  188 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~  188 (200)
                      ..|+.||..|...           +..|-.|+.||..|.-.
T Consensus        10 R~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            4688888888743           33677788888887654


No 76 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=85.59  E-value=0.37  Score=28.20  Aligned_cols=13  Identities=23%  Similarity=0.572  Sum_probs=9.0

Q ss_pred             ccccccccccccc
Q psy7453          77 SLCKHCHSQLSHL   89 (200)
Q Consensus        77 ~~C~~C~~~f~~~   89 (200)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (52)
T TIGR02605         6 YRCTACGHRFEVL   18 (52)
T ss_pred             EEeCCCCCEeEEE
Confidence            6677777777654


No 77 
>KOG2482|consensus
Probab=85.42  E-value=0.76  Score=37.71  Aligned_cols=50  Identities=26%  Similarity=0.466  Sum_probs=37.4

Q ss_pred             eecCccCcccCChHHHHHHHHH-cCC--------------------------CCCcccccCcccccCHHHHHHHHhh
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRT-HTG--------------------------EKPYACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~-H~~--------------------------~k~~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      .+|-.|.....+...|..||.+ |.=                          .+.-.|-.|.-.|.....|..||-.
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            4788888888888888889874 521                          1234578888889999999988864


No 78 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=85.33  E-value=0.93  Score=27.33  Aligned_cols=8  Identities=25%  Similarity=0.920  Sum_probs=4.4

Q ss_pred             ceecCccC
Q psy7453         147 KFVCYACD  154 (200)
Q Consensus       147 ~~~C~~C~  154 (200)
                      +|.|+.||
T Consensus        50 ~Y~Cp~CG   57 (61)
T COG2888          50 PYRCPKCG   57 (61)
T ss_pred             ceECCCcC
Confidence            45555554


No 79 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=85.17  E-value=0.24  Score=38.30  Aligned_cols=13  Identities=31%  Similarity=0.925  Sum_probs=9.7

Q ss_pred             eecCccCcccCCh
Q psy7453         148 FVCYACDYFSYNI  160 (200)
Q Consensus       148 ~~C~~C~~~f~~~  160 (200)
                      ..|+.||.++...
T Consensus        49 ~vCP~CgyA~~~~   61 (214)
T PF09986_consen   49 WVCPHCGYAAFEE   61 (214)
T ss_pred             EECCCCCCccccc
Confidence            5899998877543


No 80 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=84.43  E-value=0.51  Score=28.03  Aligned_cols=24  Identities=21%  Similarity=0.332  Sum_probs=21.7

Q ss_pred             CCCCCcccccChhhhccCHHHHHhc
Q psy7453         107 NNTFSPFCIYCKAVLSTNLNELIEH  131 (200)
Q Consensus       107 ~~~~~~~C~~C~~~f~~~~~~l~~H  131 (200)
                      .||--+.|+-||+.|.. ...+.+|
T Consensus        13 DGE~~lrCPRC~~~FR~-~K~Y~RH   36 (65)
T COG4049          13 DGEEFLRCPRCGMVFRR-RKDYIRH   36 (65)
T ss_pred             CCceeeeCCchhHHHHH-hHHHHHH
Confidence            47788999999999999 9999999


No 81 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=84.26  E-value=0.55  Score=36.32  Aligned_cols=19  Identities=11%  Similarity=0.349  Sum_probs=14.8

Q ss_pred             CCCcccccccccccccccc
Q psy7453          74 QNHSLCKHCHSQLSHLDLL   92 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~~~l   92 (200)
                      ++...|++|++.|......
T Consensus         3 ~k~~~CPvC~~~F~~~~vr   21 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVR   21 (214)
T ss_pred             CCceECCCCCCeeeeeEEE
Confidence            3567899999999987544


No 82 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=83.62  E-value=0.44  Score=26.68  Aligned_cols=12  Identities=17%  Similarity=0.271  Sum_probs=5.2

Q ss_pred             cccccChhhhcc
Q psy7453         112 PFCIYCKAVLST  123 (200)
Q Consensus       112 ~~C~~C~~~f~~  123 (200)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (42)
T PF09723_consen    6 YRCEECGHEFEV   17 (42)
T ss_pred             EEeCCCCCEEEE
Confidence            344444444433


No 83 
>KOG2893|consensus
Probab=82.90  E-value=0.3  Score=38.05  Aligned_cols=41  Identities=24%  Similarity=0.537  Sum_probs=23.1

Q ss_pred             cccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHH
Q psy7453         114 CIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSH  166 (200)
Q Consensus       114 C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H  166 (200)
                      |=+|++.|.. ..-|.+|      + +    .|.|+|.+|-+...+.-.|..|
T Consensus        13 cwycnrefdd-ekiliqh------q-k----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDD-EKILIQH------Q-K----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccch-hhhhhhh------h-h----hccceeeeehhhhccCCCceee
Confidence            5566666666 6666666      4 1    2346666666655544444444


No 84 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=82.57  E-value=1.1  Score=25.18  Aligned_cols=22  Identities=27%  Similarity=0.374  Sum_probs=9.2

Q ss_pred             CCcccccCcccccCH----HHHHHHH
Q psy7453         174 KPYACGQCAFRSASV----AGLHYHL  195 (200)
Q Consensus       174 k~~~C~~C~k~f~~~----~~L~~H~  195 (200)
                      ....|..|++.+...    +.|.+|+
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            334455555555442    4555555


No 85 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=82.33  E-value=0.75  Score=34.03  Aligned_cols=23  Identities=43%  Similarity=1.038  Sum_probs=19.4

Q ss_pred             ceecCccCcccCChHHHHHHHHHcCCCCCcccccCc
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCA  182 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~  182 (200)
                      -|.|++||..             |.|+-|-+||+||
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            5999999854             4578899999998


No 86 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=82.16  E-value=0.65  Score=25.50  Aligned_cols=12  Identities=17%  Similarity=0.531  Sum_probs=7.7

Q ss_pred             cccccccccccc
Q psy7453          77 SLCKHCHSQLSH   88 (200)
Q Consensus        77 ~~C~~C~~~f~~   88 (200)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (41)
T smart00834        6 YRCEDCGHTFEV   17 (41)
T ss_pred             EEcCCCCCEEEE
Confidence            567777766653


No 87 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=81.44  E-value=0.74  Score=26.14  Aligned_cols=24  Identities=21%  Similarity=0.639  Sum_probs=13.5

Q ss_pred             cccccccccccccc-cccccccccC
Q psy7453          77 SLCKHCHSQLSHLD-LLDHCKTCSY  100 (200)
Q Consensus        77 ~~C~~C~~~f~~~~-~l~~C~~C~~  100 (200)
                      |.|..||..|.... ...+|+.||.
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG~   27 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECGY   27 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCCc
Confidence            66777776665542 2235555554


No 88 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=81.32  E-value=0.92  Score=31.85  Aligned_cols=28  Identities=11%  Similarity=0.088  Sum_probs=17.3

Q ss_pred             ccccccCcccCCCCCCCCcccccChhhhcc
Q psy7453          94 HCKTCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        94 ~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      .|+.||+.|...  +..|..|+.||..|..
T Consensus        11 ~Cp~cg~kFYDL--nk~p~vcP~cg~~~~~   38 (129)
T TIGR02300        11 ICPNTGSKFYDL--NRRPAVSPYTGEQFPP   38 (129)
T ss_pred             cCCCcCcccccc--CCCCccCCCcCCccCc
Confidence            455555555532  2357778888877765


No 89 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=80.60  E-value=2.1  Score=29.53  Aligned_cols=54  Identities=20%  Similarity=0.331  Sum_probs=35.6

Q ss_pred             ccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCc
Q psy7453         113 FCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCA  182 (200)
Q Consensus       113 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~  182 (200)
                      .|--|...|.. ......         ..-.....|.|+.|...|-..-+.-.|...|.      |+-|.
T Consensus        57 ~C~~C~~~f~~-~~~~~~---------~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh~------CPGC~  110 (112)
T TIGR00622        57 FCFGCQGPFPK-PPVSPF---------DELKDSHRYVCAVCKNVFCVDCDVFVHESLHC------CPGCI  110 (112)
T ss_pred             cccCcCCCCCC-cccccc---------cccccccceeCCCCCCccccccchhhhhhccC------CcCCC
Confidence            48888888876 421110         11122346899999999988888888877664      66664


No 90 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=79.95  E-value=1.2  Score=23.42  Aligned_cols=11  Identities=18%  Similarity=0.806  Sum_probs=5.1

Q ss_pred             ccccccccccc
Q psy7453          77 SLCKHCHSQLS   87 (200)
Q Consensus        77 ~~C~~C~~~f~   87 (200)
                      |.|..|+..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            34555555444


No 91 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=79.92  E-value=0.85  Score=32.62  Aligned_cols=16  Identities=19%  Similarity=0.434  Sum_probs=12.7

Q ss_pred             CCCccccccccccccc
Q psy7453          74 QNHSLCKHCHSQLSHL   89 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~   89 (200)
                      ...+.|..||..|...
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            3568899999888775


No 92 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=79.86  E-value=1.5  Score=29.96  Aligned_cols=25  Identities=24%  Similarity=0.557  Sum_probs=23.1

Q ss_pred             ccc----ccCcccccCHHHHHHHHhhhcC
Q psy7453         176 YAC----GQCAFRSASVAGLHYHLKKTYH  200 (200)
Q Consensus       176 ~~C----~~C~k~f~~~~~L~~H~~~h~g  200 (200)
                      |.|    ..|+....+...++.|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889    9999999999999999998886


No 93 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=78.89  E-value=0.76  Score=30.87  Aligned_cols=26  Identities=19%  Similarity=0.554  Sum_probs=20.8

Q ss_pred             Ccccccccccccccc--cccccccccCc
Q psy7453          76 HSLCKHCHSQLSHLD--LLDHCKTCSYM  101 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~--~l~~C~~C~~~  101 (200)
                      |+.|..||..|.+-+  .|.-|+.||-.
T Consensus         2 pH~CtrCG~vf~~g~~~il~GCp~CG~n   29 (112)
T COG3364           2 PHQCTRCGEVFDDGSEEILSGCPKCGCN   29 (112)
T ss_pred             CceecccccccccccHHHHccCccccch
Confidence            678999999999843  55789999854


No 94 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=78.63  E-value=0.97  Score=31.27  Aligned_cols=28  Identities=14%  Similarity=0.349  Sum_probs=21.6

Q ss_pred             CCCcccccccccccccccccccccccCc
Q psy7453          74 QNHSLCKHCHSQLSHLDLLDHCKTCSYM  101 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~~~l~~C~~C~~~  101 (200)
                      .....|..|+..|........||.||..
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (113)
T PRK12380         68 PAQAWCWDCSQVVEIHQHDAQCPHCHGE   95 (113)
T ss_pred             CcEEEcccCCCEEecCCcCccCcCCCCC
Confidence            3457899999988887666679998854


No 95 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=78.47  E-value=0.79  Score=33.56  Aligned_cols=13  Identities=23%  Similarity=0.542  Sum_probs=9.6

Q ss_pred             CcccccChhhhcc
Q psy7453         111 SPFCIYCKAVLST  123 (200)
Q Consensus       111 ~~~C~~C~~~f~~  123 (200)
                      .++|+.||++|.+
T Consensus        28 ~~~c~~c~~~f~~   40 (154)
T PRK00464         28 RRECLACGKRFTT   40 (154)
T ss_pred             eeeccccCCcceE
Confidence            4777777777776


No 96 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=78.21  E-value=1.5  Score=30.76  Aligned_cols=30  Identities=10%  Similarity=0.133  Sum_probs=21.6

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccCH
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASV  188 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~  188 (200)
                      ..|+.||+.|...           +..|-.|+.||..|.-.
T Consensus        10 r~Cp~cg~kFYDL-----------nk~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        10 RICPNTGSKFYDL-----------NRRPAVSPYTGEQFPPE   39 (129)
T ss_pred             ccCCCcCcccccc-----------CCCCccCCCcCCccCcc
Confidence            4688888888743           34677888888887554


No 97 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=77.99  E-value=1.3  Score=31.54  Aligned_cols=22  Identities=27%  Similarity=0.641  Sum_probs=10.0

Q ss_pred             ceecCccCcccCChHHHHHHHHHcC
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~  171 (200)
                      ...|-+||+.|...   ++|++.|.
T Consensus        72 ~i~clecGk~~k~L---krHL~~~~   93 (132)
T PF05443_consen   72 YIICLECGKKFKTL---KRHLRTHH   93 (132)
T ss_dssp             -EE-TBT--EESBH---HHHHHHTT
T ss_pred             eeEEccCCcccchH---HHHHHHcc
Confidence            35566666666533   55665553


No 98 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=77.64  E-value=1.1  Score=31.10  Aligned_cols=29  Identities=21%  Similarity=0.449  Sum_probs=22.4

Q ss_pred             CCCcccccccccccccccccccccccCcc
Q psy7453          74 QNHSLCKHCHSQLSHLDLLDHCKTCSYMI  102 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~~~l~~C~~C~~~f  102 (200)
                      .-...|..|+..|........||.||-..
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (115)
T TIGR00100        68 PVECECEDCSEEVSPEIDLYRCPKCHGIM   96 (115)
T ss_pred             CcEEEcccCCCEEecCCcCccCcCCcCCC
Confidence            33578999999988877677899988543


No 99 
>KOG4173|consensus
Probab=77.62  E-value=2.1  Score=32.74  Aligned_cols=48  Identities=19%  Similarity=0.323  Sum_probs=28.1

Q ss_pred             ccccChhhhccCHHHHHhchhhhhhhhhcC---------CCCCceec--CccCcccCChHHHHHHH
Q psy7453         113 FCIYCKAVLSTNLNELIEHCRTCKSMIRTD---------PFRHKFVC--YACDYFSYNIGCMRSHI  167 (200)
Q Consensus       113 ~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h---------~~~k~~~C--~~C~~~f~~~~~l~~H~  167 (200)
                      .|..|.+.|.+ ...|..|      +.--|         .|..-|+|  ..|+..|.+...-+.|+
T Consensus       108 sCs~C~r~~Pt-~hLLd~H------I~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  108 SCSFCKRAFPT-GHLLDAH------ILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             hhHHHHHhCCc-hhhhhHH------HHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHH
Confidence            57777777777 6666666      52222         23334666  33666666666666664


No 100
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=77.32  E-value=1.6  Score=25.29  Aligned_cols=19  Identities=26%  Similarity=0.613  Sum_probs=9.2

Q ss_pred             cccCcccccCH-----HHHHHHHh
Q psy7453         178 CGQCAFRSASV-----AGLHYHLK  196 (200)
Q Consensus       178 C~~C~k~f~~~-----~~L~~H~~  196 (200)
                      |..|++.++..     ++|.+|++
T Consensus        21 C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       21 CKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             ecCCCCEeeeCCCCCcHHHHHHHH
Confidence            44454444332     45555555


No 101
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=77.31  E-value=1.6  Score=31.57  Aligned_cols=11  Identities=18%  Similarity=0.452  Sum_probs=4.9

Q ss_pred             eecCccCcccC
Q psy7453         148 FVCYACDYFSY  158 (200)
Q Consensus       148 ~~C~~C~~~f~  158 (200)
                      |.|+.|+..|.
T Consensus       100 Y~Cp~C~~~y~  110 (147)
T smart00531      100 YKCPNCQSKYT  110 (147)
T ss_pred             EECcCCCCEee
Confidence            44444444444


No 102
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=77.27  E-value=0.22  Score=28.87  Aligned_cols=44  Identities=18%  Similarity=0.324  Sum_probs=31.1

Q ss_pred             CcccccccccccccccccccccccCcccCCCCCCCCcccccChhh
Q psy7453          76 HSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAV  120 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~  120 (200)
                      .|.|+.|...|... .|++|..||+-.-..--.++-|.|.-|+-.
T Consensus         7 ry~CDLCn~~~p~~-~LRQCvlCGRWaC~sCW~deYY~CksC~Gi   50 (57)
T PF14445_consen    7 RYSCDLCNSSHPIS-ELRQCVLCGRWACNSCWQDEYYTCKSCNGI   50 (57)
T ss_pred             hHhHHhhcccCcHH-HHHHHhhhchhhhhhhhhhhHhHHHhhhch
Confidence            47899999888654 588899998764444445667777777543


No 103
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=77.15  E-value=0.63  Score=34.95  Aligned_cols=14  Identities=21%  Similarity=0.479  Sum_probs=8.3

Q ss_pred             CCcccccChhhhcc
Q psy7453         110 FSPFCIYCKAVLST  123 (200)
Q Consensus       110 ~~~~C~~C~~~f~~  123 (200)
                      .-|.|+.|+..|+.
T Consensus       116 ~~Y~Cp~C~~rytf  129 (178)
T PRK06266        116 MFFFCPNCHIRFTF  129 (178)
T ss_pred             CEEECCCCCcEEeH
Confidence            34566666666655


No 104
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=77.05  E-value=2.7  Score=30.88  Aligned_cols=34  Identities=15%  Similarity=0.208  Sum_probs=24.2

Q ss_pred             CCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCccc
Q psy7453         142 DPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFR  184 (200)
Q Consensus       142 h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~  184 (200)
                      ..+..-|.|+.|+..|....++.         ..|.|+.||..
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            44455688888888887777763         25888888864


No 105
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=75.85  E-value=0.68  Score=33.56  Aligned_cols=13  Identities=15%  Similarity=0.281  Sum_probs=6.9

Q ss_pred             CcccccChhhhcc
Q psy7453         111 SPFCIYCKAVLST  123 (200)
Q Consensus       111 ~~~C~~C~~~f~~  123 (200)
                      -|.|+.|+..|..
T Consensus        99 ~Y~Cp~C~~~y~~  111 (147)
T smart00531       99 YYKCPNCQSKYTF  111 (147)
T ss_pred             EEECcCCCCEeeH
Confidence            4555555555554


No 106
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=75.01  E-value=1.4  Score=25.62  Aligned_cols=26  Identities=15%  Similarity=0.305  Sum_probs=13.8

Q ss_pred             CCcccccccccccccc--cccccccccC
Q psy7453          75 NHSLCKHCHSQLSHLD--LLDHCKTCSY  100 (200)
Q Consensus        75 ~~~~C~~C~~~f~~~~--~l~~C~~C~~  100 (200)
                      ..|.|..||+.|....  ...+|+.||.
T Consensus         5 ~~Y~C~~Cg~~~~~~~~~~~irCp~Cg~   32 (49)
T COG1996           5 MEYKCARCGREVELDQETRGIRCPYCGS   32 (49)
T ss_pred             EEEEhhhcCCeeehhhccCceeCCCCCc
Confidence            3467777777774221  1235555553


No 107
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=74.75  E-value=0.74  Score=33.85  Aligned_cols=13  Identities=8%  Similarity=-0.059  Sum_probs=6.6

Q ss_pred             CcccccChhhhcc
Q psy7453         111 SPFCIYCKAVLST  123 (200)
Q Consensus       111 ~~~C~~C~~~f~~  123 (200)
                      -|.|+.|+..|+.
T Consensus       109 ~Y~Cp~c~~r~tf  121 (158)
T TIGR00373       109 FFICPNMCVRFTF  121 (158)
T ss_pred             eEECCCCCcEeeH
Confidence            4455555555544


No 108
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=74.63  E-value=3.2  Score=31.18  Aligned_cols=35  Identities=20%  Similarity=0.273  Sum_probs=27.2

Q ss_pred             CCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccc
Q psy7453         142 DPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRS  185 (200)
Q Consensus       142 h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f  185 (200)
                      -....-|.|+.|+..|....++.         -.|.|+.||...
T Consensus       112 e~~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        112 EENNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             ccCCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            33445799999999998887762         369999999654


No 109
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=73.83  E-value=3.1  Score=20.65  Aligned_cols=19  Identities=21%  Similarity=0.352  Sum_probs=12.1

Q ss_pred             ccccCcccccCHHHHHHHHh
Q psy7453         177 ACGQCAFRSASVAGLHYHLK  196 (200)
Q Consensus       177 ~C~~C~k~f~~~~~L~~H~~  196 (200)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 4456666654


No 110
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=73.74  E-value=2.7  Score=29.81  Aligned_cols=33  Identities=12%  Similarity=0.266  Sum_probs=23.4

Q ss_pred             hhhhhhhhcCCCCCCCccccccccccccccccc
Q psy7453          61 LNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLLD   93 (200)
Q Consensus        61 ~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~   93 (200)
                      ++....++..-.+.+.|.|..|..+...+.-|.
T Consensus        65 ~n~r~qvmnvF~d~~lYeCnIC~etS~ee~FLK   97 (140)
T PF05290_consen   65 INRRLQVMNVFLDPKLYECNICKETSAEERFLK   97 (140)
T ss_pred             HHHHHHHheeecCCCceeccCcccccchhhcCC
Confidence            344444444445668999999999988888775


No 111
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=73.40  E-value=1  Score=31.12  Aligned_cols=28  Identities=14%  Similarity=0.394  Sum_probs=19.7

Q ss_pred             CCcccccccccccccccccccccccCcc
Q psy7453          75 NHSLCKHCHSQLSHLDLLDHCKTCSYMI  102 (200)
Q Consensus        75 ~~~~C~~C~~~f~~~~~l~~C~~C~~~f  102 (200)
                      -...|..|+..|.-......||.||...
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (113)
T PF01155_consen   69 ARARCRDCGHEFEPDEFDFSCPRCGSPD   96 (113)
T ss_dssp             -EEEETTTS-EEECHHCCHH-SSSSSS-
T ss_pred             CcEECCCCCCEEecCCCCCCCcCCcCCC
Confidence            3478999999998887778888888653


No 112
>KOG2482|consensus
Probab=73.20  E-value=5.2  Score=33.03  Aligned_cols=23  Identities=22%  Similarity=0.183  Sum_probs=18.9

Q ss_pred             cccccCcccccCHHHHHHHHhhh
Q psy7453         176 YACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      .+|-.|...+-....|..||++.
T Consensus       280 v~CLfC~~~~en~~~l~eHmk~v  302 (423)
T KOG2482|consen  280 VVCLFCTNFYENPVFLFEHMKIV  302 (423)
T ss_pred             eEEEeeccchhhHHHHHHHHHHH
Confidence            47888888888888888898864


No 113
>KOG1280|consensus
Probab=73.01  E-value=2.4  Score=34.91  Aligned_cols=38  Identities=21%  Similarity=0.547  Sum_probs=21.3

Q ss_pred             CCceecCccCcccCChHHHHHHHHH-cCCCCC-cccccCc
Q psy7453         145 RHKFVCYACDYFSYNIGCMRSHIRT-HTGEKP-YACGQCA  182 (200)
Q Consensus       145 ~k~~~C~~C~~~f~~~~~l~~H~~~-H~~~k~-~~C~~C~  182 (200)
                      +..|.|++|+..=.+...|..|... |....+ ..|++|+
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            3457777777766666677777554 432221 2355553


No 114
>PRK12496 hypothetical protein; Provisional
Probab=72.63  E-value=2  Score=31.84  Aligned_cols=26  Identities=23%  Similarity=0.540  Sum_probs=15.9

Q ss_pred             cccccccccccccccccccccccCcc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMI  102 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f  102 (200)
                      |.|+.|++.|........|+.||...
T Consensus       128 ~~C~gC~~~~~~~~~~~~C~~CG~~~  153 (164)
T PRK12496        128 KVCKGCKKKYPEDYPDDVCEICGSPV  153 (164)
T ss_pred             EECCCCCccccCCCCCCcCCCCCChh
Confidence            66777777776544444566666543


No 115
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=71.86  E-value=2.3  Score=24.59  Aligned_cols=13  Identities=15%  Similarity=0.166  Sum_probs=7.6

Q ss_pred             CcccccChhhhcc
Q psy7453         111 SPFCIYCKAVLST  123 (200)
Q Consensus       111 ~~~C~~C~~~f~~  123 (200)
                      .+.|+.||..+.-
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            4566666655544


No 116
>KOG2186|consensus
Probab=71.73  E-value=1.7  Score=34.16  Aligned_cols=46  Identities=17%  Similarity=0.297  Sum_probs=28.4

Q ss_pred             cccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHH
Q psy7453         112 PFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIR  168 (200)
Q Consensus       112 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~  168 (200)
                      |.|..||....-  ..+.+|      + ..-++ .-|.|--||+.|-. .++..|..
T Consensus         4 FtCnvCgEsvKK--p~vekH------~-srCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    4 FTCNVCGESVKK--PQVEKH------M-SRCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             Eehhhhhhhccc--cchHHH------H-HhccC-CeeEEeeccccccc-chhhhhhh
Confidence            567777766554  456667      6 44444 45777777777766 45566644


No 117
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=71.55  E-value=2.6  Score=27.73  Aligned_cols=14  Identities=21%  Similarity=0.586  Sum_probs=10.1

Q ss_pred             CCcccccccccccc
Q psy7453          75 NHSLCKHCHSQLSH   88 (200)
Q Consensus        75 ~~~~C~~C~~~f~~   88 (200)
                      .|-.|..||..|.+
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            36677778877766


No 118
>KOG4167|consensus
Probab=71.41  E-value=1  Score=40.64  Aligned_cols=24  Identities=17%  Similarity=0.407  Sum_probs=21.9

Q ss_pred             cccccCcccccCHHHHHHHHhhhc
Q psy7453         176 YACGQCAFRSASVAGLHYHLKKTY  199 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~~h~  199 (200)
                      |.|.+|+|.|-...++..||++|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHHHHH
Confidence            899999999999999999999884


No 119
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=71.34  E-value=1.3  Score=39.88  Aligned_cols=66  Identities=15%  Similarity=0.380  Sum_probs=41.2

Q ss_pred             ccccccccccccccc---cc---ccccccCcccCCCC--------CCCCc-ccccChhhhccCHHHHHhchhhhhhhhhc
Q psy7453          77 SLCKHCHSQLSHLDL---LD---HCKTCSYMIRPNAN--------NTFSP-FCIYCKAVLSTNLNELIEHCRTCKSMIRT  141 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~---l~---~C~~C~~~f~~~~~--------~~~~~-~C~~C~~~f~~~~~~l~~H~~~~~~~~~~  141 (200)
                      -.|+.|-+-+.++.+   +|   .|..||-+|+-...        .-..| -|+.|.+.+.. ..+          . |.
T Consensus       102 a~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTIi~alPYDR~nTsM~~F~lC~~C~~EY~d-P~n----------R-Rf  169 (750)
T COG0068         102 ATCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTIIEALPYDRENTSMADFPLCPFCDKEYKD-PLN----------R-RF  169 (750)
T ss_pred             hhhHHHHHHhcCCCCcceeccccccCCCCcceeeeccCCCCcccCccccCcCCHHHHHHhcC-ccc----------c-cc
Confidence            468888765555433   33   68888888775433        11123 48889888877 544          2 44


Q ss_pred             CCCCCceecCccCcc
Q psy7453         142 DPFRHKFVCYACDYF  156 (200)
Q Consensus       142 h~~~k~~~C~~C~~~  156 (200)
                      |.  .|..|+.||-.
T Consensus       170 HA--Qp~aCp~CGP~  182 (750)
T COG0068         170 HA--QPIACPKCGPH  182 (750)
T ss_pred             cc--ccccCcccCCC
Confidence            54  36789999863


No 120
>PF14353 CpXC:  CpXC protein
Probab=70.72  E-value=2  Score=30.26  Aligned_cols=20  Identities=25%  Similarity=0.285  Sum_probs=11.4

Q ss_pred             CcccccChhhhccCHHHHHhc
Q psy7453         111 SPFCIYCKAVLSTNLNELIEH  131 (200)
Q Consensus       111 ~~~C~~C~~~f~~~~~~l~~H  131 (200)
                      .|.|+.||..|.- ...+.-|
T Consensus        38 ~~~CP~Cg~~~~~-~~p~lY~   57 (128)
T PF14353_consen   38 SFTCPSCGHKFRL-EYPLLYH   57 (128)
T ss_pred             EEECCCCCCceec-CCCEEEE
Confidence            4567777776665 4443333


No 121
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=70.72  E-value=2  Score=29.77  Aligned_cols=28  Identities=18%  Similarity=0.500  Sum_probs=20.7

Q ss_pred             CCCcccccccccccccccc-cccccccCc
Q psy7453          74 QNHSLCKHCHSQLSHLDLL-DHCKTCSYM  101 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~~~l-~~C~~C~~~  101 (200)
                      .....|..|+..|...... ..||.||..
T Consensus        68 p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~   96 (114)
T PRK03681         68 EAECWCETCQQYVTLLTQRVRRCPQCHGD   96 (114)
T ss_pred             CcEEEcccCCCeeecCCccCCcCcCcCCC
Confidence            3457899999988876443 679888854


No 122
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=69.93  E-value=1  Score=28.44  Aligned_cols=15  Identities=13%  Similarity=0.255  Sum_probs=7.9

Q ss_pred             CCceecC--ccCcccCC
Q psy7453         145 RHKFVCY--ACDYFSYN  159 (200)
Q Consensus       145 ~k~~~C~--~C~~~f~~  159 (200)
                      +.-++|.  .||..|..
T Consensus        25 ~~Y~qC~N~eCg~tF~t   41 (72)
T PRK09678         25 ERYHQCQNVNCSATFIT   41 (72)
T ss_pred             eeeeecCCCCCCCEEEE
Confidence            4445555  56655543


No 123
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=69.89  E-value=3  Score=32.77  Aligned_cols=51  Identities=14%  Similarity=0.346  Sum_probs=37.3

Q ss_pred             CCCCcccccccccccc----cccccccccccCcccCCCC----CCCCcccccChhhhcc
Q psy7453          73 TQNHSLCKHCHSQLSH----LDLLDHCKTCSYMIRPNAN----NTFSPFCIYCKAVLST  123 (200)
Q Consensus        73 ~~~~~~C~~C~~~f~~----~~~l~~C~~C~~~f~~~~~----~~~~~~C~~C~~~f~~  123 (200)
                      ..+-|.|..|+...-.    .....+|..|.+.|...-.    |--.|.|+.|+..|.-
T Consensus       109 ~drqFaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  109 VDRQFACSSCDHMWWRRVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             cceeeeccccchHHHhccCcccccccccccccccCCCccccccceeeeecccccccchh
Confidence            3467999999865443    3344589999888775443    5557899999999977


No 124
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=69.70  E-value=2.7  Score=20.23  Aligned_cols=6  Identities=33%  Similarity=1.027  Sum_probs=2.7

Q ss_pred             cccChh
Q psy7453         114 CIYCKA  119 (200)
Q Consensus       114 C~~C~~  119 (200)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444443


No 125
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=69.52  E-value=4  Score=35.88  Aligned_cols=10  Identities=30%  Similarity=0.697  Sum_probs=5.7

Q ss_pred             CCceecCccC
Q psy7453         145 RHKFVCYACD  154 (200)
Q Consensus       145 ~k~~~C~~C~  154 (200)
                      +....|..||
T Consensus       238 ~~~l~Ch~Cg  247 (505)
T TIGR00595       238 EGKLRCHYCG  247 (505)
T ss_pred             CCeEEcCCCc
Confidence            3445666665


No 126
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=69.36  E-value=2.2  Score=29.69  Aligned_cols=29  Identities=21%  Similarity=0.430  Sum_probs=20.8

Q ss_pred             CCCccccccccccccccc-ccccccccCcc
Q psy7453          74 QNHSLCKHCHSQLSHLDL-LDHCKTCSYMI  102 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~~~-l~~C~~C~~~f  102 (200)
                      .-.+.|..||..|..... ...||.||-..
T Consensus        69 p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~~   98 (117)
T PRK00564         69 KVELECKDCSHVFKPNALDYGVCEKCHSKN   98 (117)
T ss_pred             CCEEEhhhCCCccccCCccCCcCcCCCCCc
Confidence            345789999988887654 34588888553


No 127
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=69.22  E-value=1.7  Score=34.45  Aligned_cols=95  Identities=20%  Similarity=0.567  Sum_probs=56.3

Q ss_pred             ccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHH-------HHH
Q psy7453          94 HCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCM-------RSH  166 (200)
Q Consensus        94 ~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l-------~~H  166 (200)
                      .|-+|.+..+.  .|.+-|+|..|....--  ..-..|+++++-. -    ...|+|.-|++.= ..+.|       ..|
T Consensus       127 ~C~EC~R~vw~--hGGrif~CsfC~~flCE--DDQFEHQAsCQvL-e----~E~~KC~SCNrlG-q~sCLRCK~cfCddH  196 (314)
T PF06524_consen  127 VCIECERGVWD--HGGRIFKCSFCDNFLCE--DDQFEHQASCQVL-E----SETFKCQSCNRLG-QYSCLRCKICFCDDH  196 (314)
T ss_pred             Eeeeeeccccc--CCCeEEEeecCCCeeec--cchhhhhhhhhhh-h----ccccccccccccc-chhhhheeeeehhhh
Confidence            45555554432  26788999999876554  4455675555443 1    2246777765432 22222       245


Q ss_pred             HHH----cCCCCCcccccCcccccCHHHHHHHHhhh
Q psy7453         167 IRT----HTGEKPYACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       167 ~~~----H~~~k~~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      .+.    -...++++||.||........|..-.|+|
T Consensus       197 vrrKg~ky~k~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  197 VRRKGFKYEKGKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             hhhcccccccCCCCCCCCCCCcccccccceeeeecc
Confidence            443    23357899999998887777776555544


No 128
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=68.84  E-value=3.1  Score=29.48  Aligned_cols=60  Identities=18%  Similarity=0.256  Sum_probs=33.4

Q ss_pred             ccccccccccccccccCcccCCCCCCCCccc---ccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCCh
Q psy7453          84 SQLSHLDLLDHCKTCSYMIRPNANNTFSPFC---IYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNI  160 (200)
Q Consensus        84 ~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C---~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~  160 (200)
                      ..|... .||+|.+|.......+-. ||-.|   .+|+.-+..    |.+|      - ..|+     +|++|.-+|++.
T Consensus        73 nvF~d~-~lYeCnIC~etS~ee~FL-KPneCCgY~iCn~Cya~----LWK~------~-~~yp-----vCPvCkTSFKss  134 (140)
T PF05290_consen   73 NVFLDP-KLYECNICKETSAEERFL-KPNECCGYSICNACYAN----LWKF------C-NLYP-----VCPVCKTSFKSS  134 (140)
T ss_pred             eeecCC-CceeccCcccccchhhcC-CcccccchHHHHHHHHH----HHHH------c-ccCC-----CCCccccccccc
Confidence            345555 678888887665443321 33333   234444433    5556      4 4443     588887777765


Q ss_pred             H
Q psy7453         161 G  161 (200)
Q Consensus       161 ~  161 (200)
                      +
T Consensus       135 ~  135 (140)
T PF05290_consen  135 S  135 (140)
T ss_pred             c
Confidence            4


No 129
>PF12773 DZR:  Double zinc ribbon
Probab=68.16  E-value=4.3  Score=23.25  Aligned_cols=8  Identities=38%  Similarity=0.862  Sum_probs=3.4

Q ss_pred             cccccChh
Q psy7453         112 PFCIYCKA  119 (200)
Q Consensus       112 ~~C~~C~~  119 (200)
                      ..|+.|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            33444443


No 130
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=67.97  E-value=2.4  Score=30.04  Aligned_cols=21  Identities=19%  Similarity=0.363  Sum_probs=11.9

Q ss_pred             eecCccCcccCChHHHHHHHHHcC
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~  171 (200)
                      ..|-++|+.|.   +|++|+.+|.
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~   97 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHY   97 (148)
T ss_pred             EEEeccCcchH---HHHHHHhccc
Confidence            45666666665   4556665553


No 131
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=67.38  E-value=1.9  Score=24.09  Aligned_cols=11  Identities=36%  Similarity=0.670  Sum_probs=5.1

Q ss_pred             CcccccChhhh
Q psy7453         111 SPFCIYCKAVL  121 (200)
Q Consensus       111 ~~~C~~C~~~f  121 (200)
                      .+.|..||...
T Consensus        19 ~~vC~~CG~Vl   29 (43)
T PF08271_consen   19 ELVCPNCGLVL   29 (43)
T ss_dssp             EEEETTT-BBE
T ss_pred             eEECCCCCCEe
Confidence            34555555443


No 132
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=67.28  E-value=3  Score=30.94  Aligned_cols=11  Identities=27%  Similarity=0.564  Sum_probs=7.1

Q ss_pred             CCCcccccChh
Q psy7453         109 TFSPFCIYCKA  119 (200)
Q Consensus       109 ~~~~~C~~C~~  119 (200)
                      +-|-.||+||.
T Consensus       147 e~P~~CPiCga  157 (166)
T COG1592         147 EAPEVCPICGA  157 (166)
T ss_pred             CCCCcCCCCCC
Confidence            55667777763


No 133
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=67.27  E-value=2.8  Score=27.43  Aligned_cols=10  Identities=20%  Similarity=0.763  Sum_probs=5.6

Q ss_pred             Cccccccccc
Q psy7453          76 HSLCKHCHSQ   85 (200)
Q Consensus        76 ~~~C~~C~~~   85 (200)
                      .|.|+.|++.
T Consensus        35 ~~~Cp~C~~~   44 (89)
T COG1997          35 KHVCPFCGRT   44 (89)
T ss_pred             CCcCCCCCCc
Confidence            4556666554


No 134
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=67.07  E-value=3.2  Score=21.24  Aligned_cols=22  Identities=23%  Similarity=0.747  Sum_probs=13.8

Q ss_pred             ccccccccccccccccccccccc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCS   99 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~   99 (200)
                      |.|..|++...... .|.|..|+
T Consensus         1 ~~C~~C~~~~~~~~-~Y~C~~c~   22 (30)
T PF03107_consen    1 FWCDVCRRKIDGFY-FYHCSECC   22 (30)
T ss_pred             CCCCCCCCCcCCCE-eEEeCCCC
Confidence            45677776655555 66666665


No 135
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=66.10  E-value=4.8  Score=38.87  Aligned_cols=37  Identities=19%  Similarity=0.469  Sum_probs=24.6

Q ss_pred             cccccccccccccccccccccccCcccCCCCCCCCcccccChhhhcc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      +.|+.||..-..    ..|+.||...      +..|.|+.||.....
T Consensus       668 rkCPkCG~~t~~----~fCP~CGs~t------e~vy~CPsCGaev~~  704 (1337)
T PRK14714        668 RRCPSCGTETYE----NRCPDCGTHT------EPVYVCPDCGAEVPP  704 (1337)
T ss_pred             EECCCCCCcccc----ccCcccCCcC------CCceeCccCCCccCC
Confidence            789999874322    2788888664      235688888776543


No 136
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=66.06  E-value=8.1  Score=32.01  Aligned_cols=71  Identities=27%  Similarity=0.557  Sum_probs=46.7

Q ss_pred             cccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCc-------ccCChHHHHHHHHHcCCCCCccccc--C-
Q psy7453         112 PFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDY-------FSYNIGCMRSHIRTHTGEKPYACGQ--C-  181 (200)
Q Consensus       112 ~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~-------~f~~~~~l~~H~~~H~~~k~~~C~~--C-  181 (200)
                      -.|..|...|-. -..|..|      ++..|  |   .|.+|++       -|.+...|..|.+.    --|.|.+  | 
T Consensus       221 P~C~FC~~~FYd-DDEL~~H------cR~~H--E---~ChICD~v~p~~~QYFK~Y~~Le~HF~~----~hy~ct~qtc~  284 (493)
T COG5236         221 PLCIFCKIYFYD-DDELRRH------CRLRH--E---ACHICDMVGPIRYQYFKSYEDLEAHFRN----AHYCCTFQTCR  284 (493)
T ss_pred             chhhhccceecC-hHHHHHH------HHhhh--h---hhhhhhccCccchhhhhCHHHHHHHhhc----CceEEEEEEEe
Confidence            358889988888 8889999      73333  2   2555543       36777777777552    2366754  4 


Q ss_pred             -c--ccccCHHHHHHHHhhh
Q psy7453         182 -A--FRSASVAGLHYHLKKT  198 (200)
Q Consensus       182 -~--k~f~~~~~L~~H~~~h  198 (200)
                       |  ..|.....|..|+-.-
T Consensus       285 ~~k~~vf~~~~el~~h~~~~  304 (493)
T COG5236         285 VGKCYVFPYHTELLEHLTRF  304 (493)
T ss_pred             cCcEEEeccHHHHHHHHHHH
Confidence             2  3677788888887553


No 137
>PRK14873 primosome assembly protein PriA; Provisional
Probab=64.09  E-value=5.1  Score=36.49  Aligned_cols=14  Identities=21%  Similarity=0.012  Sum_probs=7.2

Q ss_pred             ceeehhhHHHHHHH
Q psy7453           2 LVTITPTLAKVFLV   15 (200)
Q Consensus         2 ~~~~~p~~~~~~~~   15 (200)
                      +.+.||++....+.
T Consensus       298 LgSaTPSles~~~~  311 (665)
T PRK14873        298 IGGHARTAEAQALV  311 (665)
T ss_pred             EECCCCCHHHHHHH
Confidence            34556665555443


No 138
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=64.01  E-value=3.3  Score=22.36  Aligned_cols=11  Identities=27%  Similarity=0.546  Sum_probs=5.8

Q ss_pred             CcccccChhhh
Q psy7453         111 SPFCIYCKAVL  121 (200)
Q Consensus       111 ~~~C~~C~~~f  121 (200)
                      +-.|+.||-.+
T Consensus        21 ~~~Cd~cg~~L   31 (36)
T PF05191_consen   21 EGVCDNCGGEL   31 (36)
T ss_dssp             TTBCTTTTEBE
T ss_pred             CCccCCCCCee
Confidence            34566665544


No 139
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=63.90  E-value=4.4  Score=29.38  Aligned_cols=29  Identities=24%  Similarity=0.635  Sum_probs=21.7

Q ss_pred             CCCCccccccc--ccccccccccccccccCc
Q psy7453          73 TQNHSLCKHCH--SQLSHLDLLDHCKTCSYM  101 (200)
Q Consensus        73 ~~~~~~C~~C~--~~f~~~~~l~~C~~C~~~  101 (200)
                      |...|.|..||  ..|.....|-.|+.||..
T Consensus       109 g~G~l~C~~Cg~~~~~~~~~~l~~Cp~C~~~  139 (146)
T PF07295_consen  109 GPGTLVCENCGHEVELTHPERLPPCPKCGHT  139 (146)
T ss_pred             cCceEecccCCCEEEecCCCcCCCCCCCCCC
Confidence            34569999998  456666778889888865


No 140
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=63.64  E-value=2.1  Score=31.16  Aligned_cols=40  Identities=23%  Similarity=0.610  Sum_probs=26.0

Q ss_pred             cccccccccccccccccccccCcccCC----------CCCCCCcccccChhhhcc
Q psy7453          79 CKHCHSQLSHLDLLDHCKTCSYMIRPN----------ANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        79 C~~C~~~f~~~~~l~~C~~C~~~f~~~----------~~~~~~~~C~~C~~~f~~  123 (200)
                      |..||..     .+..|+.|+....-.          ...+.|.-|..||+.|.+
T Consensus        31 C~kCG~~-----tI~~Cp~C~~~IrG~y~v~gv~~~g~~~~~PsYC~~CGkpyPW   80 (158)
T PF10083_consen   31 CSKCGAK-----TITSCPNCSTPIRGDYHVEGVFGLGGHYEAPSYCHNCGKPYPW   80 (158)
T ss_pred             HHHhhHH-----HHHHCcCCCCCCCCceecCCeeeeCCCCCCChhHHhCCCCCch
Confidence            7777753     345677776543322          224567889999999987


No 141
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=63.41  E-value=3.2  Score=25.62  Aligned_cols=26  Identities=27%  Similarity=0.696  Sum_probs=9.7

Q ss_pred             cccccccccccccccccccccccCcc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMI  102 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f  102 (200)
                      -.|..|++.|.....-..|..||..|
T Consensus        10 ~~C~~C~~~F~~~~rrhhCr~CG~~v   35 (69)
T PF01363_consen   10 SNCMICGKKFSLFRRRHHCRNCGRVV   35 (69)
T ss_dssp             SB-TTT--B-BSSS-EEE-TTT--EE
T ss_pred             CcCcCcCCcCCCceeeEccCCCCCEE
Confidence            35777777775444334565555543


No 142
>KOG2785|consensus
Probab=63.07  E-value=9.1  Score=32.05  Aligned_cols=51  Identities=20%  Similarity=0.318  Sum_probs=39.1

Q ss_pred             ceecCccCcccCChHHHHHHHHHcCC-----------------------CCCcccccCc---ccccCHHHHHHHHhh
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHTG-----------------------EKPYACGQCA---FRSASVAGLHYHLKK  197 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~~-----------------------~k~~~C~~C~---k~f~~~~~L~~H~~~  197 (200)
                      |-.|-.|++.+.+......||..++|                       ..-|.|-.|.   +.|.+....+.||..
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            45677788888877777788776655                       1357888887   899999999999863


No 143
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=62.96  E-value=4.5  Score=23.28  Aligned_cols=9  Identities=33%  Similarity=0.600  Sum_probs=4.1

Q ss_pred             CcccccChh
Q psy7453         111 SPFCIYCKA  119 (200)
Q Consensus       111 ~~~C~~C~~  119 (200)
                      .|.|++|+.
T Consensus        34 ~w~CP~C~a   42 (47)
T PF00301_consen   34 DWVCPVCGA   42 (47)
T ss_dssp             T-B-TTTSS
T ss_pred             CCcCcCCCC
Confidence            466666654


No 144
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=62.88  E-value=6.6  Score=32.50  Aligned_cols=48  Identities=23%  Similarity=0.408  Sum_probs=34.1

Q ss_pred             ecCccCcccCChHHHHHHHHHcCCCCCcccccCc----ccccCHHHHHHHHhh
Q psy7453         149 VCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCA----FRSASVAGLHYHLKK  197 (200)
Q Consensus       149 ~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~----k~f~~~~~L~~H~~~  197 (200)
                      .|..|...|.....|..|+|... |+-|.|+.-+    +-|....+|..|.+.
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~HF~~  273 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAHFRN  273 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHHhhc
Confidence            68899999999999999988532 3434443322    347888889888764


No 145
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=62.58  E-value=4  Score=24.23  Aligned_cols=26  Identities=19%  Similarity=0.489  Sum_probs=13.7

Q ss_pred             ccccccccccccccc----ccccccccCcc
Q psy7453          77 SLCKHCHSQLSHLDL----LDHCKTCSYMI  102 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~----l~~C~~C~~~f  102 (200)
                      +.|+.||..+.-...    +..|+.||..+
T Consensus         3 ~~CP~CG~~iev~~~~~GeiV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPELGELVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCccCCEEeCCCCCCEE
Confidence            567777776654332    22455555443


No 146
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=62.52  E-value=4.6  Score=23.74  Aligned_cols=13  Identities=15%  Similarity=0.585  Sum_probs=6.4

Q ss_pred             CcccccChhhhcc
Q psy7453         111 SPFCIYCKAVLST  123 (200)
Q Consensus       111 ~~~C~~C~~~f~~  123 (200)
                      .+.|..||+.|-.
T Consensus        18 k~~Cr~Cg~~~C~   30 (57)
T cd00065          18 RHHCRNCGRIFCS   30 (57)
T ss_pred             ccccCcCcCCcCh
Confidence            3445555555544


No 147
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=61.97  E-value=6.7  Score=22.86  Aligned_cols=9  Identities=33%  Similarity=0.600  Sum_probs=6.0

Q ss_pred             CcccccChh
Q psy7453         111 SPFCIYCKA  119 (200)
Q Consensus       111 ~~~C~~C~~  119 (200)
                      .|.|+.|+.
T Consensus        34 ~w~CP~C~a   42 (50)
T cd00730          34 DWVCPVCGA   42 (50)
T ss_pred             CCCCCCCCC
Confidence            567777764


No 148
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=61.64  E-value=4.3  Score=28.08  Aligned_cols=11  Identities=36%  Similarity=1.126  Sum_probs=7.2

Q ss_pred             cccccCccccc
Q psy7453         176 YACGQCAFRSA  186 (200)
Q Consensus       176 ~~C~~C~k~f~  186 (200)
                      |.|..||..|.
T Consensus       101 y~C~~Cg~~wr  111 (113)
T COG1594         101 YKCTRCGYRWR  111 (113)
T ss_pred             EEecccCCEee
Confidence            66777776654


No 149
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=61.59  E-value=3.4  Score=20.17  Aligned_cols=8  Identities=38%  Similarity=1.481  Sum_probs=3.8

Q ss_pred             CcccccCc
Q psy7453         175 PYACGQCA  182 (200)
Q Consensus       175 ~~~C~~C~  182 (200)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            34455554


No 150
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=61.11  E-value=5.7  Score=36.47  Aligned_cols=22  Identities=23%  Similarity=0.617  Sum_probs=12.1

Q ss_pred             cccccccCcccCCCCCCCCcccccChhh
Q psy7453          93 DHCKTCSYMIRPNANNTFSPFCIYCKAV  120 (200)
Q Consensus        93 ~~C~~C~~~f~~~~~~~~~~~C~~C~~~  120 (200)
                      ..|..||..      ...|..|+.||-.
T Consensus       463 L~CH~Cg~~------~~~p~~Cp~Cgs~  484 (730)
T COG1198         463 LRCHYCGYQ------EPIPQSCPECGSE  484 (730)
T ss_pred             eEeCCCCCC------CCCCCCCCCCCCC
Confidence            356666543      2245667777654


No 151
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=60.90  E-value=6.5  Score=28.01  Aligned_cols=25  Identities=28%  Similarity=0.464  Sum_probs=15.7

Q ss_pred             CCCCcccccChhhhccCHHHHHhchhhhhhhhhcCC
Q psy7453         108 NTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDP  143 (200)
Q Consensus       108 ~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~  143 (200)
                      .+.-..|-+||+.|..    |++|      . +.|.
T Consensus        69 ~~d~i~clecGk~~k~----LkrH------L-~~~~   93 (132)
T PF05443_consen   69 TPDYIICLECGKKFKT----LKRH------L-RTHH   93 (132)
T ss_dssp             -SS-EE-TBT--EESB----HHHH------H-HHTT
T ss_pred             ccCeeEEccCCcccch----HHHH------H-HHcc
Confidence            4445689999999999    7999      7 6664


No 152
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=59.95  E-value=3.2  Score=32.87  Aligned_cols=26  Identities=19%  Similarity=0.387  Sum_probs=20.0

Q ss_pred             CCceecCccCcccCChHHHHHHHHHc
Q psy7453         145 RHKFVCYACDYFSYNIGCMRSHIRTH  170 (200)
Q Consensus       145 ~k~~~C~~C~~~f~~~~~l~~H~~~H  170 (200)
                      .+++.|+.||..-.....|..-.|+|
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~h  232 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSH  232 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecc
Confidence            46899999998887777776666665


No 153
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=59.94  E-value=3.8  Score=28.71  Aligned_cols=32  Identities=25%  Similarity=0.576  Sum_probs=20.9

Q ss_pred             ccccccccCcccCC----------CCCCCCcccccChhhhcc
Q psy7453          92 LDHCKTCSYMIRPN----------ANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        92 l~~C~~C~~~f~~~----------~~~~~~~~C~~C~~~f~~  123 (200)
                      +.+|+.|....+-.          +..+.|-.|..||.+|.+
T Consensus        39 i~qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpw   80 (160)
T COG4306          39 ITQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPW   80 (160)
T ss_pred             HhcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCc
Confidence            44566666543322          124567789999999987


No 154
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=59.38  E-value=2  Score=26.97  Aligned_cols=39  Identities=18%  Similarity=0.512  Sum_probs=13.4

Q ss_pred             cccccccccccccccccccccccCcccCCCC-CCCCcccccCh
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMIRPNAN-NTFSPFCIYCK  118 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~-~~~~~~C~~C~  118 (200)
                      |.|..|++.|...   ..||.|+.....-.. |...|.|..|.
T Consensus        18 ~~C~~C~~~~~~~---a~CPdC~~~Le~LkACGAvdYFC~~c~   57 (70)
T PF07191_consen   18 YHCEACQKDYKKE---AFCPDCGQPLEVLKACGAVDYFCNHCH   57 (70)
T ss_dssp             EEETTT--EEEEE---EE-TTT-SB-EEEEETTEEEEE-TTTT
T ss_pred             EECccccccceec---ccCCCcccHHHHHHHhcccceeeccCC
Confidence            4444554443222   234555443322111 34455555554


No 155
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=59.37  E-value=3.7  Score=20.91  Aligned_cols=8  Identities=25%  Similarity=0.999  Sum_probs=1.9

Q ss_pred             cccccccc
Q psy7453          79 CKHCHSQL   86 (200)
Q Consensus        79 C~~C~~~f   86 (200)
                      |..|++..
T Consensus         3 C~~C~~~~   10 (30)
T PF07649_consen    3 CDACGKPI   10 (30)
T ss_dssp             -TTTS---
T ss_pred             CCcCCCcC
Confidence            44444433


No 156
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=58.94  E-value=1.7  Score=39.20  Aligned_cols=80  Identities=21%  Similarity=0.364  Sum_probs=52.4

Q ss_pred             ccccccccccCcccCCCCCC--CCc-ccccChhhhccCHHHHHhchhhhhhhhhcCCCCCce-ecCccCcccCChHHHHH
Q psy7453          90 DLLDHCKTCSYMIRPNANNT--FSP-FCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKF-VCYACDYFSYNIGCMRS  165 (200)
Q Consensus        90 ~~l~~C~~C~~~f~~~~~~~--~~~-~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~-~C~~C~~~f~~~~~l~~  165 (200)
                      .++..|+.|-..........  -|| .|..||=+|+- -..|---        |.++.-+.| .|+.|.+.+.+..+-+-
T Consensus        99 pD~a~C~~Cl~Ei~dp~~rrY~YPF~~CT~CGPRfTI-i~alPYD--------R~nTsM~~F~lC~~C~~EY~dP~nRRf  169 (750)
T COG0068          99 PDAATCEDCLEEIFDPNSRRYLYPFINCTNCGPRFTI-IEALPYD--------RENTSMADFPLCPFCDKEYKDPLNRRF  169 (750)
T ss_pred             CchhhhHHHHHHhcCCCCcceeccccccCCCCcceee-eccCCCC--------cccCccccCcCCHHHHHHhcCcccccc
Confidence            34568999976655444322  244 39999999998 5554433        333333333 69999998888877544


Q ss_pred             HHHHcCCCCCcccccCccc
Q psy7453         166 HIRTHTGEKPYACGQCAFR  184 (200)
Q Consensus       166 H~~~H~~~k~~~C~~C~k~  184 (200)
                      |      ..|..|+.||=.
T Consensus       170 H------AQp~aCp~CGP~  182 (750)
T COG0068         170 H------AQPIACPKCGPH  182 (750)
T ss_pred             c------cccccCcccCCC
Confidence            4      368899999853


No 157
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=58.07  E-value=10  Score=25.78  Aligned_cols=24  Identities=29%  Similarity=0.642  Sum_probs=17.9

Q ss_pred             eec----CccCcccCChHHHHHHHHHcC
Q psy7453         148 FVC----YACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       148 ~~C----~~C~~~f~~~~~l~~H~~~H~  171 (200)
                      |.|    ..|+....+...+++|.+.+.
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~H  108 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEH  108 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhc
Confidence            677    777777777777777777654


No 159
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=57.77  E-value=5.5  Score=23.64  Aligned_cols=41  Identities=17%  Similarity=0.328  Sum_probs=16.7

Q ss_pred             ceecCc-cCcccCChHHHHHHHHHcCCCCCccccc----CcccccC
Q psy7453         147 KFVCYA-CDYFSYNIGCMRSHIRTHTGEKPYACGQ----CAFRSAS  187 (200)
Q Consensus       147 ~~~C~~-C~~~f~~~~~l~~H~~~H~~~k~~~C~~----C~k~f~~  187 (200)
                      +..|+. |+..-.....|..|...--..++-.|+.    |+..+..
T Consensus         9 ~v~C~~~cc~~~i~r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPRKELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             EEE-TT--S-BEEECCCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             EeeCCCCCcccceeHHHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            455555 2222222335556655444445555666    6555543


No 160
>KOG2807|consensus
Probab=57.59  E-value=8.8  Score=31.52  Aligned_cols=33  Identities=18%  Similarity=0.391  Sum_probs=22.9

Q ss_pred             cccccccCcccCCCCCCCCcccccChhhhccCHHHHHhc
Q psy7453          93 DHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEH  131 (200)
Q Consensus        93 ~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H  131 (200)
                      |.|+.|+...     -.-|-.|++|+-+... ...|.+-
T Consensus       277 y~CP~Ckakv-----CsLP~eCpiC~ltLVs-s~hLARS  309 (378)
T KOG2807|consen  277 YFCPQCKAKV-----CSLPIECPICSLTLVS-SPHLARS  309 (378)
T ss_pred             eeCCcccCee-----ecCCccCCccceeEec-chHHHHH
Confidence            3577665443     3457789999988888 7777754


No 161
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=57.08  E-value=5.2  Score=32.59  Aligned_cols=91  Identities=15%  Similarity=0.207  Sum_probs=54.3

Q ss_pred             cccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhhhcCC-----CCCc-------eecCccCcccCCh
Q psy7453          93 DHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDP-----FRHK-------FVCYACDYFSYNI  160 (200)
Q Consensus        93 ~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~-----~~k~-------~~C~~C~~~f~~~  160 (200)
                      |.|+.|....     -.-|..|+.|+-.... ...|.+-      . ..--     .|+|       --|-.|.-.|.-.
T Consensus       309 y~CP~CktkV-----CsLPi~CP~Csl~Lil-sthLarS------y-hhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~  375 (421)
T COG5151         309 YECPVCKTKV-----CSLPISCPICSLQLIL-STHLARS------Y-HHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKP  375 (421)
T ss_pred             eeCCccccee-----ecCCccCcchhHHHHH-HHHHHHH------H-HhhccCcccccccCCCCCCCccceeccCCCCCC
Confidence            4677775332     2347789999888777 6666653      2 1000     1222       2377777777644


Q ss_pred             HHHHHHHHHcCCCCCcccccCcccccCHHHHHHHHhhh
Q psy7453         161 GCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       161 ~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      ..-..-.  -+..-.|+|+.|...|-...+.-.|...|
T Consensus       376 ~~~~~~~--~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         376 PVSPFDE--STSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             CCCcccc--cccccceechhhhhhhhhhhHHHHHHHHh
Confidence            3211000  11234699999999999888888887665


No 162
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=56.80  E-value=4.7  Score=20.82  Aligned_cols=25  Identities=16%  Similarity=0.377  Sum_probs=10.8

Q ss_pred             ecCccCcccCChHHHHHHHHHcCCCCCcccccCccc
Q psy7453         149 VCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFR  184 (200)
Q Consensus       149 ~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~  184 (200)
                      +|+.|+..+..           .+.-.|.|+.|+..
T Consensus         4 ~Cp~C~se~~y-----------~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----E-----------E-SSSEEETTTTEE
T ss_pred             CCCCCCCccee-----------ccCCEEeCCccccc
Confidence            46777655543           34456777777753


No 163
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=55.98  E-value=7.5  Score=19.11  Aligned_cols=7  Identities=29%  Similarity=1.203  Sum_probs=4.0

Q ss_pred             ccccccc
Q psy7453          78 LCKHCHS   84 (200)
Q Consensus        78 ~C~~C~~   84 (200)
                      .|+.||.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            4556665


No 164
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.25  E-value=7.1  Score=26.70  Aligned_cols=28  Identities=7%  Similarity=-0.172  Sum_probs=15.9

Q ss_pred             ccccccCcccCCCCCCCCcccccChhhhcc
Q psy7453          94 HCKTCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        94 ~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      .|+.||+.|..  .+..|..|+.||+.|..
T Consensus        11 idPetg~KFYD--LNrdPiVsPytG~s~P~   38 (129)
T COG4530          11 IDPETGKKFYD--LNRDPIVSPYTGKSYPR   38 (129)
T ss_pred             cCccccchhhc--cCCCccccCcccccchH
Confidence            34555554443  23456777777777743


No 165
>PRK05580 primosome assembly protein PriA; Validated
Probab=54.78  E-value=10  Score=34.71  Aligned_cols=7  Identities=29%  Similarity=0.956  Sum_probs=3.2

Q ss_pred             eecCccC
Q psy7453         148 FVCYACD  154 (200)
Q Consensus       148 ~~C~~C~  154 (200)
                      ..|..||
T Consensus       409 l~Ch~Cg  415 (679)
T PRK05580        409 LRCHHCG  415 (679)
T ss_pred             EECCCCc
Confidence            4444444


No 166
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=54.68  E-value=11  Score=29.10  Aligned_cols=26  Identities=23%  Similarity=0.319  Sum_probs=17.2

Q ss_pred             CCCceecCccCcccCChHHHHHHHHH
Q psy7453         144 FRHKFVCYACDYFSYNIGCMRSHIRT  169 (200)
Q Consensus       144 ~~k~~~C~~C~~~f~~~~~l~~H~~~  169 (200)
                      ++..|.|..|+|.|.-..-..+|+..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhh
Confidence            44557777777777777777777765


No 167
>KOG2893|consensus
Probab=54.54  E-value=2.9  Score=32.69  Aligned_cols=42  Identities=19%  Similarity=0.279  Sum_probs=31.1

Q ss_pred             ccccccccccccccccccccccCcccCCCCCCCCcccccChhhhccCHHHHHhc
Q psy7453          78 LCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEH  131 (200)
Q Consensus        78 ~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H  131 (200)
                      .|=.|++.|.....|.++           ...|.|+|.+|.|..-+ --.|.-|
T Consensus        12 wcwycnrefddekiliqh-----------qkakhfkchichkkl~s-gpglsih   53 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQH-----------QKAKHFKCHICHKKLFS-GPGLSIH   53 (341)
T ss_pred             eeeecccccchhhhhhhh-----------hhhccceeeeehhhhcc-CCCceee
Confidence            377788888888777542           24578999999988766 6667777


No 168
>KOG4167|consensus
Probab=54.45  E-value=3.4  Score=37.49  Aligned_cols=25  Identities=28%  Similarity=0.636  Sum_probs=22.9

Q ss_pred             ceecCccCcccCChHHHHHHHHHcC
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHT  171 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~  171 (200)
                      -|.|..|++.|....++..||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4999999999999999999999984


No 169
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=54.32  E-value=8.9  Score=23.03  Aligned_cols=27  Identities=22%  Similarity=0.519  Sum_probs=16.6

Q ss_pred             cccCcccCCCCCCCCcccccChhhhcc
Q psy7453          97 TCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        97 ~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      .||+.|......++.-.|+.|.+.|..
T Consensus        30 LCGk~wvp~rdp~~~PVCP~Ck~iye~   56 (58)
T PF11238_consen   30 LCGKVWVPTRDPKPFPVCPECKEIYES   56 (58)
T ss_pred             eeCceeCCCCCCCCCCCCcCHHHHHHh
Confidence            456666655555555568888776643


No 170
>KOG4173|consensus
Probab=54.12  E-value=1.9  Score=32.89  Aligned_cols=21  Identities=19%  Similarity=0.208  Sum_probs=10.8

Q ss_pred             CCccc--ccChhhhccCHHHHHhc
Q psy7453         110 FSPFC--IYCKAVLSTNLNELIEH  131 (200)
Q Consensus       110 ~~~~C--~~C~~~f~~~~~~l~~H  131 (200)
                      .-|+|  +.|+..|.+ ...-..|
T Consensus       143 dMy~ClvEgCt~KFkT-~r~RkdH  165 (253)
T KOG4173|consen  143 DMYQCLVEGCTEKFKT-SRDRKDH  165 (253)
T ss_pred             cHHHHHHHhhhhhhhh-hhhhhhH
Confidence            34555  335555555 5555555


No 171
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=53.38  E-value=4.1  Score=32.46  Aligned_cols=51  Identities=12%  Similarity=0.247  Sum_probs=30.9

Q ss_pred             CCCCcccccccccccccccccccccccCcccCCCCCC--CCcccccChhhhcc
Q psy7453          73 TQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNT--FSPFCIYCKAVLST  123 (200)
Q Consensus        73 ~~~~~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~--~~~~C~~C~~~f~~  123 (200)
                      ...+|.|++.++.|.....+.-=..||..|......+  +...|+.|++.|..
T Consensus       110 ~~~~~~CPvt~~~~~~~~~fv~l~~cG~V~s~~alke~k~~~~Cp~c~~~f~~  162 (260)
T PF04641_consen  110 SEGRFICPVTGKEFNGKHKFVYLRPCGCVFSEKALKELKKSKKCPVCGKPFTE  162 (260)
T ss_pred             CCceeECCCCCcccCCceeEEEEcCCCCEeeHHHHHhhcccccccccCCcccc
Confidence            4668999999988865544432234565555433321  23457777777765


No 172
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=53.33  E-value=7  Score=26.67  Aligned_cols=27  Identities=26%  Similarity=0.549  Sum_probs=15.8

Q ss_pred             ccccccccccccc-cccccccccCcccC
Q psy7453          78 LCKHCHSQLSHLD-LLDHCKTCSYMIRP  104 (200)
Q Consensus        78 ~C~~C~~~f~~~~-~l~~C~~C~~~f~~  104 (200)
                      .|+.|+..|.... .++-|++|+..+..
T Consensus         4 ~CP~C~seytY~dg~~~iCpeC~~EW~~   31 (109)
T TIGR00686         4 PCPKCNSEYTYHDGTQLICPSCLYEWNE   31 (109)
T ss_pred             cCCcCCCcceEecCCeeECccccccccc
Confidence            4777766655543 45566666665543


No 173
>PRK10220 hypothetical protein; Provisional
Probab=53.20  E-value=7.6  Score=26.52  Aligned_cols=29  Identities=21%  Similarity=0.437  Sum_probs=18.2

Q ss_pred             cccccccccccccc-cccccccccCcccCC
Q psy7453          77 SLCKHCHSQLSHLD-LLDHCKTCSYMIRPN  105 (200)
Q Consensus        77 ~~C~~C~~~f~~~~-~l~~C~~C~~~f~~~  105 (200)
                      ..|+.|+..|.... .++-|++|+..+...
T Consensus         4 P~CP~C~seytY~d~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          4 PHCPKCNSEYTYEDNGMYICPECAHEWNDA   33 (111)
T ss_pred             CcCCCCCCcceEcCCCeEECCcccCcCCcc
Confidence            35777776666543 556677777665543


No 174
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=52.27  E-value=7.3  Score=28.34  Aligned_cols=13  Identities=15%  Similarity=0.444  Sum_probs=7.2

Q ss_pred             CCcccccChhhhcc
Q psy7453         110 FSPFCIYCKAVLST  123 (200)
Q Consensus       110 ~~~~C~~C~~~f~~  123 (200)
                      .+|.|. |+..|.+
T Consensus       116 ~~Y~C~-C~q~~l~  128 (156)
T COG3091         116 YPYRCQ-CQQHYLR  128 (156)
T ss_pred             eeEEee-cCCccch
Confidence            355665 6655544


No 175
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=51.69  E-value=8  Score=20.40  Aligned_cols=12  Identities=25%  Similarity=0.479  Sum_probs=5.3

Q ss_pred             ccccccccccCc
Q psy7453          90 DLLDHCKTCSYM  101 (200)
Q Consensus        90 ~~l~~C~~C~~~  101 (200)
                      ...+.|..||..
T Consensus        19 ~~~~~C~~Cg~~   30 (33)
T PF08792_consen   19 DDYEVCIFCGSS   30 (33)
T ss_pred             CCeEEcccCCcE
Confidence            333444444443


No 176
>PF12907 zf-met2:  Zinc-binding
Probab=50.96  E-value=9.5  Score=21.13  Aligned_cols=20  Identities=30%  Similarity=0.584  Sum_probs=9.7

Q ss_pred             cccccChhhhcc--CHHHHHhc
Q psy7453         112 PFCIYCKAVLST--NLNELIEH  131 (200)
Q Consensus       112 ~~C~~C~~~f~~--~~~~l~~H  131 (200)
                      +.|.+|..+|..  +...|..|
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH   23 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEH   23 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHH
Confidence            456666644432  03456666


No 177
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=50.78  E-value=3.9  Score=23.99  Aligned_cols=16  Identities=13%  Similarity=0.193  Sum_probs=4.9

Q ss_pred             ceecCccCcccCChHH
Q psy7453         147 KFVCYACDYFSYNIGC  162 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~  162 (200)
                      .|.|+.|...|=-.=+
T Consensus        21 ~y~C~~C~~~FC~dCD   36 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCD   36 (51)
T ss_dssp             EE--TTTT--B-HHHH
T ss_pred             eEECCCCCCccccCcC
Confidence            3555555544443333


No 178
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=49.63  E-value=4.5  Score=21.63  Aligned_cols=8  Identities=25%  Similarity=0.467  Sum_probs=3.4

Q ss_pred             ccccChhh
Q psy7453         113 FCIYCKAV  120 (200)
Q Consensus       113 ~C~~C~~~  120 (200)
                      .|..|+..
T Consensus        22 ~C~~C~Y~   29 (35)
T PF02150_consen   22 ACRTCGYE   29 (35)
T ss_dssp             EESSSS-E
T ss_pred             CCCCCCCc
Confidence            45555443


No 179
>KOG2593|consensus
Probab=49.24  E-value=17  Score=31.07  Aligned_cols=36  Identities=14%  Similarity=0.401  Sum_probs=18.4

Q ss_pred             CCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCc
Q psy7453         144 FRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCA  182 (200)
Q Consensus       144 ~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~  182 (200)
                      ...-|.|+.|++.|.....++-   .-...-.|.|..|+
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCG  160 (436)
T ss_pred             ccccccCCccccchhhhHHHHh---hcccCceEEEecCC
Confidence            3445666666666665444322   22223346666665


No 180
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF14369 zf-RING_3:  zinc-finger
Probab=49.02  E-value=12  Score=19.93  Aligned_cols=10  Identities=20%  Similarity=0.747  Sum_probs=4.3

Q ss_pred             cccccccccc
Q psy7453          77 SLCKHCHSQL   86 (200)
Q Consensus        77 ~~C~~C~~~f   86 (200)
                      |-|-.|.+..
T Consensus         3 ywCh~C~~~V   12 (35)
T PF14369_consen    3 YWCHQCNRFV   12 (35)
T ss_pred             EeCccCCCEe
Confidence            3444444433


No 182
>PRK04023 DNA polymerase II large subunit; Validated
Probab=48.89  E-value=13  Score=35.36  Aligned_cols=23  Identities=17%  Similarity=0.576  Sum_probs=15.1

Q ss_pred             CCcccccccccccccccccccccccCc
Q psy7453          75 NHSLCKHCHSQLSHLDLLDHCKTCSYM  101 (200)
Q Consensus        75 ~~~~C~~C~~~f~~~~~l~~C~~C~~~  101 (200)
                      ....|+.||...    ....|+.||..
T Consensus       625 g~RfCpsCG~~t----~~frCP~CG~~  647 (1121)
T PRK04023        625 GRRKCPSCGKET----FYRRCPFCGTH  647 (1121)
T ss_pred             cCccCCCCCCcC----CcccCCCCCCC
Confidence            356788888763    33567777765


No 183
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=48.60  E-value=10  Score=20.19  Aligned_cols=16  Identities=25%  Similarity=0.517  Sum_probs=7.8

Q ss_pred             cccccccccccccccc
Q psy7453          77 SLCKHCHSQLSHLDLL   92 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l   92 (200)
                      -.|..|++.|.....+
T Consensus         4 ~~C~eC~~~f~dSyL~   19 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLL   19 (34)
T ss_dssp             EE-TTT--EES-SSCC
T ss_pred             chHhHhCCHHHHHHHH
Confidence            3577788887776544


No 184
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=48.15  E-value=8.6  Score=23.64  Aligned_cols=28  Identities=14%  Similarity=0.287  Sum_probs=14.1

Q ss_pred             ccccccCcccCCCCCCCCcccccChhhhc
Q psy7453          94 HCKTCSYMIRPNANNTFSPFCIYCKAVLS  122 (200)
Q Consensus        94 ~C~~C~~~f~~~~~~~~~~~C~~C~~~f~  122 (200)
                      .|+.||..... ....+.|.|+.||..+.
T Consensus        30 ~C~~CG~~~~~-~~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   30 TCPRCGHRNKK-RRSGRVFTCPNCGFEMD   57 (69)
T ss_pred             CccCccccccc-ccccceEEcCCCCCEEC
Confidence            35555544333 22345566666666543


No 185
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=48.10  E-value=13  Score=20.29  Aligned_cols=18  Identities=22%  Similarity=0.421  Sum_probs=13.2

Q ss_pred             Cccccccccccccccccc
Q psy7453          76 HSLCKHCHSQLSHLDLLD   93 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~l~   93 (200)
                      |+.|..|++.|-..-.+.
T Consensus        12 ~f~C~~C~~~FC~~HR~~   29 (39)
T smart00154       12 GFKCRHCGNLFCGEHRLP   29 (39)
T ss_pred             CeECCccCCccccccCCc
Confidence            678888888887765543


No 186
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=47.82  E-value=8.5  Score=21.97  Aligned_cols=24  Identities=17%  Similarity=0.463  Sum_probs=11.4

Q ss_pred             cccccccccccccccccccccCccc
Q psy7453          79 CKHCHSQLSHLDLLDHCKTCSYMIR  103 (200)
Q Consensus        79 C~~C~~~f~~~~~l~~C~~C~~~f~  103 (200)
                      |..|+. ......+..|..|+..|.
T Consensus         2 C~vC~~-~~~~~~~i~C~~C~~~~H   25 (51)
T PF00628_consen    2 CPVCGQ-SDDDGDMIQCDSCNRWYH   25 (51)
T ss_dssp             BTTTTS-SCTTSSEEEBSTTSCEEE
T ss_pred             CcCCCC-cCCCCCeEEcCCCChhhC
Confidence            445555 233334445555555444


No 187
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=47.47  E-value=14  Score=20.94  Aligned_cols=21  Identities=38%  Similarity=0.754  Sum_probs=10.1

Q ss_pred             cccccCcccccCHHHHHHHHh
Q psy7453         176 YACGQCAFRSASVAGLHYHLK  196 (200)
Q Consensus       176 ~~C~~C~k~f~~~~~L~~H~~  196 (200)
                      |+|=+|..+...++.|-.||+
T Consensus        21 ykcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             ceeecCCcccchHHHHHHHHH
Confidence            344444444444555544443


No 188
>PRK00420 hypothetical protein; Validated
Probab=47.27  E-value=10  Score=26.18  Aligned_cols=27  Identities=19%  Similarity=0.167  Sum_probs=14.6

Q ss_pred             cccccccccccc-cccccccccccCccc
Q psy7453          77 SLCKHCHSQLSH-LDLLDHCKTCSYMIR  103 (200)
Q Consensus        77 ~~C~~C~~~f~~-~~~l~~C~~C~~~f~  103 (200)
                      -.|+.||..+.. ...-..|+.||....
T Consensus        24 ~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~~   51 (112)
T PRK00420         24 KHCPVCGLPLFELKDGEVVCPVHGKVYI   51 (112)
T ss_pred             CCCCCCCCcceecCCCceECCCCCCeee
Confidence            347777755544 344445666665433


No 189
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=46.93  E-value=11  Score=21.95  Aligned_cols=11  Identities=18%  Similarity=0.102  Sum_probs=5.5

Q ss_pred             CCcccccChhh
Q psy7453         110 FSPFCIYCKAV  120 (200)
Q Consensus       110 ~~~~C~~C~~~  120 (200)
                      ..+.|..||.+
T Consensus        36 ~r~~C~~Cgyt   46 (50)
T PRK00432         36 DRWHCGKCGYT   46 (50)
T ss_pred             CcEECCCcCCE
Confidence            34555555543


No 190
>PRK11032 hypothetical protein; Provisional
Probab=46.16  E-value=11  Score=27.79  Aligned_cols=29  Identities=21%  Similarity=0.555  Sum_probs=23.0

Q ss_pred             CCCCccccccc--ccccccccccccccccCc
Q psy7453          73 TQNHSLCKHCH--SQLSHLDLLDHCKTCSYM  101 (200)
Q Consensus        73 ~~~~~~C~~C~--~~f~~~~~l~~C~~C~~~  101 (200)
                      |...+.|..||  ..|.....|-.|+.||..
T Consensus       121 g~G~LvC~~Cg~~~~~~~p~~i~pCp~C~~~  151 (160)
T PRK11032        121 GLGNLVCEKCHHHLAFYTPEVLPLCPKCGHD  151 (160)
T ss_pred             ecceEEecCCCCEEEecCCCcCCCCCCCCCC
Confidence            45579999998  567777888899999865


No 191
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=46.01  E-value=11  Score=29.29  Aligned_cols=26  Identities=15%  Similarity=0.241  Sum_probs=20.8

Q ss_pred             CCCCcccccCcccccCHHHHHHHHhh
Q psy7453         172 GEKPYACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       172 ~~k~~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      ++..|.|++|+|.|.-..-.++|+..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhh
Confidence            44569999999999999999999875


No 192
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=45.60  E-value=8.7  Score=26.63  Aligned_cols=27  Identities=19%  Similarity=0.527  Sum_probs=21.4

Q ss_pred             CCcccccccccccccccccccccccCc
Q psy7453          75 NHSLCKHCHSQLSHLDLLDHCKTCSYM  101 (200)
Q Consensus        75 ~~~~C~~C~~~f~~~~~l~~C~~C~~~  101 (200)
                      ....|..|+..+......+.||.||-.
T Consensus        69 ~~~~C~~C~~~~~~e~~~~~CP~C~s~   95 (115)
T COG0375          69 AECWCLDCGQEVELEELDYRCPKCGSI   95 (115)
T ss_pred             cEEEeccCCCeecchhheeECCCCCCC
Confidence            357899999888888777779999844


No 193
>PRK04023 DNA polymerase II large subunit; Validated
Probab=45.55  E-value=14  Score=35.16  Aligned_cols=34  Identities=18%  Similarity=0.525  Sum_probs=16.4

Q ss_pred             cccccccccccccccccccccccCcccCCCCCCCCcccccChhh
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAV  120 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~  120 (200)
                      +.|+.||..   ....+.|+.|+....       ++.|+.||..
T Consensus       639 frCP~CG~~---Te~i~fCP~CG~~~~-------~y~CPKCG~E  672 (1121)
T PRK04023        639 RRCPFCGTH---TEPVYRCPRCGIEVE-------EDECEKCGRE  672 (1121)
T ss_pred             ccCCCCCCC---CCcceeCccccCcCC-------CCcCCCCCCC
Confidence            556666654   123345666643321       2446666543


No 194
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=45.27  E-value=12  Score=30.53  Aligned_cols=47  Identities=13%  Similarity=0.199  Sum_probs=31.6

Q ss_pred             cccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHc
Q psy7453         114 CIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTH  170 (200)
Q Consensus       114 C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H  170 (200)
                      |-.|.-.|.-    +..|      .-..-+....|.|+.|-..|-..-+.-.|...|
T Consensus       365 Cf~CQ~~fp~----~~~~------~~~~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         365 CFVCQGPFPK----PPVS------PFDESTSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             ceeccCCCCC----CCCC------cccccccccceechhhhhhhhhhhHHHHHHHHh
Confidence            7777777766    2333      212223345699999999998888888887766


No 195
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.70  E-value=3.8  Score=26.01  Aligned_cols=12  Identities=17%  Similarity=0.564  Sum_probs=6.9

Q ss_pred             cccccccccccc
Q psy7453          77 SLCKHCHSQLSH   88 (200)
Q Consensus        77 ~~C~~C~~~f~~   88 (200)
                      |.|..|+..|.-
T Consensus        13 Y~c~~cg~~~dv   24 (82)
T COG2331          13 YECTECGNRFDV   24 (82)
T ss_pred             EeecccchHHHH
Confidence            566666655543


No 196
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=43.72  E-value=12  Score=21.21  Aligned_cols=8  Identities=50%  Similarity=1.173  Sum_probs=4.8

Q ss_pred             cccccccc
Q psy7453          77 SLCKHCHS   84 (200)
Q Consensus        77 ~~C~~C~~   84 (200)
                      +.|+.||.
T Consensus        19 ~~CP~Cg~   26 (46)
T PF12760_consen   19 FVCPHCGS   26 (46)
T ss_pred             CCCCCCCC
Confidence            45666664


No 197
>KOG2593|consensus
Probab=43.61  E-value=14  Score=31.58  Aligned_cols=39  Identities=23%  Similarity=0.330  Sum_probs=26.3

Q ss_pred             CCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCccc
Q psy7453         108 NTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFS  157 (200)
Q Consensus       108 ~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f  157 (200)
                      ....|.|+.|.+.|.. ...++          ......-.|.|..|+-..
T Consensus       125 ~~~~Y~Cp~C~kkyt~-Lea~~----------L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTS-LEALQ----------LLDNETGEFHCENCGGEL  163 (436)
T ss_pred             ccccccCCccccchhh-hHHHH----------hhcccCceEEEecCCCch
Confidence            4467999999999988 55544          223334468999987543


No 198
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=43.37  E-value=11  Score=25.39  Aligned_cols=30  Identities=13%  Similarity=0.354  Sum_probs=17.9

Q ss_pred             CCCcccccccccccccccc--------cccccccCccc
Q psy7453          74 QNHSLCKHCHSQLSHLDLL--------DHCKTCSYMIR  103 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~~~l--------~~C~~C~~~f~  103 (200)
                      ++.|.|+.|+..-...-.+        ..|..||..|.
T Consensus        20 ~k~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~e   57 (104)
T COG4888          20 PKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSFE   57 (104)
T ss_pred             CceEecCccCCeeeeEEEEEecCceeEEEcccCcceEE
Confidence            4568999998765543333        24555555543


No 199
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=43.02  E-value=17  Score=32.04  Aligned_cols=24  Identities=21%  Similarity=0.506  Sum_probs=14.6

Q ss_pred             ccccccccccCcccCCCCCCCCcccccChh
Q psy7453          90 DLLDHCKTCSYMIRPNANNTFSPFCIYCKA  119 (200)
Q Consensus        90 ~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~  119 (200)
                      .....|..||...      ..|..|+.|+.
T Consensus       238 ~~~l~Ch~Cg~~~------~~~~~Cp~C~s  261 (505)
T TIGR00595       238 EGKLRCHYCGYQE------PIPKTCPQCGS  261 (505)
T ss_pred             CCeEEcCCCcCcC------CCCCCCCCCCC
Confidence            3344677777443      23667888875


No 200
>PRK05978 hypothetical protein; Provisional
Probab=41.77  E-value=16  Score=26.55  Aligned_cols=30  Identities=23%  Similarity=0.508  Sum_probs=15.5

Q ss_pred             cccccccccccccccc---cccccccCcccCCC
Q psy7453          77 SLCKHCHSQLSHLDLL---DHCKTCSYMIRPNA  106 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l---~~C~~C~~~f~~~~  106 (200)
                      -.|+.||+.=--...|   ..|+.||..|....
T Consensus        34 grCP~CG~G~LF~g~Lkv~~~C~~CG~~~~~~~   66 (148)
T PRK05978         34 GRCPACGEGKLFRAFLKPVDHCAACGEDFTHHR   66 (148)
T ss_pred             CcCCCCCCCcccccccccCCCccccCCccccCC
Confidence            3577776432222223   25777776665543


No 201
>KOG4124|consensus
Probab=41.49  E-value=3.1  Score=34.38  Aligned_cols=50  Identities=32%  Similarity=0.635  Sum_probs=33.7

Q ss_pred             CceecCc--cCcccCChHHHHHHHHH-c--------------C----CCCCcccccCcccccCHHHHHHHH
Q psy7453         146 HKFVCYA--CDYFSYNIGCMRSHIRT-H--------------T----GEKPYACGQCAFRSASVAGLHYHL  195 (200)
Q Consensus       146 k~~~C~~--C~~~f~~~~~l~~H~~~-H--------------~----~~k~~~C~~C~k~f~~~~~L~~H~  195 (200)
                      ++|+|++  |.+...+...|+-|... |              +    ..|+|.|++|.+.++-...|..|+
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~  418 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHR  418 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCcee
Confidence            4666743  77777666666555321 2              1    258999999999998877777664


No 202
>PRK14873 primosome assembly protein PriA; Provisional
Probab=40.40  E-value=17  Score=33.21  Aligned_cols=21  Identities=19%  Similarity=0.395  Sum_probs=11.3

Q ss_pred             cccccccCcccCCCCCCCCcccccChhh
Q psy7453          93 DHCKTCSYMIRPNANNTFSPFCIYCKAV  120 (200)
Q Consensus        93 ~~C~~C~~~f~~~~~~~~~~~C~~C~~~  120 (200)
                      -.|..||..       ..|..|+.||-.
T Consensus       411 l~Ch~CG~~-------~~p~~Cp~Cgs~  431 (665)
T PRK14873        411 PRCRWCGRA-------APDWRCPRCGSD  431 (665)
T ss_pred             eECCCCcCC-------CcCccCCCCcCC
Confidence            356666642       125667777643


No 203
>KOG2272|consensus
Probab=40.11  E-value=18  Score=28.66  Aligned_cols=15  Identities=20%  Similarity=0.485  Sum_probs=8.9

Q ss_pred             Ccccccccccccccc
Q psy7453          76 HSLCKHCHSQLSHLD   90 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~   90 (200)
                      -|.|+.|.+...+..
T Consensus        99 CF~Cd~Cn~~Lad~g  113 (332)
T KOG2272|consen   99 CFRCDLCNKHLADQG  113 (332)
T ss_pred             cchhHHHHHHHhhhh
Confidence            466676766655544


No 204
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=40.05  E-value=13  Score=30.16  Aligned_cols=29  Identities=24%  Similarity=0.510  Sum_probs=19.7

Q ss_pred             Cccccccccccccc---ccccccccccCcccC
Q psy7453          76 HSLCKHCHSQLSHL---DLLDHCKTCSYMIRP  104 (200)
Q Consensus        76 ~~~C~~C~~~f~~~---~~l~~C~~C~~~f~~  104 (200)
                      -.+|+.|+.....+   .+++.|+.||..|.-
T Consensus        26 ~~~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        26 WTKCPKCGQVLYTKELERNLEVCPKCDHHMRM   57 (285)
T ss_pred             eeECCCCcchhhHHHHHhhCCCCCCCCCcCcC
Confidence            56788888776665   345677777776654


No 205
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=39.22  E-value=17  Score=31.11  Aligned_cols=28  Identities=14%  Similarity=0.306  Sum_probs=18.3

Q ss_pred             ccccccCcccCCCCCCCCcccccChhhhcc
Q psy7453          94 HCKTCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        94 ~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      .|+.||..-.+..  ..-|+|..||..+..
T Consensus       352 ~Cp~Cg~~m~S~G--~~g~rC~kCg~~~~~  379 (421)
T COG1571         352 VCPRCGGRMKSAG--RNGFRCKKCGTRARE  379 (421)
T ss_pred             CCCccCCchhhcC--CCCcccccccccCCc
Confidence            5777776644433  337788888877766


No 206
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=38.87  E-value=14  Score=28.07  Aligned_cols=30  Identities=23%  Similarity=0.417  Sum_probs=19.9

Q ss_pred             Cccccccccccccccccc-------------ccccccCcccCC
Q psy7453          76 HSLCKHCHSQLSHLDLLD-------------HCKTCSYMIRPN  105 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~l~-------------~C~~C~~~f~~~  105 (200)
                      ...|+.||..+.....++             .|..||..+...
T Consensus        14 ~~~CPvCg~~l~~~~~~~~IPyFG~V~i~t~~C~~CgYR~~DV   56 (201)
T COG1779          14 RIDCPVCGGTLKAHMYLYDIPYFGEVLISTGVCERCGYRSTDV   56 (201)
T ss_pred             eecCCcccceeeEEEeeecCCccceEEEEEEEccccCCcccce
Confidence            356999998777766664             466666655543


No 207
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=38.76  E-value=6.8  Score=31.88  Aligned_cols=29  Identities=17%  Similarity=0.490  Sum_probs=17.1

Q ss_pred             Ccccccccccccccc---cccccccccCcccC
Q psy7453          76 HSLCKHCHSQLSHLD---LLDHCKTCSYMIRP  104 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~---~l~~C~~C~~~f~~  104 (200)
                      ..+|+.|+.....+.   +++.|+.|+..|.-
T Consensus        38 w~kc~~C~~~~~~~~l~~~~~vcp~c~~h~rl   69 (296)
T CHL00174         38 WVQCENCYGLNYKKFLKSKMNICEQCGYHLKM   69 (296)
T ss_pred             eeECCCccchhhHHHHHHcCCCCCCCCCCcCC
Confidence            456777776665543   34566666665543


No 208
>KOG4218|consensus
Probab=38.75  E-value=9.4  Score=31.63  Aligned_cols=39  Identities=21%  Similarity=0.394  Sum_probs=27.1

Q ss_pred             ccccccccc-cccccccccccccCcccCCCCCCCCccccc
Q psy7453          78 LCKHCHSQL-SHLDLLDHCKTCSYMIRPNANNTFSPFCIY  116 (200)
Q Consensus        78 ~C~~C~~~f-~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~  116 (200)
                      .|++||... .....|..|+.|.--|.+.-.+.|.|.|..
T Consensus        17 lCPVCGDkVSGYHYGLLTCESCKGFFKRTVQNnK~YtC~e   56 (475)
T KOG4218|consen   17 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKQYTCSE   56 (475)
T ss_pred             ccccccCccccceeeeeehhhhhhHHHHHhhcCcceeccc
Confidence            488887543 334566788888877777666777777753


No 209
>KOG2785|consensus
Probab=38.65  E-value=33  Score=28.88  Aligned_cols=51  Identities=24%  Similarity=0.511  Sum_probs=40.9

Q ss_pred             CcccccChhhhccCHHHHHhchhhhhhhhhcCCCC-----------------------CceecCccC---cccCChHHHH
Q psy7453         111 SPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFR-----------------------HKFVCYACD---YFSYNIGCMR  164 (200)
Q Consensus       111 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~-----------------------k~~~C~~C~---~~f~~~~~l~  164 (200)
                      |-.|-.|++.+.+ ...-..|      | ..+.|-                       .-|.|-.|+   +.|.+..+.+
T Consensus       166 Pt~CLfC~~~~k~-~e~~~~H------M-~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr  237 (390)
T KOG2785|consen  166 PTDCLFCDKKSKS-LEENLKH------M-FKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVR  237 (390)
T ss_pred             CcceeecCCCccc-HHHHHHH------H-hhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHH
Confidence            5679999999999 8888889      8 554431                       137888888   9999999999


Q ss_pred             HHHHH
Q psy7453         165 SHIRT  169 (200)
Q Consensus       165 ~H~~~  169 (200)
                      .||..
T Consensus       238 ~HM~~  242 (390)
T KOG2785|consen  238 AHMRD  242 (390)
T ss_pred             HHHhh
Confidence            99874


No 210
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=37.98  E-value=26  Score=20.47  Aligned_cols=13  Identities=15%  Similarity=0.204  Sum_probs=7.3

Q ss_pred             eecCccCcccCCh
Q psy7453         148 FVCYACDYFSYNI  160 (200)
Q Consensus       148 ~~C~~C~~~f~~~  160 (200)
                      ++|+.||..|...
T Consensus        29 W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   29 WKCPKCGHEWKAS   41 (55)
T ss_pred             EECCCCCCeeEcc
Confidence            5666666555544


No 211
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=37.91  E-value=7.2  Score=31.59  Aligned_cols=33  Identities=12%  Similarity=0.370  Sum_probs=25.2

Q ss_pred             cccccccccCcccCCCCCCCCcccccChhhhcc
Q psy7453          91 LLDHCKTCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        91 ~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      .+.+|+.|+.....+...+..+.|+.|+..|.-
T Consensus        25 ~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        25 VWTKCPKCGQVLYTKELERNLEVCPKCDHHMRM   57 (285)
T ss_pred             CeeECCCCcchhhHHHHHhhCCCCCCCCCcCcC
Confidence            467899999887665545556789999988875


No 212
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=37.63  E-value=18  Score=22.37  Aligned_cols=29  Identities=21%  Similarity=0.479  Sum_probs=19.0

Q ss_pred             ccccccc---ccccccccccccccccCcccCC
Q psy7453          77 SLCKHCH---SQLSHLDLLDHCKTCSYMIRPN  105 (200)
Q Consensus        77 ~~C~~C~---~~f~~~~~l~~C~~C~~~f~~~  105 (200)
                      .+|+.|+   -.|...+....|..||......
T Consensus        20 VkCpdC~N~q~vFshast~V~C~~CG~~l~~P   51 (67)
T COG2051          20 VKCPDCGNEQVVFSHASTVVTCLICGTTLAEP   51 (67)
T ss_pred             EECCCCCCEEEEeccCceEEEecccccEEEec
Confidence            4577776   4566666666777777665443


No 213
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=37.31  E-value=12  Score=24.76  Aligned_cols=9  Identities=22%  Similarity=0.803  Sum_probs=5.9

Q ss_pred             Ccccccccc
Q psy7453          76 HSLCKHCHS   84 (200)
Q Consensus        76 ~~~C~~C~~   84 (200)
                      .|.|+.|++
T Consensus        36 ~y~CpfCgk   44 (90)
T PTZ00255         36 KYFCPFCGK   44 (90)
T ss_pred             CccCCCCCC
Confidence            466777764


No 214
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=37.04  E-value=7.4  Score=31.64  Aligned_cols=28  Identities=25%  Similarity=0.586  Sum_probs=15.8

Q ss_pred             Ccccccccccccccc---cccccccccCccc
Q psy7453          76 HSLCKHCHSQLSHLD---LLDHCKTCSYMIR  103 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~---~l~~C~~C~~~f~  103 (200)
                      -.+|+.|+.....+.   +++.|+.|+..|.
T Consensus        27 ~~~c~~c~~~~~~~~l~~~~~vc~~c~~h~r   57 (292)
T PRK05654         27 WTKCPSCGQVLYRKELEANLNVCPKCGHHMR   57 (292)
T ss_pred             eeECCCccchhhHHHHHhcCCCCCCCCCCee
Confidence            456777776555443   3445666665554


No 215
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=36.98  E-value=40  Score=18.58  Aligned_cols=23  Identities=17%  Similarity=0.265  Sum_probs=12.9

Q ss_pred             eecCccCcccCC--hHHHHHHHHHc
Q psy7453         148 FVCYACDYFSYN--IGCMRSHIRTH  170 (200)
Q Consensus       148 ~~C~~C~~~f~~--~~~l~~H~~~H  170 (200)
                      -+|+.||..+..  ..+-..|.+-|
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH   38 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYH   38 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHH
Confidence            467777766543  34455555555


No 216
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=36.78  E-value=11  Score=27.28  Aligned_cols=32  Identities=28%  Similarity=0.570  Sum_probs=20.4

Q ss_pred             ceecCccCcccCChHHHHHHHHHcCCCCCcccccCccccc
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSA  186 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~  186 (200)
                      .|.|..|+..+.      +|.++  ....|.|..|+..+.
T Consensus       123 ~~~C~~C~~~~~------r~~~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYK------RHRRS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEee------eeccc--chhhEECCCCCCEEE
Confidence            578888887764      23232  234488888886654


No 217
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=36.66  E-value=17  Score=24.39  Aligned_cols=17  Identities=12%  Similarity=0.077  Sum_probs=9.6

Q ss_pred             hcCCCCCceecCccCccc
Q psy7453         140 RTDPFRHKFVCYACDYFS  157 (200)
Q Consensus       140 ~~h~~~k~~~C~~C~~~f  157 (200)
                      ..+.+ +|..|..||..|
T Consensus        73 ~l~~g-~~~rC~eCG~~f   89 (97)
T cd00924          73 WLEKG-KPKRCPECGHVF   89 (97)
T ss_pred             EEeCC-CceeCCCCCcEE
Confidence            44444 466666666555


No 218
>KOG0782|consensus
Probab=36.62  E-value=2.1  Score=37.69  Aligned_cols=94  Identities=14%  Similarity=0.230  Sum_probs=52.3

Q ss_pred             ccccccccccccccccccCcccCCCC---CCCCcccccC----hhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccC
Q psy7453          82 CHSQLSHLDLLDHCKTCSYMIRPNAN---NTFSPFCIYC----KAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACD  154 (200)
Q Consensus        82 C~~~f~~~~~l~~C~~C~~~f~~~~~---~~~~~~C~~C----~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~  154 (200)
                      |.-.|.....-++|..|.....+.-.   ..-+|.|..-    |-.-.. .+.+.+|      . -+|.....=+|..||
T Consensus       189 C~~r~~kS~~rRkCAaCkIVvHT~CieqLeKiNfrCKptFRe~gsr~~r-E~~fvrH------H-WVHrrRqeGkC~~Cg  260 (1004)
T KOG0782|consen  189 CRVRFAKSGERRKCAACKIVVHTNCIEQLEKINFRCKPTFREYGSRKTR-ESGFVRH------H-WVHRRRQEGKCNTCG  260 (1004)
T ss_pred             HHHHHhhhhhhccceeeeEEEechHHHHHHHhccccccchhhccccCcc-cccchHH------h-HhhHhhhccccchhh
Confidence            55555555555567777654332211   2335556421    111112 3467777      6 666655555799999


Q ss_pred             cccCChHHHHHHHHHcCCCC-CcccccCcccccCHH
Q psy7453         155 YFSYNIGCMRSHIRTHTGEK-PYACGQCAFRSASVA  189 (200)
Q Consensus       155 ~~f~~~~~l~~H~~~H~~~k-~~~C~~C~k~f~~~~  189 (200)
                      |.|..+-.+      |..|- ...|.-|.++|..+.
T Consensus       261 KgFQQKf~F------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  261 KGFQQKFFF------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             hhhhhheee------ccccEEEEEehHHHHHhhcch
Confidence            988766443      43332 356888888776665


No 219
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=36.58  E-value=23  Score=20.90  Aligned_cols=12  Identities=17%  Similarity=0.334  Sum_probs=6.9

Q ss_pred             cccccChhhhcc
Q psy7453         112 PFCIYCKAVLST  123 (200)
Q Consensus       112 ~~C~~C~~~f~~  123 (200)
                      ..|+.|+..|-.
T Consensus        41 ~~C~~C~~~fC~   52 (64)
T PF01485_consen   41 VTCPSCGTEFCF   52 (64)
T ss_dssp             CCTTSCCSEECS
T ss_pred             eECCCCCCcCcc
Confidence            556666655544


No 220
>KOG3408|consensus
Probab=36.37  E-value=26  Score=24.50  Aligned_cols=21  Identities=19%  Similarity=0.717  Sum_probs=11.5

Q ss_pred             eecCccCcccCChHHHHHHHH
Q psy7453         148 FVCYACDYFSYNIGCMRSHIR  168 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~  168 (200)
                      |-|-.|.+-|.+...|..|.+
T Consensus        58 fyCi~CaRyFi~~~~l~~H~k   78 (129)
T KOG3408|consen   58 FYCIECARYFIDAKALKTHFK   78 (129)
T ss_pred             eehhhhhhhhcchHHHHHHHh
Confidence            555555555555555555544


No 221
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=36.12  E-value=27  Score=34.16  Aligned_cols=40  Identities=20%  Similarity=0.541  Sum_probs=21.8

Q ss_pred             cccccccccccccccccccccccCcccCCCCCCCCcccccChhhh
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVL  121 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f  121 (200)
                      ..|+.||.....   .+.|+.||........+  ...|+.|+...
T Consensus       680 ~fCP~CGs~te~---vy~CPsCGaev~~des~--a~~CP~CGtpl  719 (1337)
T PRK14714        680 NRCPDCGTHTEP---VYVCPDCGAEVPPDESG--RVECPRCDVEL  719 (1337)
T ss_pred             ccCcccCCcCCC---ceeCccCCCccCCCccc--cccCCCCCCcc
Confidence            367777765432   34677777654432222  44577776443


No 222
>COG1773 Rubredoxin [Energy production and conversion]
Probab=35.86  E-value=16  Score=21.77  Aligned_cols=12  Identities=17%  Similarity=0.719  Sum_probs=7.9

Q ss_pred             CcccccCccccc
Q psy7453         175 PYACGQCAFRSA  186 (200)
Q Consensus       175 ~~~C~~C~k~f~  186 (200)
                      .|+|.+||..|.
T Consensus         3 ~~~C~~CG~vYd   14 (55)
T COG1773           3 RWRCSVCGYVYD   14 (55)
T ss_pred             ceEecCCceEec
Confidence            467777776664


No 223
>KOG3507|consensus
Probab=35.60  E-value=14  Score=22.22  Aligned_cols=13  Identities=15%  Similarity=0.120  Sum_probs=7.7

Q ss_pred             CcccccChhhhcc
Q psy7453         111 SPFCIYCKAVLST  123 (200)
Q Consensus       111 ~~~C~~C~~~f~~  123 (200)
                      .++|.+||.+.-.
T Consensus        37 ~irCReCG~RIly   49 (62)
T KOG3507|consen   37 VIRCRECGYRILY   49 (62)
T ss_pred             cEehhhcchHHHH
Confidence            4566666665544


No 224
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=35.59  E-value=17  Score=25.49  Aligned_cols=26  Identities=15%  Similarity=0.303  Sum_probs=15.6

Q ss_pred             CCCcccccccccccccc-c------ccccccccC
Q psy7453          74 QNHSLCKHCHSQLSHLD-L------LDHCKTCSY  100 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~~-~------l~~C~~C~~  100 (200)
                      ...+.| .|+..|.... .      ...||.||-
T Consensus        68 p~~~~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs  100 (124)
T PRK00762         68 PVEIEC-ECGYEGVVDEDEIDHYAAVIECPVCGN  100 (124)
T ss_pred             CeeEEe-eCcCcccccccchhccccCCcCcCCCC
Confidence            335778 8888776431 1      145777763


No 225
>KOG2071|consensus
Probab=35.50  E-value=24  Score=31.38  Aligned_cols=26  Identities=19%  Similarity=0.464  Sum_probs=21.2

Q ss_pred             CCCcccccCcccccCHHHHHHHHhhh
Q psy7453         173 EKPYACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       173 ~k~~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      ..+-+|..||.+|........||-.|
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H  441 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIH  441 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhh
Confidence            45688999999998888888888776


No 226
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=35.29  E-value=13  Score=19.62  Aligned_cols=19  Identities=16%  Similarity=0.349  Sum_probs=10.7

Q ss_pred             cccccChhhhccCHHHHHhch
Q psy7453         112 PFCIYCKAVLSTNLNELIEHC  132 (200)
Q Consensus       112 ~~C~~C~~~f~~~~~~l~~H~  132 (200)
                      +.|+.|++.+..  +.+..|+
T Consensus         5 ~~C~nC~R~v~a--~RfA~HL   23 (33)
T PF08209_consen    5 VECPNCGRPVAA--SRFAPHL   23 (33)
T ss_dssp             EE-TTTSSEEEG--GGHHHHH
T ss_pred             EECCCCcCCcch--hhhHHHH
Confidence            567777766554  4456663


No 227
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=35.20  E-value=22  Score=30.46  Aligned_cols=32  Identities=19%  Similarity=0.428  Sum_probs=26.2

Q ss_pred             Cccccccccccccccc-ccccccccCcccCCCC
Q psy7453          76 HSLCKHCHSQLSHLDL-LDHCKTCSYMIRPNAN  107 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~-l~~C~~C~~~f~~~~~  107 (200)
                      .-.|+.||....+... -++|+.||..+.....
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~~~~  382 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCGTRARETLI  382 (421)
T ss_pred             CCCCCccCCchhhcCCCCcccccccccCCcccc
Confidence            3579999999998865 7899999998876544


No 228
>PRK06260 threonine synthase; Validated
Probab=35.18  E-value=19  Score=30.59  Aligned_cols=26  Identities=15%  Similarity=0.544  Sum_probs=19.3

Q ss_pred             cccccccccccccccccccccccCcc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMI  102 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f  102 (200)
                      +.|..||..|......+.|+.|+-.+
T Consensus         4 ~~C~~cg~~~~~~~~~~~Cp~cg~~l   29 (397)
T PRK06260          4 LKCIECGKEYDPDEIIYTCPECGGLL   29 (397)
T ss_pred             EEECCCCCCCCCCCccccCCCCCCeE
Confidence            67888888887666667888887543


No 229
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=35.16  E-value=13  Score=20.38  Aligned_cols=12  Identities=17%  Similarity=0.520  Sum_probs=4.9

Q ss_pred             CCCceecCccCc
Q psy7453         144 FRHKFVCYACDY  155 (200)
Q Consensus       144 ~~k~~~C~~C~~  155 (200)
                      +.+.+.|..|+.
T Consensus        21 ~~~~w~C~~C~~   32 (40)
T PF04810_consen   21 GGKTWICNFCGT   32 (40)
T ss_dssp             TTTEEEETTT--
T ss_pred             CCCEEECcCCCC
Confidence            334455555543


No 230
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=35.03  E-value=11  Score=24.90  Aligned_cols=10  Identities=20%  Similarity=0.766  Sum_probs=6.4

Q ss_pred             Cccccccccc
Q psy7453          76 HSLCKHCHSQ   85 (200)
Q Consensus        76 ~~~C~~C~~~   85 (200)
                      .|.|+.|++.
T Consensus        35 ~y~CpfCgk~   44 (91)
T TIGR00280        35 KYVCPFCGKK   44 (91)
T ss_pred             CccCCCCCCC
Confidence            4677777643


No 231
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=35.02  E-value=17  Score=26.45  Aligned_cols=11  Identities=27%  Similarity=0.670  Sum_probs=6.9

Q ss_pred             ccccChhhhcc
Q psy7453         113 FCIYCKAVLST  123 (200)
Q Consensus       113 ~C~~C~~~f~~  123 (200)
                      .|+.|+..|.+
T Consensus        30 eC~~C~~RFTT   40 (156)
T COG1327          30 ECLECGERFTT   40 (156)
T ss_pred             cccccccccch
Confidence            46666666665


No 232
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=34.92  E-value=16  Score=24.21  Aligned_cols=28  Identities=18%  Similarity=0.337  Sum_probs=15.3

Q ss_pred             Ccccccccccccccc--cccccccccCccc
Q psy7453          76 HSLCKHCHSQLSHLD--LLDHCKTCSYMIR  103 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~--~l~~C~~C~~~f~  103 (200)
                      .|.|+.|++.-....  -+-.|..|++.|.
T Consensus        35 ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSVKRVATGIWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEEEEEETTEEEETTTTEEEE
T ss_pred             CCcCCCCCCceeEEeeeEEeecCCCCCEEe
Confidence            578888887543322  1235666665554


No 233
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=34.89  E-value=18  Score=27.08  Aligned_cols=23  Identities=22%  Similarity=0.574  Sum_probs=13.3

Q ss_pred             cccccccccccccccccccccccCc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYM  101 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~  101 (200)
                      +.|.-|++.|.  .....|+.||..
T Consensus       140 ~rC~GC~~~f~--~~~~~Cp~CG~~  162 (177)
T COG1439         140 LRCHGCKRIFP--EPKDFCPICGSP  162 (177)
T ss_pred             EEEecCceecC--CCCCcCCCCCCc
Confidence            55666666666  333446666644


No 234
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=34.75  E-value=21  Score=25.28  Aligned_cols=15  Identities=13%  Similarity=0.290  Sum_probs=9.3

Q ss_pred             CCCcccccChhhhcc
Q psy7453         109 TFSPFCIYCKAVLST  123 (200)
Q Consensus       109 ~~~~~C~~C~~~f~~  123 (200)
                      .-.|+|..|++.|..
T Consensus        51 ~qRyrC~~C~~tf~~   65 (129)
T COG3677          51 HQRYKCKSCGSTFTV   65 (129)
T ss_pred             ccccccCCcCcceee
Confidence            345666666666655


No 235
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=34.59  E-value=22  Score=25.54  Aligned_cols=12  Identities=17%  Similarity=0.199  Sum_probs=6.3

Q ss_pred             CcccccChhhhc
Q psy7453         111 SPFCIYCKAVLS  122 (200)
Q Consensus       111 ~~~C~~C~~~f~  122 (200)
                      .|.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~  123 (146)
T smart00731      112 PYRCTGCGQRYL  123 (146)
T ss_pred             EEECCCCCCCCc
Confidence            455655554443


No 236
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=34.16  E-value=28  Score=20.77  Aligned_cols=14  Identities=14%  Similarity=0.131  Sum_probs=8.0

Q ss_pred             CCCcccccChhhhc
Q psy7453         109 TFSPFCIYCKAVLS  122 (200)
Q Consensus       109 ~~~~~C~~C~~~f~  122 (200)
                      ...|.|+.||..+-
T Consensus        12 ~v~~~Cp~cGipth   25 (55)
T PF13824_consen   12 HVNFECPDCGIPTH   25 (55)
T ss_pred             ccCCcCCCCCCcCc
Confidence            34566666665544


No 237
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=33.35  E-value=13  Score=23.23  Aligned_cols=30  Identities=20%  Similarity=0.424  Sum_probs=13.9

Q ss_pred             ceecCccCcccCChHHHHHHHHHcCCCCCcccccCccc
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFR  184 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~  184 (200)
                      ...|..|+..+.....       ..+ ..|.|+.|+..
T Consensus        41 ~v~Cg~C~~~~~~~~~-------~c~-~~~~C~~C~~~   70 (71)
T PF05495_consen   41 RVICGKCRTEQPIDEY-------SCG-ADYFCPICGLY   70 (71)
T ss_dssp             EEEETTT--EEES-SB-------TT---SEEETTTTEE
T ss_pred             CeECCCCCCccChhhh-------hcC-CCccCcCcCCC
Confidence            5667777665544332       111 45667777644


No 238
>PRK05580 primosome assembly protein PriA; Validated
Probab=32.66  E-value=30  Score=31.73  Aligned_cols=37  Identities=24%  Similarity=0.654  Sum_probs=19.7

Q ss_pred             cccccccccc--ccccccccccccCcccCCCCCCCCcccccChhh
Q psy7453          78 LCKHCHSQLS--HLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAV  120 (200)
Q Consensus        78 ~C~~C~~~f~--~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~  120 (200)
                      .|+.|+-.+.  .......|..||...      ..|..|+.||..
T Consensus       392 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~~------~~~~~Cp~Cg~~  430 (679)
T PRK05580        392 ECPHCDASLTLHRFQRRLRCHHCGYQE------PIPKACPECGST  430 (679)
T ss_pred             CCCCCCCceeEECCCCeEECCCCcCCC------CCCCCCCCCcCC
Confidence            3445543322  223334677777543      235678888654


No 239
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=32.26  E-value=20  Score=25.98  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=7.3

Q ss_pred             ccccChhhhcc
Q psy7453         113 FCIYCKAVLST  123 (200)
Q Consensus       113 ~C~~C~~~f~~  123 (200)
                      .|..|++.|.+
T Consensus        30 eC~~C~~RFTT   40 (147)
T TIGR00244        30 ECLECHERFTT   40 (147)
T ss_pred             cCCccCCccce
Confidence            46667766666


No 240
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=31.95  E-value=20  Score=24.66  Aligned_cols=29  Identities=24%  Similarity=0.509  Sum_probs=20.3

Q ss_pred             CCcccccccccccccccccccccccCccc
Q psy7453          75 NHSLCKHCHSQLSHLDLLDHCKTCSYMIR  103 (200)
Q Consensus        75 ~~~~C~~C~~~f~~~~~l~~C~~C~~~f~  103 (200)
                      ....|+.|++...-......|..|+..-.
T Consensus        68 v~V~CP~C~K~TKmLGr~D~CM~C~~pLT   96 (114)
T PF11023_consen   68 VQVECPNCGKQTKMLGRVDACMHCKEPLT   96 (114)
T ss_pred             eeeECCCCCChHhhhchhhccCcCCCcCc
Confidence            45678888887766666667877776543


No 241
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=31.86  E-value=30  Score=19.36  Aligned_cols=12  Identities=17%  Similarity=0.235  Sum_probs=7.0

Q ss_pred             cccCcccccCHH
Q psy7453         178 CGQCAFRSASVA  189 (200)
Q Consensus       178 C~~C~k~f~~~~  189 (200)
                      |..||+.|+.+.
T Consensus        11 C~~C~rpf~WRK   22 (42)
T PF10013_consen   11 CPVCGRPFTWRK   22 (42)
T ss_pred             CcccCCcchHHH
Confidence            666666665544


No 242
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=31.73  E-value=32  Score=31.35  Aligned_cols=37  Identities=27%  Similarity=0.662  Sum_probs=24.8

Q ss_pred             ccccccccccccccccccccccCcccCCCCCCCCcccccChhhhcc
Q psy7453          78 LCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        78 ~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      -|+.||..+..    ..|+.||.....     ..-.|+.||....+
T Consensus        17 FC~~CG~~l~~----~~Cp~CG~~~~~-----~~~fC~~CG~~~~~   53 (645)
T PRK14559         17 FCQKCGTSLTH----KPCPQCGTEVPV-----DEAHCPNCGAETGT   53 (645)
T ss_pred             cccccCCCCCC----CcCCCCCCCCCc-----ccccccccCCcccc
Confidence            47777776643    358888866332     22369999988887


No 243
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=31.57  E-value=18  Score=33.57  Aligned_cols=26  Identities=23%  Similarity=0.696  Sum_probs=14.6

Q ss_pred             ccccccccccccccc-----ccccccccCcc
Q psy7453          77 SLCKHCHSQLSHLDL-----LDHCKTCSYMI  102 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~-----l~~C~~C~~~f  102 (200)
                      -.|..|++.|.....     -.+|..||..|
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGrVF  491 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGIRL  491 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCcccc
Confidence            457778877754321     12466666544


No 244
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=31.56  E-value=20  Score=27.24  Aligned_cols=7  Identities=29%  Similarity=0.771  Sum_probs=4.7

Q ss_pred             ccccccc
Q psy7453          77 SLCKHCH   83 (200)
Q Consensus        77 ~~C~~C~   83 (200)
                      +.|+.||
T Consensus         7 ~~Cp~Cg   13 (201)
T COG1326           7 IECPSCG   13 (201)
T ss_pred             EECCCCC
Confidence            4577777


No 245
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.51  E-value=15  Score=28.72  Aligned_cols=14  Identities=14%  Similarity=0.309  Sum_probs=8.5

Q ss_pred             CCcccccChhhhcc
Q psy7453         110 FSPFCIYCKAVLST  123 (200)
Q Consensus       110 ~~~~C~~C~~~f~~  123 (200)
                      +.+.|++|+-.|..
T Consensus        18 k~ieCPvC~tkFkk   31 (267)
T COG1655          18 KTIECPVCNTKFKK   31 (267)
T ss_pred             ceeccCcccchhhh
Confidence            44566666666655


No 246
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=31.22  E-value=12  Score=28.13  Aligned_cols=13  Identities=23%  Similarity=0.337  Sum_probs=5.8

Q ss_pred             CcccccChhhhcc
Q psy7453         111 SPFCIYCKAVLST  123 (200)
Q Consensus       111 ~~~C~~C~~~f~~  123 (200)
                      -|.|+.|...|+.
T Consensus       113 ~y~C~~~~~r~sf  125 (176)
T COG1675         113 YYVCPNCHVKYSF  125 (176)
T ss_pred             ceeCCCCCCcccH
Confidence            3445444444433


No 247
>PLN02294 cytochrome c oxidase subunit Vb
Probab=31.13  E-value=24  Score=26.21  Aligned_cols=13  Identities=23%  Similarity=0.565  Sum_probs=7.1

Q ss_pred             CCcccccCccccc
Q psy7453         174 KPYACGQCAFRSA  186 (200)
Q Consensus       174 k~~~C~~C~k~f~  186 (200)
                      +++.|++||..|.
T Consensus       140 kp~RCpeCG~~fk  152 (174)
T PLN02294        140 KSFECPVCTQYFE  152 (174)
T ss_pred             CceeCCCCCCEEE
Confidence            4555655655553


No 248
>PRK06450 threonine synthase; Validated
Probab=30.80  E-value=24  Score=29.28  Aligned_cols=26  Identities=19%  Similarity=0.441  Sum_probs=17.6

Q ss_pred             cccccccccccccccccccccccCccc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMIR  103 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f~  103 (200)
                      +.|..||+.+.. ...+.|+.||-.+.
T Consensus         4 ~~C~~Cg~~~~~-~~~~~C~~cg~~l~   29 (338)
T PRK06450          4 EVCMKCGKERES-IYEIRCKKCGGPFE   29 (338)
T ss_pred             eEECCcCCcCCC-cccccCCcCCCEeE
Confidence            678888888755 44567887865433


No 249
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=30.31  E-value=19  Score=21.00  Aligned_cols=12  Identities=17%  Similarity=0.351  Sum_probs=6.0

Q ss_pred             ccccCcccccCH
Q psy7453         177 ACGQCAFRSASV  188 (200)
Q Consensus       177 ~C~~C~k~f~~~  188 (200)
                      .||+|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            788888888643


No 250
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=29.88  E-value=36  Score=31.00  Aligned_cols=37  Identities=16%  Similarity=0.552  Sum_probs=23.6

Q ss_pred             ccccccccccccccccccccccCcccCCCCCCCCcccccChhhhcc
Q psy7453          78 LCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLST  123 (200)
Q Consensus        78 ~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~  123 (200)
                      .|+.||..-....  .-|+.||.....       -.|+.||.....
T Consensus         3 ~Cp~Cg~~n~~~a--kFC~~CG~~l~~-------~~Cp~CG~~~~~   39 (645)
T PRK14559          3 ICPQCQFENPNNN--RFCQKCGTSLTH-------KPCPQCGTEVPV   39 (645)
T ss_pred             cCCCCCCcCCCCC--ccccccCCCCCC-------CcCCCCCCCCCc
Confidence            5888887644333  458888877632       148888776443


No 251
>COG4640 Predicted membrane protein [Function unknown]
Probab=29.80  E-value=33  Score=29.14  Aligned_cols=21  Identities=10%  Similarity=0.173  Sum_probs=13.1

Q ss_pred             CCCcccccChhhhccCHHHHHh
Q psy7453         109 TFSPFCIYCKAVLSTNLNELIE  130 (200)
Q Consensus       109 ~~~~~C~~C~~~f~~~~~~l~~  130 (200)
                      |..++|..||..|.. .+.+.+
T Consensus        13 Ed~~qC~qCG~~~t~-~~sqan   33 (465)
T COG4640          13 EDDVQCTQCGHKFTS-RQSQAN   33 (465)
T ss_pred             cccccccccCCcCCc-hhhhhh
Confidence            334558888877777 555443


No 252
>KOG1280|consensus
Probab=29.64  E-value=41  Score=28.01  Aligned_cols=39  Identities=23%  Similarity=0.417  Sum_probs=28.8

Q ss_pred             CCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCc-eecCccC
Q psy7453         109 TFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHK-FVCYACD  154 (200)
Q Consensus       109 ~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~-~~C~~C~  154 (200)
                      ...|.|++|+++--+ ...|..|      ....|....+ ..|++|+
T Consensus        77 ~qSftCPyC~~~Gft-e~~f~~H------v~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFT-ERQFGTH------VLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccc-hhHHHHH------hhhcCcccCcceeeeccc
Confidence            447999999999888 8999999      7667764332 4566664


No 253
>KOG3408|consensus
Probab=29.64  E-value=33  Score=23.96  Aligned_cols=25  Identities=24%  Similarity=0.394  Sum_probs=21.9

Q ss_pred             CCCcccccCcccccCHHHHHHHHhh
Q psy7453         173 EKPYACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       173 ~k~~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      .-.|-|-.|.+-|.....|..|.++
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhc
Confidence            3458899999999999999999874


No 254
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=29.36  E-value=4.2  Score=33.78  Aligned_cols=14  Identities=14%  Similarity=0.002  Sum_probs=5.5

Q ss_pred             CCcccccChhhhcc
Q psy7453         110 FSPFCIYCKAVLST  123 (200)
Q Consensus       110 ~~~~C~~C~~~f~~  123 (200)
                      +-|+|..|+++..+
T Consensus       284 RFFkC~~C~~Rt~s  297 (344)
T PF09332_consen  284 RFFKCKDCGNRTIS  297 (344)
T ss_dssp             EEEE-T-TS-EEEE
T ss_pred             eeEECCCCCCeeee
Confidence            34555555555444


No 255
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=29.30  E-value=50  Score=17.97  Aligned_cols=16  Identities=25%  Similarity=0.554  Sum_probs=7.3

Q ss_pred             eecCccCcccCChHHH
Q psy7453         148 FVCYACDYFSYNIGCM  163 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l  163 (200)
                      ..|+.|+-.+.....|
T Consensus        20 d~C~~C~G~W~d~~el   35 (41)
T PF13453_consen   20 DVCPSCGGIWFDAGEL   35 (41)
T ss_pred             EECCCCCeEEccHHHH
Confidence            3444454444444443


No 256
>KOG0978|consensus
Probab=29.11  E-value=21  Score=32.65  Aligned_cols=21  Identities=10%  Similarity=0.175  Sum_probs=14.1

Q ss_pred             CCCcccccCcccccCHHHHHH
Q psy7453         173 EKPYACGQCAFRSASVAGLHY  193 (200)
Q Consensus       173 ~k~~~C~~C~k~f~~~~~L~~  193 (200)
                      .+.-+||.|+.+|....-+..
T Consensus       676 tRqRKCP~Cn~aFganDv~~I  696 (698)
T KOG0978|consen  676 TRQRKCPKCNAAFGANDVHRI  696 (698)
T ss_pred             HhcCCCCCCCCCCCccccccc
Confidence            355678888888876654443


No 257
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=28.96  E-value=25  Score=20.53  Aligned_cols=29  Identities=21%  Similarity=0.499  Sum_probs=17.6

Q ss_pred             Ccccccccccccccccc----cccccccCcccC
Q psy7453          76 HSLCKHCHSQLSHLDLL----DHCKTCSYMIRP  104 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~l----~~C~~C~~~f~~  104 (200)
                      .+.|..|++........    .+|+.|+....-
T Consensus         4 eiRC~~CnklLa~~g~~~~leIKCpRC~tiN~~   36 (51)
T PF10122_consen    4 EIRCGHCNKLLAKAGEVIELEIKCPRCKTINHV   36 (51)
T ss_pred             ceeccchhHHHhhhcCccEEEEECCCCCccceE
Confidence            35688888776663222    367777765543


No 258
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=28.93  E-value=31  Score=19.11  Aligned_cols=19  Identities=26%  Similarity=0.382  Sum_probs=10.8

Q ss_pred             CCccccccccccccccccc
Q psy7453          75 NHSLCKHCHSQLSHLDLLD   93 (200)
Q Consensus        75 ~~~~C~~C~~~f~~~~~l~   93 (200)
                      .|+.|+.|++.|-..-.+.
T Consensus        12 ~~~~C~~C~~~FC~~Hr~~   30 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKHRLP   30 (43)
T ss_dssp             SHEE-TTTS-EE-TTTHST
T ss_pred             CCeECCCCCcccCccccCc
Confidence            4678888888887665443


No 259
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=28.34  E-value=42  Score=20.30  Aligned_cols=28  Identities=21%  Similarity=0.522  Sum_probs=16.8

Q ss_pred             ccccccc---ccccccccccccccccCcccC
Q psy7453          77 SLCKHCH---SQLSHLDLLDHCKTCSYMIRP  104 (200)
Q Consensus        77 ~~C~~C~---~~f~~~~~l~~C~~C~~~f~~  104 (200)
                      .+|+.|+   -.|+..+..-.|..||....+
T Consensus        12 VkCp~C~n~q~vFsha~t~V~C~~Cg~~L~~   42 (59)
T PRK00415         12 VKCPDCGNEQVVFSHASTVVRCLVCGKTLAE   42 (59)
T ss_pred             EECCCCCCeEEEEecCCcEEECcccCCCccc
Confidence            3566665   345666666667777665543


No 260
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=28.32  E-value=17  Score=33.40  Aligned_cols=68  Identities=13%  Similarity=0.239  Sum_probs=39.9

Q ss_pred             Ccccccccccccccccc---c---ccccccCcccCCCC--CC------CCc-ccccChhhhccCHHHHHhchhhhhhhhh
Q psy7453          76 HSLCKHCHSQLSHLDLL---D---HCKTCSYMIRPNAN--NT------FSP-FCIYCKAVLSTNLNELIEHCRTCKSMIR  140 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~l---~---~C~~C~~~f~~~~~--~~------~~~-~C~~C~~~f~~~~~~l~~H~~~~~~~~~  140 (200)
                      .-.|+.|-+-+.+..+-   |   -|..||-.|.-...  ..      ..| .|+.|.+-+.. ..+-           |
T Consensus        68 ~a~C~~Cl~E~~dp~~Rry~YpF~nCt~CGPr~~i~~~lpydr~~t~m~~f~~C~~C~~ey~~-p~~r-----------r  135 (711)
T TIGR00143        68 VATCSDCLEEMLDKNDRRYLYPFISCTHCGPRFTIIEALPYDRENTSMADFPLCPDCAKEYKD-PLDR-----------R  135 (711)
T ss_pred             hhhHHHHHHHhcCCCcccccCCcccccCCCCCeEEeecCCCCCCCcCCCCCcCCHHHHHHhcC-Cccc-----------c
Confidence            35688887666554332   2   68888877664332  11      122 48888877766 4332           4


Q ss_pred             cCCCCCceecCccCccc
Q psy7453         141 TDPFRHKFVCYACDYFS  157 (200)
Q Consensus       141 ~h~~~k~~~C~~C~~~f  157 (200)
                      .|.  .+-.|..||-..
T Consensus       136 ~h~--~~~~C~~Cgp~l  150 (711)
T TIGR00143       136 FHA--QPIACPRCGPQL  150 (711)
T ss_pred             CCC--CCccCCCCCcEE
Confidence            443  256788888654


No 261
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=28.17  E-value=14  Score=18.74  Aligned_cols=9  Identities=33%  Similarity=0.748  Sum_probs=4.5

Q ss_pred             ccccChhhh
Q psy7453         113 FCIYCKAVL  121 (200)
Q Consensus       113 ~C~~C~~~f  121 (200)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344555555


No 262
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=27.69  E-value=22  Score=20.62  Aligned_cols=14  Identities=21%  Similarity=0.472  Sum_probs=8.0

Q ss_pred             CCcccccCcccccC
Q psy7453         174 KPYACGQCAFRSAS  187 (200)
Q Consensus       174 k~~~C~~C~k~f~~  187 (200)
                      +.+.|..||..|..
T Consensus         3 k~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    3 KTLTCKDCGAEFVF   16 (49)
T ss_pred             eeEEcccCCCeEEE
Confidence            45566666665543


No 263
>PRK07591 threonine synthase; Validated
Probab=27.68  E-value=29  Score=29.71  Aligned_cols=27  Identities=15%  Similarity=0.436  Sum_probs=19.4

Q ss_pred             CcccccccccccccccccccccccCccc
Q psy7453          76 HSLCKHCHSQLSHLDLLDHCKTCSYMIR  103 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~~l~~C~~C~~~f~  103 (200)
                      -+.|..||+.|..... +.|+.||-.+.
T Consensus        18 ~l~C~~Cg~~~~~~~~-~~C~~cg~~l~   44 (421)
T PRK07591         18 ALKCRECGAEYPLGPI-HVCEECFGPLE   44 (421)
T ss_pred             EEEeCCCCCcCCCCCC-ccCCCCCCeEE
Confidence            3778888888876544 78888875443


No 264
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=27.47  E-value=19  Score=19.88  Aligned_cols=11  Identities=27%  Similarity=0.739  Sum_probs=5.8

Q ss_pred             CcccccChhhh
Q psy7453         111 SPFCIYCKAVL  121 (200)
Q Consensus       111 ~~~C~~C~~~f  121 (200)
                      +-.|+.|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            44555555544


No 265
>PRK04351 hypothetical protein; Provisional
Probab=27.40  E-value=27  Score=25.40  Aligned_cols=33  Identities=15%  Similarity=0.219  Sum_probs=18.0

Q ss_pred             CCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccC
Q psy7453         110 FSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSY  158 (200)
Q Consensus       110 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~  158 (200)
                      -.|.|..||..+.+              . +.+. ...|.|..|+-.+.
T Consensus       111 y~Y~C~~Cg~~~~r--------------~-Rr~n-~~~yrCg~C~g~L~  143 (149)
T PRK04351        111 YLYECQSCGQQYLR--------------K-RRIN-TKRYRCGKCRGKLK  143 (149)
T ss_pred             EEEECCCCCCEeee--------------e-eecC-CCcEEeCCCCcEee
Confidence            35667777755544              2 2221 24577777765543


No 266
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=27.38  E-value=35  Score=21.93  Aligned_cols=26  Identities=23%  Similarity=0.433  Sum_probs=15.6

Q ss_pred             ccccccc-cccccccc--ccccccccCcc
Q psy7453          77 SLCKHCH-SQLSHLDL--LDHCKTCSYMI  102 (200)
Q Consensus        77 ~~C~~C~-~~f~~~~~--l~~C~~C~~~f  102 (200)
                      |.|+-|| .+|.....  ...|++|.-..
T Consensus         2 ~~CPCCg~~Tl~~~~~~~ydIC~VC~WEd   30 (78)
T PF14206_consen    2 YPCPCCGYYTLEERGEGTYDICPVCFWED   30 (78)
T ss_pred             ccCCCCCcEEeccCCCcCceECCCCCccc
Confidence            5688887 44444443  55677776443


No 267
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=27.30  E-value=31  Score=20.05  Aligned_cols=9  Identities=22%  Similarity=0.209  Sum_probs=4.0

Q ss_pred             CcccccChh
Q psy7453         111 SPFCIYCKA  119 (200)
Q Consensus       111 ~~~C~~C~~  119 (200)
                      .+.|.-||.
T Consensus        37 R~~CGkCgy   45 (51)
T COG1998          37 RWACGKCGY   45 (51)
T ss_pred             eeEeccccc
Confidence            344444443


No 268
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=27.25  E-value=28  Score=25.08  Aligned_cols=12  Identities=17%  Similarity=0.179  Sum_probs=5.8

Q ss_pred             cccccChhhhcc
Q psy7453         112 PFCIYCKAVLST  123 (200)
Q Consensus       112 ~~C~~C~~~f~~  123 (200)
                      +.|+.||+.|-.
T Consensus       125 ~~C~~C~kiyW~  136 (147)
T PF01927_consen  125 WRCPGCGKIYWE  136 (147)
T ss_pred             EECCCCCCEecc
Confidence            445555555443


No 269
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=26.39  E-value=21  Score=18.93  Aligned_cols=7  Identities=57%  Similarity=1.322  Sum_probs=2.9

Q ss_pred             eecCccC
Q psy7453         148 FVCYACD  154 (200)
Q Consensus       148 ~~C~~C~  154 (200)
                      +.|+.||
T Consensus        23 ~vC~~Cg   29 (34)
T PF14803_consen   23 LVCPACG   29 (34)
T ss_dssp             EEETTTT
T ss_pred             eECCCCC
Confidence            3344443


No 270
>KOG3002|consensus
Probab=26.32  E-value=36  Score=27.84  Aligned_cols=61  Identities=13%  Similarity=0.138  Sum_probs=36.1

Q ss_pred             CCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecC----ccCcccCChHHHHHHHHHcCCCCCcccccC
Q psy7453         109 TFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCY----ACDYFSYNIGCMRSHIRTHTGEKPYACGQC  181 (200)
Q Consensus       109 ~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~----~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C  181 (200)
                      +++.+|+.|...+.. ...+.--        ++ ...-.+.|+    -|.+.|..... ..|.+.-.. .||.|+.-
T Consensus        78 ~~~~~CP~Cr~~~g~-~R~~amE--------kV-~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~~~CP~p  142 (299)
T KOG3002|consen   78 KVSNKCPTCRLPIGN-IRCRAME--------KV-AEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RPCSCPVP  142 (299)
T ss_pred             hhcccCCcccccccc-HHHHHHH--------HH-HHhceecccccccCCceeeccccc-ccccccccc-CCcCCCCC
Confidence            567788888888876 5444422        22 222345565    37777776655 456554443 67777654


No 271
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=26.32  E-value=37  Score=27.46  Aligned_cols=24  Identities=25%  Similarity=0.759  Sum_probs=13.9

Q ss_pred             cccccccCcccCCCCCCCCcccccChhhh
Q psy7453          93 DHCKTCSYMIRPNANNTFSPFCIYCKAVL  121 (200)
Q Consensus        93 ~~C~~C~~~f~~~~~~~~~~~C~~C~~~f  121 (200)
                      |.|+.|--.|-.     .|-.|+.||-.|
T Consensus       256 yvCs~Clsi~C~-----~p~~C~~Cgt~f  279 (279)
T TIGR00627       256 FVCSVCLSVLCQ-----YTPICKTCKTAF  279 (279)
T ss_pred             EECCCccCCcCC-----CCCCCCCCCCCC
Confidence            456666655532     234777777654


No 272
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=26.19  E-value=42  Score=24.83  Aligned_cols=12  Identities=17%  Similarity=0.290  Sum_probs=5.8

Q ss_pred             cccccChhhhcc
Q psy7453         112 PFCIYCKAVLST  123 (200)
Q Consensus       112 ~~C~~C~~~f~~  123 (200)
                      +.|+.||+.|--
T Consensus       131 ~~C~~CgkiYW~  142 (165)
T COG1656         131 YRCPKCGKIYWK  142 (165)
T ss_pred             eECCCCcccccC
Confidence            345555555443


No 273
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=25.96  E-value=32  Score=29.94  Aligned_cols=28  Identities=21%  Similarity=0.348  Sum_probs=22.9

Q ss_pred             CcccccChhhhccCHHHHHhchhhhhhhhhcCCCC
Q psy7453         111 SPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFR  145 (200)
Q Consensus       111 ~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~  145 (200)
                      -+.|+.|.+.|.. ...+..|      +...|.+.
T Consensus        57 FWiCp~CskkF~d-~~~~~~H------~~~eH~~~   84 (466)
T PF04780_consen   57 FWICPRCSKKFSD-AESCLSH------MEQEHPAG   84 (466)
T ss_pred             EeeCCcccceeCC-HHHHHHH------HHHhhhhh
Confidence            3579999999999 9999999      86677653


No 274
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=25.81  E-value=16  Score=20.85  Aligned_cols=6  Identities=17%  Similarity=0.589  Sum_probs=3.1

Q ss_pred             Chhhhc
Q psy7453         117 CKAVLS  122 (200)
Q Consensus       117 C~~~f~  122 (200)
                      ||..|.
T Consensus        33 Cg~tfv   38 (47)
T PF04606_consen   33 CGHTFV   38 (47)
T ss_pred             CCCEEE
Confidence            555554


No 275
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=25.70  E-value=57  Score=28.46  Aligned_cols=27  Identities=19%  Similarity=0.342  Sum_probs=23.4

Q ss_pred             ceecCccCcccCChHHHHHHHHH-cCCC
Q psy7453         147 KFVCYACDYFSYNIGCMRSHIRT-HTGE  173 (200)
Q Consensus       147 ~~~C~~C~~~f~~~~~l~~H~~~-H~~~  173 (200)
                      -+.|+.|.+.|.....+..|+.. |.+.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            47999999999999999999874 7654


No 276
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=25.53  E-value=17  Score=27.70  Aligned_cols=16  Identities=19%  Similarity=0.281  Sum_probs=11.1

Q ss_pred             CCcccccccccccccc
Q psy7453          75 NHSLCKHCHSQLSHLD   90 (200)
Q Consensus        75 ~~~~C~~C~~~f~~~~   90 (200)
                      -||.|.+|.+.|.++-
T Consensus       195 IPF~C~iCKkdy~spv  210 (259)
T COG5152         195 IPFLCGICKKDYESPV  210 (259)
T ss_pred             Cceeehhchhhccchh
Confidence            3778888877776653


No 277
>KOG2636|consensus
Probab=25.49  E-value=50  Score=28.49  Aligned_cols=29  Identities=17%  Similarity=0.449  Sum_probs=23.2

Q ss_pred             HHcCCCCCcccccCc-ccccCHHHHHHHHh
Q psy7453         168 RTHTGEKPYACGQCA-FRSASVAGLHYHLK  196 (200)
Q Consensus       168 ~~H~~~k~~~C~~C~-k~f~~~~~L~~H~~  196 (200)
                      +.|-=...|.|.+|| ++|.-+..+.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            345556789999999 89998889988854


No 278
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=25.40  E-value=21  Score=29.52  Aligned_cols=29  Identities=14%  Similarity=0.332  Sum_probs=19.9

Q ss_pred             ccccccCcccCCCCCCCCcccccChhhhc
Q psy7453          94 HCKTCSYMIRPNANNTFSPFCIYCKAVLS  122 (200)
Q Consensus        94 ~C~~C~~~f~~~~~~~~~~~C~~C~~~f~  122 (200)
                      .|..|...|.-.......+.|+.||..+.
T Consensus       248 AC~rC~t~y~le~A~~~~wrCpkCGg~ik  276 (403)
T COG1379         248 ACSRCYTRYSLEEAKSLRWRCPKCGGKIK  276 (403)
T ss_pred             HHHHhhhccCcchhhhhcccCcccccchh
Confidence            57777777766555556677888877654


No 279
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=24.97  E-value=48  Score=19.75  Aligned_cols=13  Identities=8%  Similarity=-0.036  Sum_probs=4.8

Q ss_pred             CCcccccChhhhc
Q psy7453         110 FSPFCIYCKAVLS  122 (200)
Q Consensus       110 ~~~~C~~C~~~f~  122 (200)
                      .|++...|+..|.
T Consensus        23 ~PV~s~~C~H~fe   35 (57)
T PF11789_consen   23 DPVKSKKCGHTFE   35 (57)
T ss_dssp             SEEEESSS--EEE
T ss_pred             CCcCcCCCCCeec
Confidence            3444444444443


No 280
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=24.88  E-value=42  Score=17.98  Aligned_cols=24  Identities=25%  Similarity=0.413  Sum_probs=12.3

Q ss_pred             cccccccccccc-cccccccccccC
Q psy7453          77 SLCKHCHSQLSH-LDLLDHCKTCSY  100 (200)
Q Consensus        77 ~~C~~C~~~f~~-~~~l~~C~~C~~  100 (200)
                      ..|++|+..+.. ..-++-|..||.
T Consensus         9 ~~C~~C~~~~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGSRWFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCCeEeEccCCEEEhhhCce
Confidence            457777654332 233445555553


No 281
>KOG2071|consensus
Probab=24.53  E-value=41  Score=29.99  Aligned_cols=28  Identities=14%  Similarity=0.194  Sum_probs=22.1

Q ss_pred             CCceecCccCcccCChHHHHHHHHHcCC
Q psy7453         145 RHKFVCYACDYFSYNIGCMRSHIRTHTG  172 (200)
Q Consensus       145 ~k~~~C~~C~~~f~~~~~l~~H~~~H~~  172 (200)
                      ..|-.|..||..|.+......|+..|..
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhh
Confidence            4567899999999888888888777754


No 282
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=23.73  E-value=11  Score=20.32  Aligned_cols=30  Identities=20%  Similarity=0.619  Sum_probs=15.1

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCCCcccccC
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQC  181 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C  181 (200)
                      ..|+.|+..=    .+.+|=....|...|.|..|
T Consensus         6 v~CP~C~s~~----~v~k~G~~~~G~qryrC~~C   35 (36)
T PF03811_consen    6 VHCPRCQSTE----GVKKNGKSPSGHQRYRCKDC   35 (36)
T ss_pred             eeCCCCCCCC----cceeCCCCCCCCEeEecCcC
Confidence            3466664321    13344444455566777666


No 283
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=23.67  E-value=25  Score=22.71  Aligned_cols=10  Identities=20%  Similarity=0.511  Sum_probs=3.3

Q ss_pred             CCCccccccc
Q psy7453          74 QNHSLCKHCH   83 (200)
Q Consensus        74 ~~~~~C~~C~   83 (200)
                      .+.|.|+.|+
T Consensus        20 ~~~F~CPfC~   29 (81)
T PF05129_consen   20 PKVFDCPFCN   29 (81)
T ss_dssp             SS----TTT-
T ss_pred             CceEcCCcCC
Confidence            3457788877


No 284
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=23.62  E-value=40  Score=22.28  Aligned_cols=28  Identities=14%  Similarity=0.356  Sum_probs=15.4

Q ss_pred             Ccccccccccccccc--cccccccccCccc
Q psy7453          76 HSLCKHCHSQLSHLD--LLDHCKTCSYMIR  103 (200)
Q Consensus        76 ~~~C~~C~~~f~~~~--~l~~C~~C~~~f~  103 (200)
                      .|.|+.|++.-....  -+-.|..|++.|.
T Consensus        36 ~y~CpfCgk~~vkR~a~GIW~C~~C~~~~A   65 (90)
T PRK03976         36 KHVCPVCGRPKVKRVGTGIWECRKCGAKFA   65 (90)
T ss_pred             CccCCCCCCCceEEEEEEEEEcCCCCCEEe
Confidence            578888865422221  2335666665554


No 285
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=23.28  E-value=18  Score=19.52  Aligned_cols=10  Identities=20%  Similarity=0.876  Sum_probs=3.1

Q ss_pred             cccccccCcc
Q psy7453          93 DHCKTCSYMI  102 (200)
Q Consensus        93 ~~C~~C~~~f  102 (200)
                      |+|..||...
T Consensus         7 YkC~~CGniV   16 (36)
T PF06397_consen    7 YKCEHCGNIV   16 (36)
T ss_dssp             EE-TTT--EE
T ss_pred             EEccCCCCEE
Confidence            4444444443


No 286
>KOG2906|consensus
Probab=23.11  E-value=31  Score=23.13  Aligned_cols=29  Identities=24%  Similarity=0.493  Sum_probs=16.9

Q ss_pred             cccccCcccCCCCCC-CCcccccChhhhcc
Q psy7453          95 CKTCSYMIRPNANNT-FSPFCIYCKAVLST  123 (200)
Q Consensus        95 C~~C~~~f~~~~~~~-~~~~C~~C~~~f~~  123 (200)
                      ||.||-...-...+. ..|.|..|+..|.-
T Consensus         4 CP~Cgn~Live~g~~~~rf~C~tCpY~~~I   33 (105)
T KOG2906|consen    4 CPTCGNMLIVESGESCNRFSCRTCPYVFPI   33 (105)
T ss_pred             cCCCCCEEEEecCCeEeeEEcCCCCceeeE
Confidence            555555544333333 45778888877765


No 287
>KOG1842|consensus
Probab=23.04  E-value=46  Score=28.72  Aligned_cols=29  Identities=21%  Similarity=0.208  Sum_probs=23.6

Q ss_pred             CCcccccChhhhccCHHHHHhchhhhhhhhhcCCCC
Q psy7453         110 FSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFR  145 (200)
Q Consensus       110 ~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~  145 (200)
                      ..|.|++|.+-|.. .+.|..|      ....|.++
T Consensus        14 egflCPiC~~dl~~-~~~L~~H------~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPN-LSALNDH------LDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhh-HHHHHHH------Hhhhcccc
Confidence            46889999999999 9999999      65666654


No 288
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.03  E-value=44  Score=20.32  Aligned_cols=10  Identities=20%  Similarity=0.800  Sum_probs=5.1

Q ss_pred             ceecCccCcc
Q psy7453         147 KFVCYACDYF  156 (200)
Q Consensus       147 ~~~C~~C~~~  156 (200)
                      .|-|+.|...
T Consensus        31 tymC~eC~~R   40 (68)
T COG4896          31 TYMCPECEHR   40 (68)
T ss_pred             eEechhhHhh
Confidence            3556655433


No 289
>PTZ00448 hypothetical protein; Provisional
Probab=22.95  E-value=59  Score=27.35  Aligned_cols=23  Identities=13%  Similarity=0.402  Sum_probs=19.0

Q ss_pred             CcccccCcccccCHHHHHHHHhh
Q psy7453         175 PYACGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       175 ~~~C~~C~k~f~~~~~L~~H~~~  197 (200)
                      .|.|..|+-.|......+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57888888888888888888875


No 290
>KOG1842|consensus
Probab=22.53  E-value=49  Score=28.53  Aligned_cols=28  Identities=25%  Similarity=0.473  Sum_probs=23.7

Q ss_pred             CceecCccCcccCChHHHHHHHHH-cCCC
Q psy7453         146 HKFVCYACDYFSYNIGCMRSHIRT-HTGE  173 (200)
Q Consensus       146 k~~~C~~C~~~f~~~~~l~~H~~~-H~~~  173 (200)
                      .-|.|++|...|.+...|..|.-. |.++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            358999999999999999999865 6543


No 291
>PF07227 DUF1423:  Protein of unknown function (DUF1423);  InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp []. Amongst the gene products is a well-conserved family of 130.7kDa proteins that share no sequence similarity with any other known proteins, other than in plants. The sequences are characterised by an N-terminal domain of variable length, a central cysteine-rich region and a relatively acidic C-terminal domain. The sequences may possess a PHD finger.
Probab=22.31  E-value=75  Score=27.47  Aligned_cols=74  Identities=26%  Similarity=0.335  Sum_probs=46.6

Q ss_pred             cccccc--ccccccccccccccccCcccCCCCCCCCcccccChhhhccCHHHHHhchhhhhhhhhcC--------CCCCc
Q psy7453          78 LCKHCH--SQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTD--------PFRHK  147 (200)
Q Consensus        78 ~C~~C~--~~f~~~~~l~~C~~C~~~f~~~~~~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h--------~~~k~  147 (200)
                      .|.+|.  .+|-+.   --|.+|.+ |....++-.-..|+.||.+... .-.|+..      +.++-        +.+..
T Consensus       115 ~C~iC~~~~gFC~~---C~C~iC~k-fD~~~n~~~Wi~Cd~CgH~cH~-dCALr~~------~i~~G~s~~g~~g~~d~~  183 (446)
T PF07227_consen  115 DCKICCSEPGFCRR---CMCCICSK-FDDNKNTCSWIGCDVCGHWCHL-DCALRHE------LIGTGPSVKGSIGTLDMQ  183 (446)
T ss_pred             CcchhcCCCCcccc---CCccccCC-cccCCCCeeEEeccCCCceehh-hhhcccc------cccCCccCCCCCccCceE
Confidence            355553  344332   36888877 6665555555679999998888 7777766      42211        12557


Q ss_pred             eecCccCcccCChHH
Q psy7453         148 FVCYACDYFSYNIGC  162 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~  162 (200)
                      |.|.-||+.-.-.+.
T Consensus       184 f~C~~C~~~seLlG~  198 (446)
T PF07227_consen  184 FHCRACGKTSELLGF  198 (446)
T ss_pred             EEccCCCChhhHHHH
Confidence            999999876544333


No 292
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=22.27  E-value=60  Score=17.57  Aligned_cols=11  Identities=45%  Similarity=1.044  Sum_probs=3.7

Q ss_pred             CcccccChhhh
Q psy7453         111 SPFCIYCKAVL  121 (200)
Q Consensus       111 ~~~C~~C~~~f  121 (200)
                      .|-|+.|+..|
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            45666666666


No 293
>KOG2636|consensus
Probab=22.06  E-value=62  Score=27.97  Aligned_cols=27  Identities=15%  Similarity=0.392  Sum_probs=21.4

Q ss_pred             CCCCCceecCccC-cccCChHHHHHHHH
Q psy7453         142 DPFRHKFVCYACD-YFSYNIGCMRSHIR  168 (200)
Q Consensus       142 h~~~k~~~C~~C~-~~f~~~~~l~~H~~  168 (200)
                      |.-...|.|.+|| +++.....+.+|-.
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            3344569999999 88888899999954


No 294
>KOG2907|consensus
Probab=22.00  E-value=32  Score=23.69  Aligned_cols=12  Identities=25%  Similarity=1.018  Sum_probs=8.6

Q ss_pred             cccccCcccccC
Q psy7453         176 YACGQCAFRSAS  187 (200)
Q Consensus       176 ~~C~~C~k~f~~  187 (200)
                      |.|+.|++.|..
T Consensus       103 YTC~kC~~k~~e  114 (116)
T KOG2907|consen  103 YTCPKCKYKFTE  114 (116)
T ss_pred             EEcCccceeeec
Confidence            778777777654


No 295
>PRK12722 transcriptional activator FlhC; Provisional
Probab=21.90  E-value=65  Score=24.41  Aligned_cols=26  Identities=23%  Similarity=0.447  Sum_probs=15.0

Q ss_pred             ccccccCcccCCCC-CCCCcccccChh
Q psy7453          94 HCKTCSYMIRPNAN-NTFSPFCIYCKA  119 (200)
Q Consensus        94 ~C~~C~~~f~~~~~-~~~~~~C~~C~~  119 (200)
                      .|..||-.|..... ....|.|+.|.-
T Consensus       136 ~C~~Cgg~fv~~~~e~~~~f~CplC~~  162 (187)
T PRK12722        136 SCNCCGGHFVTHAHDPVGSFVCGLCQP  162 (187)
T ss_pred             cCCCCCCCeeccccccCCCCcCCCCCC
Confidence            56666666664332 234677777754


No 296
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=21.80  E-value=58  Score=21.94  Aligned_cols=7  Identities=29%  Similarity=0.895  Sum_probs=2.8

Q ss_pred             ecCccCc
Q psy7453         149 VCYACDY  155 (200)
Q Consensus       149 ~C~~C~~  155 (200)
                      .|..||.
T Consensus        44 ~C~~CG~   50 (99)
T PRK14892         44 TCGNCGL   50 (99)
T ss_pred             ECCCCCC
Confidence            3444443


No 297
>KOG0717|consensus
Probab=21.79  E-value=51  Score=28.63  Aligned_cols=20  Identities=25%  Similarity=0.292  Sum_probs=0.0

Q ss_pred             cccCcccccCHHHHHHHHhh
Q psy7453         178 CGQCAFRSASVAGLHYHLKK  197 (200)
Q Consensus       178 C~~C~k~f~~~~~L~~H~~~  197 (200)
                      |.+|.|+|.+...|.-|...
T Consensus       295 C~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  295 CVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             EeeccccccchHHHHhhHHH


No 298
>TIGR03844 cysteate_syn cysteate synthase. Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M.
Probab=21.73  E-value=45  Score=28.41  Aligned_cols=22  Identities=18%  Similarity=0.241  Sum_probs=16.1

Q ss_pred             ccccccccccccccccccccccc
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCS   99 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~   99 (200)
                      +.|..||+.|. ....+.|+.|+
T Consensus         3 l~C~~Cg~~~~-~~~~~~C~~c~   24 (398)
T TIGR03844         3 LRCPGCGEVLP-DHYTLSCPLDC   24 (398)
T ss_pred             EEeCCCCCccC-CccccCCCCCC
Confidence            57888888887 44457787776


No 299
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.47  E-value=46  Score=26.91  Aligned_cols=25  Identities=20%  Similarity=0.615  Sum_probs=18.2

Q ss_pred             eecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccC
Q psy7453         148 FVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSAS  187 (200)
Q Consensus       148 ~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~  187 (200)
                      -.|+.||.               ...+.|.|+.||..+..
T Consensus       310 ~~C~~cg~---------------~~~r~~~C~~cg~~~~r  334 (364)
T COG0675         310 KTCPCCGH---------------LSGRLFKCPRCGFVHDR  334 (364)
T ss_pred             ccccccCC---------------ccceeEECCCCCCeehh
Confidence            36888987               22467999999987644


No 300
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=21.34  E-value=43  Score=23.81  Aligned_cols=28  Identities=25%  Similarity=0.450  Sum_probs=16.0

Q ss_pred             cccccccccccccccccccccccCcccC
Q psy7453          77 SLCKHCHSQLSHLDLLDHCKTCSYMIRP  104 (200)
Q Consensus        77 ~~C~~C~~~f~~~~~l~~C~~C~~~f~~  104 (200)
                      ..|+.||.....+..-.-||+||+.+..
T Consensus        29 ~hCp~Cg~PLF~KdG~v~CPvC~~~~~~   56 (131)
T COG1645          29 KHCPKCGTPLFRKDGEVFCPVCGYREVV   56 (131)
T ss_pred             hhCcccCCcceeeCCeEECCCCCceEEE
Confidence            4577777654444444457777754443


No 301
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=21.18  E-value=32  Score=23.30  Aligned_cols=13  Identities=23%  Similarity=0.521  Sum_probs=7.5

Q ss_pred             CCcccccChhhhc
Q psy7453         110 FSPFCIYCKAVLS  122 (200)
Q Consensus       110 ~~~~C~~C~~~f~  122 (200)
                      ||-.|+.||..-.
T Consensus         1 ~p~~CpYCg~~~~   13 (102)
T PF11672_consen    1 KPIICPYCGGPAE   13 (102)
T ss_pred             CCcccCCCCCeeE
Confidence            3556777765443


No 302
>KOG0957|consensus
Probab=20.85  E-value=42  Score=29.44  Aligned_cols=48  Identities=23%  Similarity=0.445  Sum_probs=32.1

Q ss_pred             CCcccccccccccccccccccccccCcccCCCC-----------CCCCcccccChhhhcc
Q psy7453          75 NHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNAN-----------NTFSPFCIYCKAVLST  123 (200)
Q Consensus        75 ~~~~C~~C~~~f~~~~~l~~C~~C~~~f~~~~~-----------~~~~~~C~~C~~~f~~  123 (200)
                      ..|.|.+|.+.-.. ..|.+|++|...|.-.-.           ...-|+|.+|++.-++
T Consensus       543 ~~ysCgiCkks~dQ-Hll~~CDtC~lhYHlGCL~PPLTR~Pkk~kn~gWqCsECdk~esS  601 (707)
T KOG0957|consen  543 MNYSCGICKKSTDQ-HLLTQCDTCHLHYHLGCLSPPLTRLPKKNKNFGWQCSECDKNESS  601 (707)
T ss_pred             cceeeeeeccchhh-HHHhhcchhhceeeccccCCccccCcccccCcceeecccccccCc
Confidence            36999999886443 456789999877653211           2334789999766544


No 303
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=20.74  E-value=80  Score=24.10  Aligned_cols=30  Identities=17%  Similarity=0.425  Sum_probs=14.8

Q ss_pred             CCcccccccc---cccccc-cccccccccCcccC
Q psy7453          75 NHSLCKHCHS---QLSHLD-LLDHCKTCSYMIRP  104 (200)
Q Consensus        75 ~~~~C~~C~~---~f~~~~-~l~~C~~C~~~f~~  104 (200)
                      +-|.|+.|+.   .|.... ...+|+.|+..|..
T Consensus       151 kGfiCe~C~~~~~IfPF~~~~~~~C~~C~~v~H~  184 (202)
T PF13901_consen  151 KGFICEICNSDDIIFPFQIDTTVRCPKCKSVFHK  184 (202)
T ss_pred             CCCCCccCCCCCCCCCCCCCCeeeCCcCccccch
Confidence            4466766653   222222 33456666655554


No 304
>KOG3183|consensus
Probab=20.65  E-value=46  Score=26.17  Aligned_cols=28  Identities=11%  Similarity=0.081  Sum_probs=18.7

Q ss_pred             CCCcccccccccccccccccccccccCc
Q psy7453          74 QNHSLCKHCHSQLSHLDLLDHCKTCSYM  101 (200)
Q Consensus        74 ~~~~~C~~C~~~f~~~~~l~~C~~C~~~  101 (200)
                      --||.|+.|+..|-...-.|.=..|...
T Consensus        21 FLPf~Cd~C~~~FC~eHrsye~H~Cp~~   48 (250)
T KOG3183|consen   21 FLPFKCDGCSGIFCLEHRSYESHHCPKG   48 (250)
T ss_pred             ccceeeCCccchhhhccchHhhcCCCcc
Confidence            3589999999888877666543333333


Done!