Query         psy7454
Match_columns 103
No_of_seqs    115 out of 2006
Neff          11.2
Searched_HMMs 46136
Date          Fri Aug 16 18:44:38 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7454.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7454hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 9.1E-24   2E-28  123.6   5.5   87   10-99    159-245 (279)
  2 KOG2462|consensus               99.9 4.1E-24   9E-29  125.1   3.6   85    4-91    181-265 (279)
  3 KOG3623|consensus               99.7 2.4E-19 5.2E-24  116.5   1.2   80   10-90    892-971 (1007)
  4 KOG3576|consensus               99.7 7.1E-19 1.5E-23   99.6   0.5   87    9-96    114-200 (267)
  5 KOG1074|consensus               99.7 2.9E-17 6.2E-22  108.1   3.7   58   42-100   881-938 (958)
  6 KOG1074|consensus               99.6 1.2E-16 2.7E-21  105.2   1.9   56   42-98    607-662 (958)
  7 KOG3576|consensus               99.6 1.5E-16 3.2E-21   90.3   1.7   95    3-97    136-240 (267)
  8 KOG3623|consensus               99.6 5.4E-16 1.2E-20  101.3   1.9   80   11-91    239-331 (1007)
  9 PHA00733 hypothetical protein   99.4 2.8E-13 6.1E-18   73.2   3.6   82   10-94     38-124 (128)
 10 KOG3608|consensus               99.4 3.4E-13 7.3E-18   82.3   4.2   95    3-98    198-320 (467)
 11 PHA02768 hypothetical protein;  99.2 4.6E-12 9.9E-17   58.1   1.7   43   12-56      5-47  (55)
 12 KOG3608|consensus               99.2 3.3E-11 7.1E-16   73.9   4.1   89    4-93    284-376 (467)
 13 PHA02768 hypothetical protein;  99.1   3E-11 6.5E-16   55.4   1.9   43   40-85      5-47  (55)
 14 PLN03086 PRLI-interacting fact  99.0 1.3E-09 2.8E-14   71.2   6.7   83   10-99    451-543 (567)
 15 PHA00733 hypothetical protein   99.0 7.1E-10 1.5E-14   60.1   4.6   51    8-60     69-119 (128)
 16 PF13465 zf-H2C2_2:  Zinc-finge  99.0 5.3E-10 1.2E-14   44.2   2.2   23   28-50      2-24  (26)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.9 2.8E-09 6.1E-14   42.1   2.5   26   55-81      1-26  (26)
 18 PHA00616 hypothetical protein   98.9 1.4E-09 3.1E-14   47.7   1.7   31   69-99      1-31  (44)
 19 PLN03086 PRLI-interacting fact  98.8 7.7E-09 1.7E-13   67.7   5.3   78   11-93    477-564 (567)
 20 KOG3993|consensus               98.8 5.4E-10 1.2E-14   69.9  -0.2   82   13-95    268-382 (500)
 21 PHA00616 hypothetical protein   98.8 1.7E-09 3.7E-14   47.4   0.7   34   12-45      1-34  (44)
 22 PF05605 zf-Di19:  Drought indu  98.5 3.6E-07 7.8E-12   42.3   4.6   50   41-93      3-53  (54)
 23 PHA00732 hypothetical protein   98.4 2.6E-07 5.6E-12   46.0   3.0   42   12-59      1-43  (79)
 24 PHA00732 hypothetical protein   98.4   3E-07 6.6E-12   45.8   2.9   46   40-92      1-47  (79)
 25 PF00096 zf-C2H2:  Zinc finger,  98.4 2.8E-07 6.1E-12   35.1   1.8   22   13-34      1-22  (23)
 26 PF00096 zf-C2H2:  Zinc finger,  98.4   4E-07 8.7E-12   34.7   2.2   23   70-92      1-23  (23)
 27 PF13894 zf-C2H2_4:  C2H2-type   98.2 2.4E-06 5.1E-11   32.6   2.6   24   70-93      1-24  (24)
 28 PF05605 zf-Di19:  Drought indu  98.1 7.1E-06 1.5E-10   38.0   3.9   46   12-60      2-49  (54)
 29 PF13912 zf-C2H2_6:  C2H2-type   98.1 3.5E-06 7.5E-11   33.3   2.1   25   12-36      1-25  (27)
 30 PF13912 zf-C2H2_6:  C2H2-type   98.1 3.4E-06 7.5E-11   33.3   2.0   25   69-93      1-25  (27)
 31 COG5189 SFP1 Putative transcri  98.0 2.4E-06 5.2E-11   52.4   1.0   53   38-90    347-419 (423)
 32 PF12756 zf-C2H2_2:  C2H2 type   98.0 7.9E-06 1.7E-10   42.2   2.8   73   14-92      1-73  (100)
 33 PF13894 zf-C2H2_4:  C2H2-type   98.0 7.7E-06 1.7E-10   31.1   2.0   23   13-35      1-23  (24)
 34 PF09237 GAGA:  GAGA factor;  I  97.9 2.7E-05 5.9E-10   35.1   3.2   26   12-37     24-49  (54)
 35 KOG3993|consensus               97.9   1E-05 2.2E-10   51.4   2.2   53   12-65    295-380 (500)
 36 COG5189 SFP1 Putative transcri  97.8 9.2E-06   2E-10   49.9   1.1   50   10-59    347-417 (423)
 37 PF09237 GAGA:  GAGA factor;  I  97.8   5E-05 1.1E-09   34.2   3.1   32   66-97     21-52  (54)
 38 smart00355 ZnF_C2H2 zinc finge  97.6 7.2E-05 1.6E-09   28.7   2.3   24   70-93      1-24  (26)
 39 PRK04860 hypothetical protein;  97.6 8.2E-05 1.8E-09   42.0   3.1   37   40-81    119-155 (160)
 40 smart00355 ZnF_C2H2 zinc finge  97.5 7.3E-05 1.6E-09   28.7   1.7   23   13-35      1-23  (26)
 41 PF12874 zf-met:  Zinc-finger o  97.5  0.0001 2.3E-09   28.3   1.8   22   13-34      1-22  (25)
 42 PF13909 zf-H2C2_5:  C2H2-type   97.3 0.00022 4.8E-09   27.2   1.9   23   70-93      1-23  (24)
 43 PRK04860 hypothetical protein;  97.3 0.00033 7.2E-09   39.6   3.1   38   11-52    118-155 (160)
 44 PF12874 zf-met:  Zinc-finger o  97.3 0.00024 5.3E-09   27.3   1.9   22   70-91      1-22  (25)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  97.1 0.00021 4.5E-09   28.1   0.7   22   13-34      2-23  (27)
 46 PF13909 zf-H2C2_5:  C2H2-type   96.8  0.0011 2.4E-08   25.1   1.6   21   13-34      1-21  (24)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00069 1.5E-08   26.6   0.2   22   70-91      2-23  (27)
 48 PF13913 zf-C2HC_2:  zinc-finge  96.2  0.0061 1.3E-07   23.5   1.9   19   71-90      4-22  (25)
 49 smart00451 ZnF_U1 U1-like zinc  96.0  0.0071 1.5E-07   25.0   1.9   23   12-34      3-25  (35)
 50 COG4049 Uncharacterized protei  95.8  0.0049 1.1E-07   28.4   1.0   30   64-93     12-41  (65)
 51 COG4049 Uncharacterized protei  95.6  0.0062 1.3E-07   28.0   0.9   28    6-33     11-38  (65)
 52 PF09538 FYDLN_acid:  Protein o  95.4   0.012 2.7E-07   31.1   1.8   30   13-53     10-39  (108)
 53 cd00350 rubredoxin_like Rubred  95.3   0.019 4.2E-07   23.6   1.9   10   13-22      2-11  (33)
 54 KOG1146|consensus               95.2  0.0098 2.1E-07   43.3   1.2   79    8-91    461-540 (1406)
 55 COG5048 FOG: Zn-finger [Genera  94.9  0.0067 1.5E-07   38.7  -0.2   58   40-98    289-352 (467)
 56 PF12756 zf-C2H2_2:  C2H2 type   94.7   0.049 1.1E-06   27.8   2.8   25   39-64     49-73  (100)
 57 COG5048 FOG: Zn-finger [Genera  94.7    0.01 2.2E-07   37.9   0.3   62   11-73    288-355 (467)
 58 TIGR00622 ssl1 transcription f  94.5   0.094   2E-06   27.9   3.6   80   11-93     14-105 (112)
 59 PF13719 zinc_ribbon_5:  zinc-r  94.1   0.079 1.7E-06   22.4   2.3   12   68-79     24-35  (37)
 60 KOG2186|consensus               94.1   0.036 7.7E-07   33.6   1.6   44   13-59      4-47  (276)
 61 PF09986 DUF2225:  Uncharacteri  94.0   0.019 4.1E-07   34.1   0.4   44   10-53      3-61  (214)
 62 TIGR02300 FYDLN_acid conserved  93.6   0.063 1.4E-06   29.1   1.9   32   13-55     10-41  (129)
 63 KOG2231|consensus               93.5    0.12 2.6E-06   35.7   3.4   77   23-100   125-213 (669)
 64 TIGR02098 MJ0042_CXXC MJ0042 f  93.4    0.12 2.6E-06   21.8   2.3   10   70-79     26-35  (38)
 65 COG2888 Predicted Zn-ribbon RN  93.2     0.1 2.2E-06   24.4   2.0   33   39-77     26-58  (61)
 66 PF13717 zinc_ribbon_4:  zinc-r  93.1    0.17 3.7E-06   21.2   2.5   12   42-53      4-15  (36)
 67 KOG2186|consensus               92.8   0.095 2.1E-06   31.8   2.0   54   41-98      4-57  (276)
 68 cd00729 rubredoxin_SM Rubredox  92.4    0.15 3.2E-06   21.1   1.8   11   12-22      2-12  (34)
 69 COG1592 Rubrerythrin [Energy p  92.1    0.13 2.7E-06   29.5   1.8   24   40-77    134-157 (166)
 70 TIGR02605 CxxC_CxxC_SSSS putat  92.1   0.072 1.6E-06   24.1   0.7   31   11-48      4-34  (52)
 71 smart00659 RPOLCX RNA polymera  92.0    0.22 4.8E-06   21.9   2.2   26   13-49      3-28  (44)
 72 PRK00398 rpoP DNA-directed RNA  91.9    0.22 4.7E-06   22.0   2.2   10   13-22      4-13  (46)
 73 KOG2893|consensus               91.7   0.059 1.3E-06   32.5   0.3   47   15-65     13-59  (341)
 74 TIGR00373 conserved hypothetic  91.2    0.17 3.8E-06   28.6   1.8   35   35-79    104-138 (158)
 75 smart00834 CxxC_CXXC_SSSS Puta  90.8    0.12 2.6E-06   22.0   0.7   30   12-48      5-34  (41)
 76 PRK14890 putative Zn-ribbon RN  90.6    0.31 6.7E-06   22.9   2.0   33   39-77     24-56  (59)
 77 PRK06266 transcription initiat  90.4    0.18 3.9E-06   29.2   1.4   33   37-79    114-146 (178)
 78 smart00531 TFIIE Transcription  90.4    0.72 1.6E-05   25.8   3.8   39   37-80     96-134 (147)
 79 PF09723 Zn-ribbon_8:  Zinc rib  89.8    0.21 4.5E-06   21.7   1.0   30   12-48      5-34  (42)
 80 PF05191 ADK_lid:  Adenylate ki  89.7    0.24 5.3E-06   20.8   1.2    9   14-22      3-11  (36)
 81 PF05443 ROS_MUCR:  ROS/MUCR tr  89.4    0.21 4.6E-06   27.5   1.1   28   67-97     70-97  (132)
 82 PHA00626 hypothetical protein   89.2    0.37   8E-06   22.3   1.6   15   38-52     21-35  (59)
 83 PF12013 DUF3505:  Protein of u  88.9    0.48   1E-05   25.0   2.3   26   69-94     80-109 (109)
 84 COG5236 Uncharacterized conser  88.5    0.72 1.6E-05   29.6   3.1   75   14-94    222-306 (493)
 85 PF02892 zf-BED:  BED zinc fing  87.9    0.58 1.3E-05   20.3   1.9   23   68-90     15-41  (45)
 86 PF08790 zf-LYAR:  LYAR-type C2  87.3    0.15 3.2E-06   20.2  -0.2    9   42-50      2-10  (28)
 87 COG4530 Uncharacterized protei  86.8    0.67 1.5E-05   24.6   1.9   26   14-50     11-36  (129)
 88 COG1996 RPC10 DNA-directed RNA  86.3    0.72 1.6E-05   20.8   1.6   11   12-22      6-16  (49)
 89 PF14353 CpXC:  CpXC protein     86.1    0.11 2.4E-06   28.2  -1.2   47   13-59      2-57  (128)
 90 PRK00464 nrdR transcriptional   85.9    0.19   4E-06   28.4  -0.4   15   41-55     29-43  (154)
 91 smart00614 ZnF_BED BED zinc fi  85.6     1.3 2.8E-05   19.9   2.4   21   70-90     19-44  (50)
 92 smart00734 ZnF_Rad18 Rad18-lik  85.1     1.1 2.4E-05   17.2   1.8   19   71-90      3-21  (26)
 93 KOG2593|consensus               84.6    0.91   2E-05   29.9   2.1   33   12-47    128-160 (436)
 94 KOG4173|consensus               83.7    0.32 6.9E-06   28.8  -0.1   78   13-93     80-170 (253)
 95 PF03604 DNA_RNApol_7kD:  DNA d  83.4     1.9 4.1E-05   17.6   2.2   10   13-22      1-10  (32)
 96 COG4957 Predicted transcriptio  83.3    0.77 1.7E-05   25.3   1.2   25   70-97     77-101 (148)
 97 PF08271 TF_Zn_Ribbon:  TFIIB z  82.6     1.2 2.5E-05   19.3   1.5   12   38-49     17-28  (43)
 98 KOG2893|consensus               82.6    0.29 6.4E-06   29.7  -0.5   41   43-88     13-53  (341)
 99 KOG4173|consensus               82.3    0.69 1.5E-05   27.5   0.9   50   39-92     78-129 (253)
100 PF13878 zf-C2H2_3:  zinc-finge  81.9     1.3 2.9E-05   19.1   1.5   24   13-36     14-39  (41)
101 PF08274 PhnA_Zn_Ribbon:  PhnA   81.8    0.94   2E-05   18.2   1.0    9   39-47     18-26  (30)
102 PF07754 DUF1610:  Domain of un  81.8    0.83 1.8E-05   17.4   0.8    9   12-20     16-24  (24)
103 PF02176 zf-TRAF:  TRAF-type zi  80.5     1.5 3.3E-05   20.2   1.6   34   11-45      8-43  (60)
104 KOG1280|consensus               80.4     2.3   5E-05   27.3   2.7   37   11-47     78-116 (381)
105 KOG4167|consensus               80.3    0.33 7.1E-06   34.0  -1.0   27   10-36    790-816 (907)
106 PF13451 zf-trcl:  Probable zin  80.1     1.6 3.5E-05   19.7   1.5   13   12-24      4-16  (49)
107 KOG1146|consensus               79.6    0.21 4.6E-06   37.0  -2.1   75   13-93   1261-1352(1406)
108 COG1655 Uncharacterized protei  79.5     0.4 8.7E-06   28.9  -0.7   25   10-34     17-41  (267)
109 KOG2785|consensus               79.3     2.3   5E-05   27.7   2.5   80   12-91      3-90  (390)
110 COG1997 RPL43A Ribosomal prote  79.2     1.1 2.4E-05   22.8   0.9   32   38-80     33-64  (89)
111 KOG3408|consensus               79.0     1.3 2.9E-05   24.0   1.2   26    9-34     54-79  (129)
112 PF10571 UPF0547:  Uncharacteri  78.7     1.1 2.4E-05   17.3   0.7   11   13-23     15-25  (26)
113 PF12013 DUF3505:  Protein of u  77.8     2.5 5.3E-05   22.3   2.1   24   12-35     80-107 (109)
114 PF15269 zf-C2H2_7:  Zinc-finge  77.8     4.6  0.0001   17.8   2.5   23   12-34     20-42  (54)
115 COG3091 SprT Zn-dependent meta  77.6       2 4.4E-05   24.3   1.7   33   39-77    116-148 (156)
116 COG1198 PriA Primosomal protei  77.1       2 4.3E-05   30.5   1.9   34   13-47    436-469 (730)
117 PF06524 NOA36:  NOA36 protein;  77.0       2 4.4E-05   26.6   1.7   81    9-91    139-231 (314)
118 PRK03824 hypA hydrogenase nick  76.9     1.5 3.3E-05   24.2   1.2   13   12-24     70-82  (135)
119 PF04959 ARS2:  Arsenite-resist  76.2     2.3   5E-05   25.5   1.8   26   39-64     76-101 (214)
120 KOG2593|consensus               76.0     3.8 8.2E-05   27.2   2.8   38   36-77    124-161 (436)
121 TIGR01206 lysW lysine biosynth  75.4     2.9 6.2E-05   19.3   1.6   10   13-22      3-12  (54)
122 KOG4167|consensus               74.5    0.68 1.5E-05   32.6  -0.7   25   69-93    792-816 (907)
123 PRK09678 DNA-binding transcrip  74.1     1.4 3.1E-05   21.6   0.5   42   13-56      2-45  (72)
124 KOG2785|consensus               73.6     5.8 0.00013   25.9   3.2   50   41-91    167-242 (390)
125 PF04959 ARS2:  Arsenite-resist  73.1     1.9 4.2E-05   25.8   1.0   29   67-95     75-103 (214)
126 PF01780 Ribosomal_L37ae:  Ribo  72.5    0.91   2E-05   23.3  -0.4   31   39-80     34-64  (90)
127 PF10013 DUF2256:  Uncharacteri  71.9     1.5 3.3E-05   19.1   0.3   14   71-84     10-23  (42)
128 COG4888 Uncharacterized Zn rib  71.4     1.1 2.3E-05   23.5  -0.3   37   12-52     22-58  (104)
129 TIGR00100 hypA hydrogenase nic  71.4     3.1 6.8E-05   22.3   1.5   10   13-22     71-80  (115)
130 PTZ00255 60S ribosomal protein  71.1     1.9 4.1E-05   22.2   0.6   32   38-80     34-65  (90)
131 smart00440 ZnF_C2C2 C2C2 Zinc   70.3    0.93   2E-05   19.4  -0.6    8   41-48     29-36  (40)
132 PRK12380 hydrogenase nickel in  69.1     4.1 8.8E-05   21.8   1.6   10   13-22     71-80  (113)
133 COG2331 Uncharacterized protei  68.5     2.9 6.3E-05   20.7   0.9   33   10-49     10-42  (82)
134 TIGR00280 L37a ribosomal prote  68.4     1.9 4.2E-05   22.2   0.3   32   38-80     33-64  (91)
135 smart00154 ZnF_AN1 AN1-like Zi  68.4     3.3 7.1E-05   17.6   0.9   13   12-24     12-24  (39)
136 COG3357 Predicted transcriptio  68.1     3.5 7.6E-05   21.2   1.1   14   39-52     57-70  (97)
137 COG4391 Uncharacterized protei  67.7       2 4.3E-05   20.4   0.2   45   31-80     15-59  (62)
138 PF07295 DUF1451:  Protein of u  67.7       4 8.7E-05   23.0   1.4    8   41-48    113-120 (146)
139 PRK00432 30S ribosomal protein  67.2     4.9 0.00011   18.2   1.4   10   69-78     37-46  (50)
140 PF13453 zf-TFIIB:  Transcripti  66.5     4.8  0.0001   17.1   1.3   18   40-57     19-36  (41)
141 KOG2482|consensus               66.1       4 8.7E-05   26.4   1.3   23   69-91    195-217 (423)
142 COG1773 Rubredoxin [Energy pro  65.8     3.6 7.8E-05   19.1   0.8   13   69-81      3-15  (55)
143 PF04423 Rad50_zn_hook:  Rad50   64.9     3.1 6.8E-05   18.9   0.6   11   14-24     22-32  (54)
144 COG4896 Uncharacterized protei  64.2     5.8 0.00013   18.8   1.4   40   14-53      4-44  (68)
145 PRK03976 rpl37ae 50S ribosomal  63.6     2.6 5.7E-05   21.6   0.2   32   38-80     34-65  (90)
146 KOG2807|consensus               63.1      11 0.00024   24.3   2.8   26   68-93    344-369 (378)
147 PF07282 OrfB_Zn_ribbon:  Putat  62.9     7.5 0.00016   18.5   1.7   15   67-81     44-58  (69)
148 PF01428 zf-AN1:  AN1-like Zinc  62.3     4.1 8.9E-05   17.6   0.7   14   11-24     12-25  (43)
149 COG3364 Zn-ribbon containing p  62.3     6.5 0.00014   20.7   1.5   13   12-24      2-14  (112)
150 PF01155 HypA:  Hydrogenase exp  62.0     5.2 0.00011   21.4   1.1   11   13-23     71-81  (113)
151 KOG1280|consensus               61.8       9 0.00019   24.9   2.3   25   41-65     80-104 (381)
152 PRK00564 hypA hydrogenase nick  61.3     5.6 0.00012   21.4   1.2   10   13-22     72-81  (117)
153 PRK04351 hypothetical protein;  61.2     7.9 0.00017   21.9   1.8   33   40-81    112-144 (149)
154 TIGR00595 priA primosomal prot  60.0     6.9 0.00015   26.6   1.7   13   35-47    235-247 (505)
155 PF03811 Zn_Tnp_IS1:  InsA N-te  59.9     3.8 8.3E-05   17.2   0.3   14   33-46     22-35  (36)
156 PF13824 zf-Mss51:  Zinc-finger  59.7       8 0.00017   18.0   1.4   11   38-48     12-22  (55)
157 COG5151 SSL1 RNA polymerase II  59.6       5 0.00011   25.6   0.9   49   42-93    364-412 (421)
158 PF04810 zf-Sec23_Sec24:  Sec23  59.4     2.9 6.4E-05   17.8  -0.0   12   67-78     22-33  (40)
159 PRK14873 primosome assembly pr  58.9      14  0.0003   26.3   3.0   13   35-47    405-417 (665)
160 PF04780 DUF629:  Protein of un  58.8     9.7 0.00021   25.8   2.2   26   68-93     56-81  (466)
161 PF07975 C1_4:  TFIIH C1-like d  58.0     2.2 4.7E-05   19.5  -0.6   24   69-92     21-44  (51)
162 PLN02294 cytochrome c oxidase   57.8     6.7 0.00014   22.7   1.2   15   67-81    139-153 (174)
163 PF15135 UPF0515:  Uncharacteri  55.9      15 0.00032   22.8   2.4   11   10-20    110-120 (278)
164 cd00924 Cyt_c_Oxidase_Vb Cytoc  55.6     8.3 0.00018   20.1   1.2   18   62-80     73-90  (97)
165 cd00730 rubredoxin Rubredoxin;  55.3     6.3 0.00014   17.9   0.7   12   70-81      2-13  (50)
166 COG1998 RPS31 Ribosomal protei  55.0      15 0.00032   16.7   1.8    9   69-77     37-45  (51)
167 PRK03681 hypA hydrogenase nick  54.9     6.8 0.00015   21.0   0.9    7   42-48     72-78  (114)
168 PF10263 SprT-like:  SprT-like   54.1     6.8 0.00015   21.9   0.8   32   40-80    123-154 (157)
169 KOG0227|consensus               53.9     7.6 0.00017   23.0   1.0   28    3-32     46-73  (222)
170 PF10276 zf-CHCC:  Zinc-finger   53.5       7 0.00015   16.8   0.6   11   69-79     29-39  (40)
171 COG1675 TFA1 Transcription ini  53.5      12 0.00025   21.9   1.7   32   36-77    109-140 (176)
172 PF14787 zf-CCHC_5:  GAG-polypr  53.4     6.1 0.00013   16.6   0.4   15   71-85      4-18  (36)
173 COG0068 HypF Hydrogenase matur  53.0     2.7 5.9E-05   29.7  -1.0   29   42-77    153-181 (750)
174 PF12230 PRP21_like_P:  Pre-mRN  53.0     4.5 9.8E-05   24.4   0.0   32   69-101   168-199 (229)
175 COG4338 Uncharacterized protei  52.7     2.8   6E-05   18.8  -0.7   13   71-83     14-26  (54)
176 PF12760 Zn_Tnp_IS1595:  Transp  52.6       6 0.00013   17.3   0.4   11   67-77     35-45  (46)
177 KOG2907|consensus               52.2     9.8 0.00021   20.5   1.1   13   69-81    102-114 (116)
178 PF00301 Rubredoxin:  Rubredoxi  52.2     7.9 0.00017   17.3   0.7   13   70-82      2-14  (47)
179 PF14311 DUF4379:  Domain of un  51.8      16 0.00035   16.6   1.8   12   41-52     29-40  (55)
180 PF11672 DUF3268:  Protein of u  51.6      13 0.00028   19.7   1.5   12   12-23      2-13  (102)
181 PF02591 DUF164:  Putative zinc  51.2      19 0.00041   16.4   2.0   32   42-78     24-55  (56)
182 KOG0696|consensus               50.7       4 8.6E-05   27.5  -0.5   41   10-59     71-111 (683)
183 COG4306 Uncharacterized protei  50.6     5.5 0.00012   21.8   0.1   18   66-83     65-82  (160)
184 smart00731 SprT SprT homologue  50.4      14 0.00031   20.6   1.7   33   40-80    112-144 (146)
185 KOG0717|consensus               49.9      12 0.00025   25.4   1.5   21   13-33    293-313 (508)
186 KOG3507|consensus               49.7      14 0.00031   17.4   1.3    9   69-77     37-45  (62)
187 PF06397 Desulfoferrod_N:  Desu  49.6     9.7 0.00021   16.0   0.7   12   11-22      5-16  (36)
188 KOG2482|consensus               49.5      11 0.00025   24.4   1.3   23   12-34    195-217 (423)
189 COG1571 Predicted DNA-binding   49.5      13 0.00027   24.9   1.6   13   40-52    367-379 (421)
190 PF01363 FYVE:  FYVE zinc finge  48.6      14 0.00031   17.4   1.4   12   12-23      9-20  (69)
191 PF04780 DUF629:  Protein of un  48.6      14 0.00031   25.0   1.7   26   12-37     57-83  (466)
192 PF09845 DUF2072:  Zn-ribbon co  48.2     9.9 0.00021   21.0   0.8   14   12-25      1-14  (131)
193 PTZ00448 hypothetical protein;  48.2      13 0.00027   24.4   1.4   24   12-35    314-337 (373)
194 PHA02998 RNA polymerase subuni  48.1     5.6 0.00012   23.2  -0.1   11   70-80    172-182 (195)
195 KOG2231|consensus               48.1      48   0.001   23.8   4.1   17   43-59    185-201 (669)
196 PRK05580 primosome assembly pr  47.6      24 0.00053   25.1   2.8    8   14-21    383-390 (679)
197 COG1326 Uncharacterized archae  47.3      35 0.00076   20.4   3.0   13   39-51     29-41  (201)
198 TIGR00686 phnA alkylphosphonat  46.8      17 0.00037   19.4   1.5   13   39-51     18-30  (109)
199 PF01286 XPA_N:  XPA protein N-  46.4      11 0.00025   15.6   0.7   12   13-24      4-15  (34)
200 KOG2071|consensus               45.0      19  0.0004   25.2   1.9   27   67-93    416-442 (579)
201 PRK00420 hypothetical protein;  45.0      25 0.00054   18.9   2.0    7   71-77     42-48  (112)
202 PF00130 C1_1:  Phorbol esters/  44.9     9.1  0.0002   17.0   0.3   10   12-21     11-20  (53)
203 PF03966 Trm112p:  Trm112p-like  44.5      11 0.00024   18.0   0.6   14   10-23     51-64  (68)
204 PF09963 DUF2197:  Uncharacteri  44.3      23 0.00049   16.6   1.6   11   38-48     29-39  (56)
205 KOG0717|consensus               43.9      16 0.00034   24.9   1.4   22   70-91    293-314 (508)
206 KOG3183|consensus               43.7      19  0.0004   22.2   1.6   41   12-52     23-67  (250)
207 COG5216 Uncharacterized conser  43.5      20 0.00044   16.9   1.4   13   65-77     40-52  (67)
208 KOG0782|consensus               43.3     2.9 6.4E-05   29.0  -1.9   51   26-83    239-290 (1004)
209 KOG1940|consensus               43.3      24 0.00051   22.3   2.0    8   41-48    197-204 (276)
210 COG2879 Uncharacterized small   41.2      37  0.0008   16.3   2.0   19   81-99     24-42  (65)
211 PF08209 Sgf11:  Sgf11 (transcr  41.1      31 0.00066   14.2   1.9   20   12-32      4-23  (33)
212 KOG1088|consensus               40.2      16 0.00034   19.9   0.8   19    7-25     93-111 (124)
213 PF12773 DZR:  Double zinc ribb  40.2      17 0.00038   15.9   0.9    8   41-48     30-37  (50)
214 PF08792 A2L_zn_ribbon:  A2L zi  40.0      18 0.00038   14.8   0.8   12   12-23     21-32  (33)
215 COG1779 C4-type Zn-finger prot  40.0     7.8 0.00017   23.0  -0.3   35   13-53     15-56  (201)
216 COG1594 RPB9 DNA-directed RNA   40.0      10 0.00022   20.4   0.1   16   10-25     20-35  (113)
217 COG3677 Transposase and inacti  40.0      15 0.00033   20.2   0.8   16   10-25     51-66  (129)
218 PRK14892 putative transcriptio  39.9      18 0.00039   19.0   1.0    8   12-19     21-28  (99)
219 KOG4727|consensus               39.8      24 0.00052   20.6   1.5   22   11-32     74-95  (193)
220 PF11789 zf-Nse:  Zinc-finger o  39.7      27 0.00058   16.2   1.5   32   38-74     22-53  (57)
221 KOG2636|consensus               39.6      26 0.00056   23.8   1.8   27   33-59    394-421 (497)
222 PF10058 DUF2296:  Predicted in  39.2      34 0.00075   15.7   1.8   10   68-77     43-52  (54)
223 KOG1842|consensus               39.2      19 0.00041   24.4   1.2   29   39-67     14-42  (505)
224 PRK05978 hypothetical protein;  39.1      12 0.00025   21.3   0.3   11   71-81     54-64  (148)
225 PF01927 Mut7-C:  Mut7-C RNAse   39.1      17 0.00037   20.3   0.9   44   41-84     92-139 (147)
226 PTZ00043 cytochrome c oxidase   38.5      17 0.00038   22.2   0.9   15   67-81    179-193 (268)
227 PRK12722 transcriptional activ  38.5      27 0.00058   20.7   1.7    9   69-77    154-162 (187)
228 PF08882 Acetone_carb_G:  Aceto  38.3      23  0.0005   19.0   1.3   17   18-34     29-46  (112)
229 PRK05452 anaerobic nitric oxid  37.6      20 0.00044   24.3   1.2   14   39-52    424-437 (479)
230 COG5246 PRP11 Splicing factor   37.4      29 0.00063   20.5   1.6   27    4-32     47-73  (222)
231 PRK12860 transcriptional activ  37.2      27 0.00059   20.7   1.6   11   41-51    135-145 (189)
232 PF04438 zf-HIT:  HIT zinc fing  37.0      22 0.00047   14.1   0.8   11   12-22     13-23  (30)
233 PRK00762 hypA hydrogenase nick  36.9      26 0.00056   19.1   1.4    6   71-76     94-99  (124)
234 PRK10220 hypothetical protein;  36.7      37 0.00079   18.3   1.8   13   40-52     20-32  (111)
235 PF02148 zf-UBP:  Zn-finger in   35.8      13 0.00029   17.4   0.1   16   67-82      9-24  (63)
236 COG0675 Transposase and inacti  35.7      30 0.00066   21.7   1.7   15   68-82    321-335 (364)
237 PF14803 Nudix_N_2:  Nudix N-te  35.6      25 0.00054   14.5   0.9   12   11-22     21-32  (34)
238 TIGR03831 YgiT_finger YgiT-typ  35.6      19 0.00042   15.2   0.6   12   13-24     33-44  (46)
239 cd00974 DSRD Desulforedoxin (D  35.5      25 0.00054   14.2   0.9   11   12-22      4-14  (34)
240 TIGR00319 desulf_FeS4 desulfof  35.3      24 0.00053   14.2   0.9   12   11-22      6-17  (34)
241 cd00065 FYVE FYVE domain; Zinc  35.1      37  0.0008   15.2   1.6   10   14-23      4-13  (57)
242 KOG2923|consensus               34.8      31 0.00067   16.6   1.3   10   67-76     42-51  (67)
243 PF01215 COX5B:  Cytochrome c o  34.6      16 0.00034   20.5   0.3   18   63-81    107-124 (136)
244 smart00064 FYVE Protein presen  34.2      34 0.00075   16.0   1.5   12   12-23     10-21  (68)
245 PF15616 TerY-C:  TerY-C metal   34.2      15 0.00031   20.4   0.1   13   66-78    102-114 (131)
246 KOG4118|consensus               33.8      23 0.00049   17.1   0.7   29   70-98     39-67  (74)
247 PF04606 Ogr_Delta:  Ogr/Delta-  33.7      14 0.00031   16.2   0.1    6   75-80     33-38  (47)
248 PLN03238 probable histone acet  32.5      65  0.0014   20.6   2.7   24   67-90     46-69  (290)
249 KOG1994|consensus               32.4      25 0.00055   21.5   0.9   25   66-90    236-260 (268)
250 PF05180 zf-DNL:  DNL zinc fing  31.8      18 0.00039   17.5   0.2   34   12-48      4-37  (66)
251 TIGR00627 tfb4 transcription f  31.6      45 0.00099   21.1   2.0   25   40-79    255-279 (279)
252 PF05741 zf-nanos:  Nanos RNA b  31.5      21 0.00046   16.6   0.4   10   12-21     33-42  (55)
253 PF02748 PyrI_C:  Aspartate car  30.9      28  0.0006   15.9   0.8   15   66-80     32-46  (52)
254 smart00132 LIM Zinc-binding do  30.9     8.8 0.00019   15.4  -0.9    6   42-47     29-34  (39)
255 KOG0978|consensus               30.5      24 0.00052   25.3   0.7   13   71-83    680-692 (698)
256 PF14369 zf-RING_3:  zinc-finge  30.4      24 0.00052   14.6   0.5   10   14-23     23-32  (35)
257 PF00412 LIM:  LIM domain;  Int  30.2     7.2 0.00016   17.6  -1.3   14   39-52     25-38  (58)
258 PF06676 DUF1178:  Protein of u  29.9      40 0.00086   19.2   1.4   10   39-48     31-40  (148)
259 COG5188 PRP9 Splicing factor 3  29.8      22 0.00047   23.4   0.4   22   12-33    238-259 (470)
260 smart00109 C1 Protein kinase C  29.8      40 0.00087   14.2   1.2   10   12-21     11-20  (49)
261 PF01096 TFIIS_C:  Transcriptio  29.4      28  0.0006   14.7   0.6    9   41-49     29-37  (39)
262 KOG2272|consensus               29.2      66  0.0014   20.2   2.3   19   64-82    216-234 (332)
263 PF10083 DUF2321:  Uncharacteri  29.1      20 0.00044   20.5   0.2   21   66-86     65-85  (158)
264 smart00661 RPOL9 RNA polymeras  29.1      33 0.00071   15.1   0.8   13   12-24     20-32  (52)
265 PHA02942 putative transposase;  29.1      39 0.00085   22.3   1.5   16   67-82    340-355 (383)
266 TIGR03829 YokU_near_AblA uncha  28.5      39 0.00085   17.4   1.1   18   12-29     35-52  (89)
267 PF02891 zf-MIZ:  MIZ/SP-RING z  27.9      42 0.00092   15.0   1.1    9   69-77     41-49  (50)
268 PRK11032 hypothetical protein;  27.7      48   0.001   19.1   1.5    8   41-48    125-132 (160)
269 PF14255 Cys_rich_CPXG:  Cystei  27.7      30 0.00065   15.8   0.6   10   71-80      2-11  (52)
270 PLN02748 tRNA dimethylallyltra  27.3      48   0.001   22.7   1.7   23   12-34    418-441 (468)
271 TIGR01384 TFS_arch transcripti  27.1      15 0.00032   19.1  -0.6   37   41-80     63-101 (104)
272 PRK01343 zinc-binding protein;  26.4      62  0.0013   15.2   1.5   11   12-22      9-19  (57)
273 TIGR00244 transcriptional regu  26.2      31 0.00067   19.6   0.6   13   70-82     29-41  (147)
274 PF14690 zf-ISL3:  zinc-finger   25.5      36 0.00078   14.6   0.6    8   12-19      2-9   (47)
275 CHL00174 accD acetyl-CoA carbo  25.3      27 0.00059   22.2   0.3   13   41-53     58-70  (296)
276 PF14354 Lar_restr_allev:  Rest  24.9      37  0.0008   15.6   0.6   10   12-21      3-12  (61)
277 KOG3214|consensus               24.8      22 0.00048   18.7  -0.2   12   41-52     48-59  (109)
278 PF02146 SIR2:  Sir2 family;  I  24.8 1.3E+02  0.0029   17.2   3.0   11   41-51    106-116 (178)
279 COG5112 UFD2 U1-like Zn-finger  24.6      36 0.00078   18.2   0.6   24   10-33     53-76  (126)
280 COG1656 Uncharacterized conser  24.4      42 0.00091   19.5   0.9   45   41-86     98-147 (165)
281 PF03884 DUF329:  Domain of unk  24.4      38 0.00081   15.9   0.6   12   13-24      3-14  (57)
282 PF13821 DUF4187:  Domain of un  24.2      41 0.00089   15.5   0.7   23   65-87     23-45  (55)
283 TIGR00515 accD acetyl-CoA carb  24.2      30 0.00066   21.9   0.3   13   41-53     46-58  (285)
284 TIGR01385 TFSII transcription   23.8      27 0.00058   22.3   0.0   10   70-79    287-296 (299)
285 PF09082 DUF1922:  Domain of un  23.5      48   0.001   16.2   0.8   26   13-50      4-29  (68)
286 PLN00104 MYST -like histone ac  23.3      75  0.0016   21.7   2.0   25   67-91    196-220 (450)
287 PRK05654 acetyl-CoA carboxylas  23.0      32  0.0007   21.8   0.3   32   13-53     28-59  (292)
288 PRK03564 formate dehydrogenase  22.7      52  0.0011   21.2   1.1   11   11-21    186-196 (309)
289 PF09855 DUF2082:  Nucleic-acid  22.4      36 0.00077   16.3   0.3    9   13-21      1-9   (64)
290 KOG3277|consensus               22.3      56  0.0012   18.8   1.1   33   12-47     79-111 (165)
291 PF03107 C1_2:  C1 domain;  Int  22.2      49  0.0011   12.9   0.7    8   71-78      2-9   (30)
292 PRK08222 hydrogenase 4 subunit  22.0      61  0.0013   18.9   1.3   18   12-29    114-131 (181)
293 TIGR03830 CxxCG_CxxCG_HTH puta  21.9      88  0.0019   16.6   1.8   18   12-29     31-48  (127)
294 PF14446 Prok-RING_1:  Prokaryo  21.8      25 0.00055   16.3  -0.3   26   13-50      6-31  (54)
295 KOG3352|consensus               21.7      48  0.0011   18.9   0.8   13   68-80    132-144 (153)
296 PF06220 zf-U1:  U1 zinc finger  21.7      86  0.0019   13.2   1.5   10   41-50      4-13  (38)
297 smart00290 ZnF_UBP Ubiquitin C  21.7      49  0.0011   14.3   0.7   10   70-79     12-21  (50)
298 PF11931 DUF3449:  Domain of un  21.6      31 0.00067   20.6   0.0   23   11-33    100-123 (196)
299 COG5539 Predicted cysteine pro  21.5      92   0.002   20.0   2.0   24    8-31    271-294 (306)
300 PF05280 FlhC:  Flagellar trans  21.4      42  0.0009   19.6   0.5   12   41-52    135-146 (175)
301 COG1327 Predicted transcriptio  21.4      43 0.00093   19.2   0.5   13   70-82     29-41  (156)
302 PF14375 Cys_rich_CWC:  Cystein  21.1      49  0.0011   14.8   0.6    9   15-23      1-9   (50)
303 KOG3014|consensus               21.1      84  0.0018   19.7   1.7   23   14-36     39-63  (257)
304 PTZ00064 histone acetyltransfe  20.9   1E+02  0.0022   21.5   2.2   25   67-91    278-302 (552)
305 COG5109 Uncharacterized conser  20.8      85  0.0018   20.5   1.7   45   36-84    347-391 (396)
306 PRK06260 threonine synthase; V  20.7 1.1E+02  0.0024   20.2   2.4   10   13-22      4-13  (397)
307 COG1885 Uncharacterized protei  20.6      49  0.0011   17.6   0.6   13   12-24     49-61  (115)
308 COG1579 Zn-ribbon protein, pos  20.6 1.1E+02  0.0024   19.0   2.1   35   41-80    198-232 (239)
309 PLN03239 histone acetyltransfe  20.2      79  0.0017   20.8   1.6   25   67-91    104-128 (351)
310 PF05876 Terminase_GpA:  Phage   20.1      48   0.001   23.1   0.7   12   13-24    201-212 (557)

No 1  
>KOG2462|consensus
Probab=99.89  E-value=9.1e-24  Score=123.63  Aligned_cols=87  Identities=23%  Similarity=0.456  Sum_probs=69.1

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHH
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHT   89 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~   89 (103)
                      ++.+.|+.||+.|.....|..|+++|+  -+.+|.+||+.|..+=.|+.| +++|+|||||.|..|++.|..+++|..|+
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGH-iRTHTGEKPF~C~hC~kAFADRSNLRAHm  235 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGH-IRTHTGEKPFSCPHCGKAFADRSNLRAHM  235 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcc-cccccCCCCccCCcccchhcchHHHHHHH
Confidence            456777777777777777777777775  567788888888887778887 78888888888888888888888888888


Q ss_pred             HhhCCCCCcc
Q psy7454          90 KRYHPKMYDV   99 (103)
Q Consensus        90 ~~~~~~~~~~   99 (103)
                      ++|.+.++|.
T Consensus       236 QTHS~~K~~q  245 (279)
T KOG2462|consen  236 QTHSDVKKHQ  245 (279)
T ss_pred             HhhcCCcccc
Confidence            8888888774


No 2  
>KOG2462|consensus
Probab=99.89  E-value=4.1e-24  Score=125.06  Aligned_cols=85  Identities=26%  Similarity=0.440  Sum_probs=78.9

Q ss_pred             CCCCCCCCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcH
Q psy7454           4 PRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQ   83 (103)
Q Consensus         4 ~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~   83 (103)
                      .|+|+  -+..|.+||+.|...=-|+.|+|+|+||+||.|..|+++|...++|+.| +.+|.+.++|.|..|++.|...+
T Consensus       181 irTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAH-mQTHS~~K~~qC~~C~KsFsl~S  257 (279)
T KOG2462|consen  181 IRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAH-MQTHSDVKKHQCPRCGKSFALKS  257 (279)
T ss_pred             hhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHH-HHhhcCCccccCcchhhHHHHHH
Confidence            44555  6799999999999888899999999999999999999999999999998 89999999999999999999999


Q ss_pred             HHHHHHHh
Q psy7454          84 ALKVHTKR   91 (103)
Q Consensus        84 ~l~~H~~~   91 (103)
                      .|.+|.-.
T Consensus       258 yLnKH~ES  265 (279)
T KOG2462|consen  258 YLNKHSES  265 (279)
T ss_pred             HHHHhhhh
Confidence            99999754


No 3  
>KOG3623|consensus
Probab=99.75  E-value=2.4e-19  Score=116.52  Aligned_cols=80  Identities=24%  Similarity=0.559  Sum_probs=76.7

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHH
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHT   89 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~   89 (103)
                      ...|.|+.|++.|...+.|.+|...|+|.+||.|.+|.++|+.+-.|..| ++.|.|++||.|..|++.|.++..+..||
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEH-kRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEH-KRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhh-hhhccCCCcchhhhhhhhcccccchHhhh
Confidence            45799999999999999999999999999999999999999999999998 99999999999999999999999999987


Q ss_pred             H
Q psy7454          90 K   90 (103)
Q Consensus        90 ~   90 (103)
                      -
T Consensus       971 N  971 (1007)
T KOG3623|consen  971 N  971 (1007)
T ss_pred             c
Confidence            5


No 4  
>KOG3576|consensus
Probab=99.72  E-value=7.1e-19  Score=99.61  Aligned_cols=87  Identities=28%  Similarity=0.467  Sum_probs=80.9

Q ss_pred             CCCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHH
Q psy7454           9 YRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVH   88 (103)
Q Consensus         9 ~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H   88 (103)
                      +...|.|.+|++.|.....|.+|++.|...+.+.|..||++|...-.|++| .++|+|-+||+|..|++.|++..+|..|
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh-~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRH-TRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhh-hccccCccccchhhhhHHHHhhccHHHH
Confidence            345799999999999999999999999999999999999999999999998 8999999999999999999999999999


Q ss_pred             HHhhCCCC
Q psy7454          89 TKRYHPKM   96 (103)
Q Consensus        89 ~~~~~~~~   96 (103)
                      ++..+|..
T Consensus       193 l~kvhgv~  200 (267)
T KOG3576|consen  193 LKKVHGVQ  200 (267)
T ss_pred             HHHHcCch
Confidence            99877654


No 5  
>KOG1074|consensus
Probab=99.68  E-value=2.9e-17  Score=108.10  Aligned_cols=58  Identities=28%  Similarity=0.513  Sum_probs=54.8

Q ss_pred             ecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHHHhhCCCCCccc
Q psy7454          42 TCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYDVE  100 (103)
Q Consensus        42 ~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~  100 (103)
                      .|.+||+.|...+.|+.| +++|++++||.|.+|++.|....+|+.||.+|.+..|..+
T Consensus       881 ~C~vCgk~FsSSsALqiH-~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~sr  938 (958)
T KOG1074|consen  881 VCNVCGKQFSSSAALEIH-MRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSR  938 (958)
T ss_pred             hhccchhcccchHHHHHh-hhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCcc
Confidence            799999999999999998 9999999999999999999999999999999998887643


No 6  
>KOG1074|consensus
Probab=99.62  E-value=1.2e-16  Score=105.20  Aligned_cols=56  Identities=25%  Similarity=0.459  Sum_probs=40.7

Q ss_pred             ecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHHHhhCCCCCc
Q psy7454          42 TCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYD   98 (103)
Q Consensus        42 ~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~   98 (103)
                      .|.+|.+...-.+.|+.| -++|+||+||+|.+||+.|.++.+|+.|+..|....|+
T Consensus       607 qCiiC~rVlSC~saLqmH-yrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~  662 (958)
T KOG1074|consen  607 QCIICLRVLSCPSALQMH-YRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPA  662 (958)
T ss_pred             ceeeeeecccchhhhhhh-hhcccCcCccccccccchhccccchhhcccccccCccc
Confidence            677777777777777776 67777777777777777777777777777777554443


No 7  
>KOG3576|consensus
Probab=99.62  E-value=1.5e-16  Score=90.32  Aligned_cols=95  Identities=25%  Similarity=0.460  Sum_probs=83.4

Q ss_pred             CCCCCCCCCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcC----------CCCCeeC
Q psy7454           3 MPRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHT----------GQKPYPC   72 (103)
Q Consensus         3 ~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~----------~~~~~~c   72 (103)
                      |+.-|+..+.+.|..||+.|.+...|++|+++|+|.+||.|..|+++|.....|..|...+|.          .++.|.|
T Consensus       136 h~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vc  215 (267)
T KOG3576|consen  136 HLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVC  215 (267)
T ss_pred             HhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeee
Confidence            455677778899999999999999999999999999999999999999999999999666664          3577999


Q ss_pred             CCCCccccCcHHHHHHHHhhCCCCC
Q psy7454          73 RYCDYKARETQALKVHTKRYHPKMY   97 (103)
Q Consensus        73 ~~C~~~f~~~~~l~~H~~~~~~~~~   97 (103)
                      ..||........+..|+..++..-|
T Consensus       216 edcg~t~~~~e~~~~h~~~~hp~Sp  240 (267)
T KOG3576|consen  216 EDCGYTSERPEVYYLHLKLHHPFSP  240 (267)
T ss_pred             cccCCCCCChhHHHHHHHhcCCCCH
Confidence            9999999999999999999886544


No 8  
>KOG3623|consensus
Probab=99.58  E-value=5.4e-16  Score=101.28  Aligned_cols=80  Identities=24%  Similarity=0.595  Sum_probs=71.1

Q ss_pred             CceeeCCCCCcccCchhHHHHHhhcCC-------------CCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCc
Q psy7454          11 YKYVCFACKFYTYNTGNIKRHLGMHLG-------------EKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDY   77 (103)
Q Consensus        11 ~~~~C~~C~~~f~~~~~l~~h~~~h~~-------------~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~   77 (103)
                      ..|.|..|..+|..+..|.+|+.+|..             -+.|+|.+||++|+.+-.|+.| +++|.|++||.|+.|++
T Consensus       239 ~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEH-lRIHSGEKPfeCpnCkK  317 (1007)
T KOG3623|consen  239 PNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEH-LRIHSGEKPFECPNCKK  317 (1007)
T ss_pred             CCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhh-heeecCCCCcCCccccc
Confidence            358899999999999999999988742             2458999999999999999998 89999999999999999


Q ss_pred             cccCcHHHHHHHHh
Q psy7454          78 KARETQALKVHTKR   91 (103)
Q Consensus        78 ~f~~~~~l~~H~~~   91 (103)
                      .|.++..+..|+..
T Consensus       318 RFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  318 RFSHSGSYSSHMSS  331 (1007)
T ss_pred             ccccCCcccccccc
Confidence            99999999999764


No 9  
>PHA00733 hypothetical protein
Probab=99.40  E-value=2.8e-13  Score=73.25  Aligned_cols=82  Identities=21%  Similarity=0.364  Sum_probs=67.8

Q ss_pred             CCceeeCCCCCcccCchhHHHH--H---hhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHH
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRH--L---GMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQA   84 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h--~---~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~   84 (103)
                      ++++.|.+|...|.....|..+  .   ..+.+.++|.|..||+.|.....|..| ++.+  +.++.|..|++.|.....
T Consensus        38 ~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H-~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         38 QKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQH-IRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHH-HhcC--CcCccCCCCCCccCCHHH
Confidence            5678999999888877666554  1   123458899999999999999999998 6655  457999999999999999


Q ss_pred             HHHHHHhhCC
Q psy7454          85 LKVHTKRYHP   94 (103)
Q Consensus        85 l~~H~~~~~~   94 (103)
                      |..|+...++
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            9999998775


No 10 
>KOG3608|consensus
Probab=99.40  E-value=3.4e-13  Score=82.33  Aligned_cols=95  Identities=20%  Similarity=0.382  Sum_probs=69.8

Q ss_pred             CCCCCCCCCceeeCCCCCcccCchhHHHHHhhcCC----------------------------CCCeecCCCCccccCch
Q psy7454           3 MPRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLG----------------------------EKPFTCNMCEFKCRDNR   54 (103)
Q Consensus         3 ~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~----------------------------~~~~~c~~C~~~~~~~~   54 (103)
                      |.++|++++.--|+.||..|.....|-.|.+..+.                            ...|+|+.|..+....+
T Consensus       198 H~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc~~~s  277 (467)
T KOG3608|consen  198 HIRTHSNEKVVACPHCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTCSSAS  277 (467)
T ss_pred             HHHhcCCCeEEecchHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCCCChH
Confidence            34566666666666666666666666555432110                            24578999999999999


Q ss_pred             HHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHHHhhCCCCCc
Q psy7454          55 TLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYD   98 (103)
Q Consensus        55 ~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~   98 (103)
                      .|..|++..|..++||+|..|+..+...++|.+|...|. +..|
T Consensus       278 sL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y  320 (467)
T KOG3608|consen  278 SLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVY  320 (467)
T ss_pred             HHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccce
Confidence            999986667888999999999999999999999999776 4434


No 11 
>PHA02768 hypothetical protein; Provisional
Probab=99.23  E-value=4.6e-12  Score=58.12  Aligned_cols=43  Identities=16%  Similarity=0.226  Sum_probs=30.4

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHH
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTL   56 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l   56 (103)
                      .|.|+.||+.|...++|..|+++|+  +++.|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            3677777777777777777777776  567777777776655554


No 12 
>KOG3608|consensus
Probab=99.18  E-value=3.3e-11  Score=73.87  Aligned_cols=89  Identities=19%  Similarity=0.510  Sum_probs=56.3

Q ss_pred             CCCCCCCCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCC--CCccccCchHHHHHHHHhcCC--CCCeeCCCCCccc
Q psy7454           4 PRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNM--CEFKCRDNRTLKAHHINIHTG--QKPYPCRYCDYKA   79 (103)
Q Consensus         4 ~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~--C~~~~~~~~~l~~h~~~~h~~--~~~~~c~~C~~~f   79 (103)
                      +-.|...+||+|+.|++.|...+.|..|..+|. +..|.|..  |...+.+...+.+|.+..|.|  ..+|.|-.|++.|
T Consensus       284 r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~f  362 (467)
T KOG3608|consen  284 RYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFF  362 (467)
T ss_pred             HhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhh
Confidence            334555666777777766666666776766665 55566655  666666666666664444433  3457777777777


Q ss_pred             cCcHHHHHHHHhhC
Q psy7454          80 RETQALKVHTKRYH   93 (103)
Q Consensus        80 ~~~~~l~~H~~~~~   93 (103)
                      ++-.+|.+|+..-+
T Consensus       363 t~G~~L~~HL~kkH  376 (467)
T KOG3608|consen  363 TSGKSLSAHLMKKH  376 (467)
T ss_pred             ccchhHHHHHHHhh
Confidence            77777777766543


No 13 
>PHA02768 hypothetical protein; Provisional
Probab=99.13  E-value=3e-11  Score=55.42  Aligned_cols=43  Identities=14%  Similarity=0.331  Sum_probs=38.7

Q ss_pred             CeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHH
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQAL   85 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l   85 (103)
                      .|.|+.||+.|...+.|..| ++.|+  ++++|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H-~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITH-LRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHH-HHhcC--CcccCCcccceeccccee
Confidence            47899999999999999998 89998  689999999999977665


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.02  E-value=1.3e-09  Score=71.19  Aligned_cols=83  Identities=14%  Similarity=0.358  Sum_probs=65.1

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc---------
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR---------   80 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~---------   80 (103)
                      +..+.|+.|+..|. ...|..|+.++.  +++.|+ ||..+ ....|..| +..+..++++.|..|+..+.         
T Consensus       451 ~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H-~~thCp~Kpi~C~fC~~~v~~g~~~~d~~  524 (567)
T PLN03086        451 KNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQH-QASTCPLRLITCRFCGDMVQAGGSAMDVR  524 (567)
T ss_pred             ccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhh-hhccCCCCceeCCCCCCccccCccccchh
Confidence            44678999998885 577899988874  788999 99755 56788887 78889999999999998884         


Q ss_pred             -CcHHHHHHHHhhCCCCCcc
Q psy7454          81 -ETQALKVHTKRYHPKMYDV   99 (103)
Q Consensus        81 -~~~~l~~H~~~~~~~~~~~   99 (103)
                       ..+.|..|.... |.+++.
T Consensus       525 d~~s~Lt~HE~~C-G~rt~~  543 (567)
T PLN03086        525 DRLRGMSEHESIC-GSRTAP  543 (567)
T ss_pred             hhhhhHHHHHHhc-CCcceE
Confidence             235788888874 666653


No 15 
>PHA00733 hypothetical protein
Probab=99.02  E-value=7.1e-10  Score=60.09  Aligned_cols=51  Identities=22%  Similarity=0.389  Sum_probs=45.4

Q ss_pred             CCCCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHH
Q psy7454           8 AYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHH   60 (103)
Q Consensus         8 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~   60 (103)
                      .+..+|.|+.|++.|.....|..|++.+  ..++.|..|++.|.....|..|.
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~  119 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHV  119 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHH
Confidence            3477999999999999999999999876  45789999999999999999983


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.97  E-value=5.3e-10  Score=44.20  Aligned_cols=23  Identities=39%  Similarity=0.947  Sum_probs=11.6

Q ss_pred             HHHHHhhcCCCCCeecCCCCccc
Q psy7454          28 IKRHLGMHLGEKPFTCNMCEFKC   50 (103)
Q Consensus        28 l~~h~~~h~~~~~~~c~~C~~~~   50 (103)
                      |..|+++|++++||.|+.|++.|
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F   24 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSF   24 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEE
T ss_pred             HHHHhhhcCCCCCCCCCCCcCee
Confidence            44455555555555555555444


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.86  E-value=2.8e-09  Score=42.10  Aligned_cols=26  Identities=42%  Similarity=0.974  Sum_probs=22.8

Q ss_pred             HHHHHHHHhcCCCCCeeCCCCCccccC
Q psy7454          55 TLKAHHINIHTGQKPYPCRYCDYKARE   81 (103)
Q Consensus        55 ~l~~h~~~~h~~~~~~~c~~C~~~f~~   81 (103)
                      .|..| ++.|++++||.|+.|++.|..
T Consensus         1 ~l~~H-~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRH-MRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHH-HHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHH-hhhcCCCCCCCCCCCcCeeCc
Confidence            36788 889999999999999999863


No 18 
>PHA00616 hypothetical protein
Probab=98.86  E-value=1.4e-09  Score=47.68  Aligned_cols=31  Identities=19%  Similarity=0.228  Sum_probs=22.9

Q ss_pred             CeeCCCCCccccCcHHHHHHHHhhCCCCCcc
Q psy7454          69 PYPCRYCDYKARETQALKVHTKRYHPKMYDV   99 (103)
Q Consensus        69 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~   99 (103)
                      ||.|+.||+.|...+.|..|++.|++++++.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~   31 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLT   31 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccc
Confidence            4677777777777777777777777777763


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.84  E-value=7.7e-09  Score=67.66  Aligned_cols=78  Identities=19%  Similarity=0.390  Sum_probs=62.6

Q ss_pred             CceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccC----------chHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          11 YKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRD----------NRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        11 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~----------~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      .++.|+ ||..+ ....|..|+.+|..++++.|..|+..+..          .+.|..| .... +.+++.|..||+.+.
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~H-E~~C-G~rt~~C~~Cgk~Vr  552 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEH-ESIC-GSRTAPCDSCGRSVM  552 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHH-HHhc-CCcceEccccCCeee
Confidence            578999 99755 56889999999999999999999988842          3478887 6664 889999999998766


Q ss_pred             CcHHHHHHHHhhC
Q psy7454          81 ETQALKVHTKRYH   93 (103)
Q Consensus        81 ~~~~l~~H~~~~~   93 (103)
                      . ..+..|+...|
T Consensus       553 l-rdm~~H~~~~h  564 (567)
T PLN03086        553 L-KEMDIHQIAVH  564 (567)
T ss_pred             e-hhHHHHHHHhh
Confidence            4 46677776644


No 20 
>KOG3993|consensus
Probab=98.83  E-value=5.4e-10  Score=69.89  Aligned_cols=82  Identities=20%  Similarity=0.335  Sum_probs=65.5

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCC--------------------------
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTG--------------------------   66 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~--------------------------   66 (103)
                      |.|..|...|.+...|.+|.-.-.-..-|.|++|++.|.-+.+|..| ++.|--                          
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASH-RRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASH-RRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhh-hcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            78888988888888888886444444568899999999999999888 776621                          


Q ss_pred             -------CCCeeCCCCCccccCcHHHHHHHHhhCCC
Q psy7454          67 -------QKPYPCRYCDYKARETQALKVHTKRYHPK   95 (103)
Q Consensus        67 -------~~~~~c~~C~~~f~~~~~l~~H~~~~~~~   95 (103)
                             +-.|.|..|++.|++...|+.|+.+|+..
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~  382 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRA  382 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhcc
Confidence                   12489999999999999999998887643


No 21 
>PHA00616 hypothetical protein
Probab=98.79  E-value=1.7e-09  Score=47.45  Aligned_cols=34  Identities=18%  Similarity=0.249  Sum_probs=24.9

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCeecCC
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNM   45 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~   45 (103)
                      ||.|+.||+.|...+.|..|++.|++++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            4677777777777777777777777777766653


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.53  E-value=3.6e-07  Score=42.34  Aligned_cols=50  Identities=26%  Similarity=0.458  Sum_probs=23.6

Q ss_pred             eecCCCCccccCchHHHHHHHHhcCCC-CCeeCCCCCccccCcHHHHHHHHhhC
Q psy7454          41 FTCNMCEFKCRDNRTLKAHHINIHTGQ-KPYPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~l~~h~~~~h~~~-~~~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      |.|+.|++ ......|..|....|..+ +.+.|++|...+.  .+|..|+...+
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            45555555 233344555544444433 2355555554322  25555555443


No 23 
>PHA00732 hypothetical protein
Probab=98.44  E-value=2.6e-07  Score=46.02  Aligned_cols=42  Identities=29%  Similarity=0.502  Sum_probs=34.4

Q ss_pred             ceeeCCCCCcccCchhHHHHHhh-cCCCCCeecCCCCccccCchHHHHH
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGM-HLGEKPFTCNMCEFKCRDNRTLKAH   59 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~-h~~~~~~~c~~C~~~~~~~~~l~~h   59 (103)
                      ||.|+.|++.|.+...|..|++. |.+   +.|+.|++.|..   +..|
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~---l~~H   43 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRR---LNQH   43 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCC---hhhh
Confidence            57899999999999999999874 553   479999999874   5666


No 24 
>PHA00732 hypothetical protein
Probab=98.41  E-value=3e-07  Score=45.77  Aligned_cols=46  Identities=30%  Similarity=0.472  Sum_probs=37.6

Q ss_pred             CeecCCCCccccCchHHHHHHHH-hcCCCCCeeCCCCCccccCcHHHHHHHHhh
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHIN-IHTGQKPYPCRYCDYKARETQALKVHTKRY   92 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~-~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~   92 (103)
                      ||.|..|++.|...+.|..| ++ .|.+   +.|..||+.|.   .+..|..+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H-~r~~H~~---~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQH-ARRNHTL---TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHH-hhcccCC---CccCCCCCEeC---Chhhhhccc
Confidence            57899999999999999998 66 4653   58999999998   477777544


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.38  E-value=2.8e-07  Score=35.15  Aligned_cols=22  Identities=32%  Similarity=0.548  Sum_probs=16.0

Q ss_pred             eeeCCCCCcccCchhHHHHHhh
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      |.|+.|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5677777777777777777665


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.37  E-value=4e-07  Score=34.69  Aligned_cols=23  Identities=30%  Similarity=0.583  Sum_probs=16.9

Q ss_pred             eeCCCCCccccCcHHHHHHHHhh
Q psy7454          70 YPCRYCDYKARETQALKVHTKRY   92 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~~   92 (103)
                      |.|..|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            56777777777777777777653


No 27 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.19  E-value=2.4e-06  Score=32.59  Aligned_cols=24  Identities=25%  Similarity=0.614  Sum_probs=16.7

Q ss_pred             eeCCCCCccccCcHHHHHHHHhhC
Q psy7454          70 YPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      |.|+.|++.|.....|..|+.+++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567788888888888888877664


No 28 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.13  E-value=7.1e-06  Score=37.96  Aligned_cols=46  Identities=20%  Similarity=0.465  Sum_probs=34.5

Q ss_pred             ceeeCCCCCcccCchhHHHHHh-hcCC-CCCeecCCCCccccCchHHHHHH
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLG-MHLG-EKPFTCNMCEFKCRDNRTLKAHH   60 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~-~h~~-~~~~~c~~C~~~~~~~~~l~~h~   60 (103)
                      .|.||.|++ ..+...|..|.. .|.. .+.+.|++|...+.  ..|..|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl   49 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHL   49 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHH
Confidence            589999999 456788999954 4554 35799999997543  4788873


No 29 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.09  E-value=3.5e-06  Score=33.30  Aligned_cols=25  Identities=16%  Similarity=0.299  Sum_probs=18.2

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcC
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHL   36 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~   36 (103)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4677777777777777777776653


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.07  E-value=3.4e-06  Score=33.32  Aligned_cols=25  Identities=24%  Similarity=0.523  Sum_probs=18.1

Q ss_pred             CeeCCCCCccccCcHHHHHHHHhhC
Q psy7454          69 PYPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        69 ~~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4677777777777777777776654


No 31 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.98  E-value=2.4e-06  Score=52.38  Aligned_cols=53  Identities=36%  Similarity=0.763  Sum_probs=38.1

Q ss_pred             CCCeecCC--CCccccCchHHHHHHHHhc------------------CCCCCeeCCCCCccccCcHHHHHHHH
Q psy7454          38 EKPFTCNM--CEFKCRDNRTLKAHHINIH------------------TGQKPYPCRYCDYKARETQALKVHTK   90 (103)
Q Consensus        38 ~~~~~c~~--C~~~~~~~~~l~~h~~~~h------------------~~~~~~~c~~C~~~f~~~~~l~~H~~   90 (103)
                      ++||.|++  |.+.|+....|+.|.+..|                  ...+||.|.+|++.+.....|+-|+.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceeccc
Confidence            46677754  6677777777766633333                  23589999999999999999887765


No 32 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.98  E-value=7.9e-06  Score=42.16  Aligned_cols=73  Identities=18%  Similarity=0.287  Sum_probs=21.7

Q ss_pred             eeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHHHhh
Q psy7454          14 VCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRY   92 (103)
Q Consensus        14 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~   92 (103)
                      .|..|+..|.....|..|+....+...-..    ..+.....+... .... ....+.|..|++.|.....|..|+..+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~----~~l~~~~~~~~~-~~~~-~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQ----KYLVDPNRLLNY-LRKK-VKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccccc----cccccccccccc-cccc-cCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            488999999999999999865433221111    111122222222 2221 223689999999999999999999974


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.96  E-value=7.7e-06  Score=31.09  Aligned_cols=23  Identities=17%  Similarity=0.496  Sum_probs=13.8

Q ss_pred             eeeCCCCCcccCchhHHHHHhhc
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMH   35 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h   35 (103)
                      |.|+.|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            46677777777777777766543


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.88  E-value=2.7e-05  Score=35.08  Aligned_cols=26  Identities=23%  Similarity=0.374  Sum_probs=11.0

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCC
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLG   37 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~   37 (103)
                      |.+|++|+..+.+..+|.+|+....+
T Consensus        24 PatCP~C~a~~~~srnLrRHle~~H~   49 (54)
T PF09237_consen   24 PATCPICGAVIRQSRNLRRHLEIRHF   49 (54)
T ss_dssp             -EE-TTT--EESSHHHHHHHHHHHTT
T ss_pred             CCCCCcchhhccchhhHHHHHHHHhc
Confidence            45555555555555555555544333


No 35 
>KOG3993|consensus
Probab=97.86  E-value=1e-05  Score=51.37  Aligned_cols=53  Identities=26%  Similarity=0.437  Sum_probs=44.2

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCC---------------------------------CCCeecCCCCccccCchHHHH
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLG---------------------------------EKPFTCNMCEFKCRDNRTLKA   58 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~---------------------------------~~~~~c~~C~~~~~~~~~l~~   58 (103)
                      -|.|+.|++.|.-..+|..|.|=|..                                 +..|.|..|++.|.....|+.
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            49999999999999999999875521                                 123899999999999999999


Q ss_pred             HHHHhcC
Q psy7454          59 HHINIHT   65 (103)
Q Consensus        59 h~~~~h~   65 (103)
                      | +.+|.
T Consensus       375 H-qlthq  380 (500)
T KOG3993|consen  375 H-QLTHQ  380 (500)
T ss_pred             h-HHhhh
Confidence            8 66654


No 36 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.78  E-value=9.2e-06  Score=49.92  Aligned_cols=50  Identities=26%  Similarity=0.522  Sum_probs=42.0

Q ss_pred             CCceeeCC--CCCcccCchhHHHHHhhcC-------------------CCCCeecCCCCccccCchHHHHH
Q psy7454          10 RYKYVCFA--CKFYTYNTGNIKRHLGMHL-------------------GEKPFTCNMCEFKCRDNRTLKAH   59 (103)
Q Consensus        10 ~~~~~C~~--C~~~f~~~~~l~~h~~~h~-------------------~~~~~~c~~C~~~~~~~~~l~~h   59 (103)
                      ++||+|++  |++.+...-.|+.|+.-..                   ..+||.|.+|++.|+....|+.|
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYH  417 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYH  417 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceec
Confidence            47999998  9999999989999864311                   24899999999999999999887


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.77  E-value=5e-05  Score=34.24  Aligned_cols=32  Identities=25%  Similarity=0.442  Sum_probs=19.9

Q ss_pred             CCCCeeCCCCCccccCcHHHHHHHHhhCCCCC
Q psy7454          66 GQKPYPCRYCDYKARETQALKVHTKRYHPKMY   97 (103)
Q Consensus        66 ~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~   97 (103)
                      .+.|-.|++|+..+.+..+|.+|+.+.++.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            45577788888888888888888877776665


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.62  E-value=7.2e-05  Score=28.69  Aligned_cols=24  Identities=29%  Similarity=0.502  Sum_probs=16.4

Q ss_pred             eeCCCCCccccCcHHHHHHHHhhC
Q psy7454          70 YPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      |.|..|++.|.....+..|+..|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            356777777777777777776543


No 39 
>PRK04860 hypothetical protein; Provisional
Probab=97.60  E-value=8.2e-05  Score=41.96  Aligned_cols=37  Identities=27%  Similarity=0.659  Sum_probs=22.2

Q ss_pred             CeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccC
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARE   81 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~   81 (103)
                      +|.|. |+.   ....+..| .+.+.++++|.|..|+..|..
T Consensus       119 ~Y~C~-C~~---~~~~~rrH-~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRH-NRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEcC-CCC---eeCHHHHH-HHHhcCCccEECCCCCceeEE
Confidence            46665 664   34445555 566666666667666665553


No 40 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.53  E-value=7.3e-05  Score=28.67  Aligned_cols=23  Identities=26%  Similarity=0.521  Sum_probs=14.3

Q ss_pred             eeeCCCCCcccCchhHHHHHhhc
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMH   35 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h   35 (103)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            35666666666666666666544


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.48  E-value=0.0001  Score=28.35  Aligned_cols=22  Identities=18%  Similarity=0.454  Sum_probs=15.3

Q ss_pred             eeeCCCCCcccCchhHHHHHhh
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      |.|..|+..|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4677777777777777777654


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.34  E-value=0.00022  Score=27.18  Aligned_cols=23  Identities=43%  Similarity=0.833  Sum_probs=15.1

Q ss_pred             eeCCCCCccccCcHHHHHHHHhhC
Q psy7454          70 YPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      |.|..|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56777777776 777777777754


No 43 
>PRK04860 hypothetical protein; Provisional
Probab=97.30  E-value=0.00033  Score=39.55  Aligned_cols=38  Identities=24%  Similarity=0.498  Sum_probs=28.3

Q ss_pred             CceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccC
Q psy7454          11 YKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRD   52 (103)
Q Consensus        11 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~   52 (103)
                      .+|.|. |+.   ....+..|.+++.++++|.|..|+..+..
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            468887 875   45567788888888888888888876654


No 44 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.30  E-value=0.00024  Score=27.28  Aligned_cols=22  Identities=18%  Similarity=0.546  Sum_probs=14.8

Q ss_pred             eeCCCCCccccCcHHHHHHHHh
Q psy7454          70 YPCRYCDYKARETQALKVHTKR   91 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~   91 (103)
                      |.|..|+..|.....+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566777777777777776654


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.09  E-value=0.00021  Score=28.13  Aligned_cols=22  Identities=27%  Similarity=0.629  Sum_probs=15.8

Q ss_pred             eeeCCCCCcccCchhHHHHHhh
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      |.|..|++.|.+...+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777654


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.80  E-value=0.0011  Score=25.15  Aligned_cols=21  Identities=43%  Similarity=0.803  Sum_probs=11.7

Q ss_pred             eeeCCCCCcccCchhHHHHHhh
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      |.|+.|+.... ...|..|++.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            45666766655 5566666654


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.56  E-value=0.00069  Score=26.60  Aligned_cols=22  Identities=32%  Similarity=0.534  Sum_probs=13.5

Q ss_pred             eeCCCCCccccCcHHHHHHHHh
Q psy7454          70 YPCRYCDYKARETQALKVHTKR   91 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~   91 (103)
                      |.|..|++.|.....+..|+.+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566666666666666665543


No 48 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.17  E-value=0.0061  Score=23.50  Aligned_cols=19  Identities=37%  Similarity=0.739  Sum_probs=10.5

Q ss_pred             eCCCCCccccCcHHHHHHHH
Q psy7454          71 PCRYCDYKARETQALKVHTK   90 (103)
Q Consensus        71 ~c~~C~~~f~~~~~l~~H~~   90 (103)
                      .|+.||+.| ....|..|+.
T Consensus         4 ~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHHH
Confidence            466666666 4445555543


No 49 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.00  E-value=0.0071  Score=24.99  Aligned_cols=23  Identities=17%  Similarity=0.348  Sum_probs=16.8

Q ss_pred             ceeeCCCCCcccCchhHHHHHhh
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      +|.|+.|+..|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            47788888888877777777643


No 50 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.83  E-value=0.0049  Score=28.38  Aligned_cols=30  Identities=20%  Similarity=0.411  Sum_probs=22.8

Q ss_pred             cCCCCCeeCCCCCccccCcHHHHHHHHhhC
Q psy7454          64 HTGQKPYPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        64 h~~~~~~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      -.||.-+.|+.||..|....++.+|.-..+
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            346777788888888888888888876544


No 51 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.60  E-value=0.0062  Score=28.04  Aligned_cols=28  Identities=14%  Similarity=0.157  Sum_probs=21.6

Q ss_pred             CCCCCCceeeCCCCCcccCchhHHHHHh
Q psy7454           6 PNAYRYKYVCFACKFYTYNTGNIKRHLG   33 (103)
Q Consensus         6 ~h~~~~~~~C~~C~~~f~~~~~l~~h~~   33 (103)
                      +..|+..+.|+.||..|.....+..|..
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhh
Confidence            4567777888888888888877877754


No 52 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=95.40  E-value=0.012  Score=31.12  Aligned_cols=30  Identities=23%  Similarity=0.588  Sum_probs=19.6

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCc
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDN   53 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~   53 (103)
                      -.|+.||..|+.           .+..|.+|+.||..|...
T Consensus        10 R~Cp~CG~kFYD-----------Lnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD-----------LNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc-----------CCCCCccCCCCCCccCcc
Confidence            467777777764           224666777777766655


No 53 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.34  E-value=0.019  Score=23.60  Aligned_cols=10  Identities=40%  Similarity=1.062  Sum_probs=6.0

Q ss_pred             eeeCCCCCcc
Q psy7454          13 YVCFACKFYT   22 (103)
Q Consensus        13 ~~C~~C~~~f   22 (103)
                      |.|.+||..+
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            5666666554


No 54 
>KOG1146|consensus
Probab=95.16  E-value=0.0098  Score=43.34  Aligned_cols=79  Identities=20%  Similarity=0.416  Sum_probs=47.4

Q ss_pred             CCCCceeeCCCCCcccCchhHHHHHhhcC-CCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHH
Q psy7454           8 AYRYKYVCFACKFYTYNTGNIKRHLGMHL-GEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALK   86 (103)
Q Consensus         8 ~~~~~~~C~~C~~~f~~~~~l~~h~~~h~-~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~   86 (103)
                      .-.+-+.|+.|+..|.....|..|+++-. ..+.   .+|.-+-.... +.+- ...-.+.++|.|..|...+.....|.
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~---~~c~~gq~~~~-~arg-~~~~~~~~p~~C~~C~~stttng~Ls  535 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQS---AYCKAGQNHPR-LARG-EVYRCPGKPYPCRACNYSTTTNGNLS  535 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccccccccch---hHhHhcccccc-cccc-ccccCCCCcccceeeeeeeecchHHH
Confidence            33456888888888888888888887632 2221   22211100000 0000 11123457889999999999989999


Q ss_pred             HHHHh
Q psy7454          87 VHTKR   91 (103)
Q Consensus        87 ~H~~~   91 (103)
                      +|+..
T Consensus       536 ihlqS  540 (1406)
T KOG1146|consen  536 IHLQS  540 (1406)
T ss_pred             HHHHH
Confidence            99775


No 55 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.88  E-value=0.0067  Score=38.71  Aligned_cols=58  Identities=24%  Similarity=0.464  Sum_probs=33.0

Q ss_pred             CeecCCCCccccCchHHHHHHHH--hcCCC--CCeeCC--CCCccccCcHHHHHHHHhhCCCCCc
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHIN--IHTGQ--KPYPCR--YCDYKARETQALKVHTKRYHPKMYD   98 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~--~h~~~--~~~~c~--~C~~~f~~~~~l~~H~~~~~~~~~~   98 (103)
                      ++.|..|...+.....+..| ..  .|.++  +++.|.  .|++.|.+...+..|..++.+..++
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~-~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRH-LRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPA  352 (467)
T ss_pred             CCCCccccCCcccccccccc-ccccccccccCCceeeeccCCCccccccccccCCcccccCCCcc
Confidence            34555566666666555555 44  45555  566665  4666666666666665555554443


No 56 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.68  E-value=0.049  Score=27.78  Aligned_cols=25  Identities=24%  Similarity=0.624  Sum_probs=19.7

Q ss_pred             CCeecCCCCccccCchHHHHHHHHhc
Q psy7454          39 KPFTCNMCEFKCRDNRTLKAHHINIH   64 (103)
Q Consensus        39 ~~~~c~~C~~~~~~~~~l~~h~~~~h   64 (103)
                      ..+.|..|+..|.+...|..| ++.+
T Consensus        49 ~~~~C~~C~~~f~s~~~l~~H-m~~~   73 (100)
T PF12756_consen   49 ESFRCPYCNKTFRSREALQEH-MRSK   73 (100)
T ss_dssp             SSEEBSSSS-EESSHHHHHHH-HHHT
T ss_pred             CCCCCCccCCCCcCHHHHHHH-HcCc
Confidence            478999999999999999998 5543


No 57 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.67  E-value=0.01  Score=37.87  Aligned_cols=62  Identities=32%  Similarity=0.536  Sum_probs=52.6

Q ss_pred             CceeeCCCCCcccCchhHHHHHh--hcCCC--CCeecC--CCCccccCchHHHHHHHHhcCCCCCeeCC
Q psy7454          11 YKYVCFACKFYTYNTGNIKRHLG--MHLGE--KPFTCN--MCEFKCRDNRTLKAHHINIHTGQKPYPCR   73 (103)
Q Consensus        11 ~~~~C~~C~~~f~~~~~l~~h~~--~h~~~--~~~~c~--~C~~~~~~~~~l~~h~~~~h~~~~~~~c~   73 (103)
                      .++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.+.....+..| ...|.+..+..+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRH-ILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCC-cccccCCCccccc
Confidence            36889999999999999999998  79999  999999  799999999998887 7778776655544


No 58 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.50  E-value=0.094  Score=27.94  Aligned_cols=80  Identities=14%  Similarity=0.131  Sum_probs=51.6

Q ss_pred             CceeeCCCCCcccCchhHHHHHhhc-----CCC-------CCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcc
Q psy7454          11 YKYVCFACKFYTYNTGNIKRHLGMH-----LGE-------KPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYK   78 (103)
Q Consensus        11 ~~~~C~~C~~~f~~~~~l~~h~~~h-----~~~-------~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~   78 (103)
                      -|..|+.||-.......|.+....-     ..+       ....|-.|...|........   ..-.....|.|..|...
T Consensus        14 LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~---~~~~~~~~y~C~~C~~~   90 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF---DELKDSHRYVCAVCKNV   90 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc---cccccccceeCCCCCCc
Confidence            4788999998888887777542110     011       11247788877765432111   00122347999999999


Q ss_pred             ccCcHHHHHHHHhhC
Q psy7454          79 ARETQALKVHTKRYH   93 (103)
Q Consensus        79 f~~~~~l~~H~~~~~   93 (103)
                      |-..-+.-.|...|.
T Consensus        91 FC~dCD~fiHe~Lh~  105 (112)
T TIGR00622        91 FCVDCDVFVHESLHC  105 (112)
T ss_pred             cccccchhhhhhccC
Confidence            999999889988875


No 59 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=94.11  E-value=0.079  Score=22.38  Aligned_cols=12  Identities=17%  Similarity=0.390  Sum_probs=6.4

Q ss_pred             CCeeCCCCCccc
Q psy7454          68 KPYPCRYCDYKA   79 (103)
Q Consensus        68 ~~~~c~~C~~~f   79 (103)
                      ....|..|+..|
T Consensus        24 ~~vrC~~C~~~f   35 (37)
T PF13719_consen   24 RKVRCPKCGHVF   35 (37)
T ss_pred             cEEECCCCCcEe
Confidence            344566665554


No 60 
>KOG2186|consensus
Probab=94.09  E-value=0.036  Score=33.57  Aligned_cols=44  Identities=18%  Similarity=0.398  Sum_probs=30.2

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHH
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAH   59 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h   59 (103)
                      |.|.+||.... +..+..|+....+ .-|.|..|+..|... ....|
T Consensus         4 FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~~-sYknH   47 (276)
T KOG2186|consen    4 FTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFERV-SYKNH   47 (276)
T ss_pred             Eehhhhhhhcc-ccchHHHHHhccC-CeeEEeecccccccc-hhhhh
Confidence            77888887764 3456678766555 668888888888773 34454


No 61 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=94.00  E-value=0.019  Score=34.10  Aligned_cols=44  Identities=16%  Similarity=0.354  Sum_probs=27.8

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhh---c-------CCCCC-----eecCCCCccccCc
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGM---H-------LGEKP-----FTCNMCEFKCRDN   53 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~---h-------~~~~~-----~~c~~C~~~~~~~   53 (103)
                      ++...||+|+..|..+.......+.   .       .+..|     .+|+.||.++...
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            3468999999999876554444332   1       12333     3788898766544


No 62 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.63  E-value=0.063  Score=29.14  Aligned_cols=32  Identities=13%  Similarity=0.185  Sum_probs=21.7

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchH
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRT   55 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~   55 (103)
                      ..|+.||+.|+.           .++.|..|+.||..+.....
T Consensus        10 r~Cp~cg~kFYD-----------Lnk~p~vcP~cg~~~~~~~~   41 (129)
T TIGR02300        10 RICPNTGSKFYD-----------LNRRPAVSPYTGEQFPPEEA   41 (129)
T ss_pred             ccCCCcCccccc-----------cCCCCccCCCcCCccCcchh
Confidence            478888888764           23467788888877655533


No 63 
>KOG2231|consensus
Probab=93.47  E-value=0.12  Score=35.71  Aligned_cols=77  Identities=14%  Similarity=0.086  Sum_probs=43.3

Q ss_pred             cCchhHHHHHh-hcCCCCCe-------ecCCCCccccCchHHHHHHHHhcCCCCC----eeCCCCCccccCcHHHHHHHH
Q psy7454          23 YNTGNIKRHLG-MHLGEKPF-------TCNMCEFKCRDNRTLKAHHINIHTGQKP----YPCRYCDYKARETQALKVHTK   90 (103)
Q Consensus        23 ~~~~~l~~h~~-~h~~~~~~-------~c~~C~~~~~~~~~l~~h~~~~h~~~~~----~~c~~C~~~f~~~~~l~~H~~   90 (103)
                      .....|+.|++ .|..-...       .+..+.+. -....|..|++....+++.    -.|..|...|.....+.+|++
T Consensus       125 ~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~-Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  125 KSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKL-YTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             hHHHHHHHHHHHhhhhhccccccccceeeeeeeeh-ehHHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhc
Confidence            35677888874 34221111       12222333 3445566664443332221    357788888888888888888


Q ss_pred             hhCCCCCccc
Q psy7454          91 RYHPKMYDVE  100 (103)
Q Consensus        91 ~~~~~~~~~~  100 (103)
                      ..+...-|++
T Consensus       204 ~~h~~chfC~  213 (669)
T KOG2231|consen  204 FDHEFCHFCD  213 (669)
T ss_pred             cceeheeecC
Confidence            7765555554


No 64 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=93.44  E-value=0.12  Score=21.78  Aligned_cols=10  Identities=20%  Similarity=0.351  Sum_probs=4.9

Q ss_pred             eeCCCCCccc
Q psy7454          70 YPCRYCDYKA   79 (103)
Q Consensus        70 ~~c~~C~~~f   79 (103)
                      ..|+.|+..|
T Consensus        26 v~C~~C~~~~   35 (38)
T TIGR02098        26 VRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEE
Confidence            4455555443


No 65 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.21  E-value=0.1  Score=24.45  Aligned_cols=33  Identities=21%  Similarity=0.419  Sum_probs=19.3

Q ss_pred             CCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCc
Q psy7454          39 KPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDY   77 (103)
Q Consensus        39 ~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~   77 (103)
                      -.|.|+.||........-      .-....+|.|+.||.
T Consensus        26 v~F~CPnCGe~~I~Rc~~------CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYRCAK------CRKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeehhhh------HHHcCCceECCCcCc
Confidence            347788888554443321      111345788888874


No 66 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=93.12  E-value=0.17  Score=21.22  Aligned_cols=12  Identities=33%  Similarity=0.648  Sum_probs=6.1

Q ss_pred             ecCCCCccccCc
Q psy7454          42 TCNMCEFKCRDN   53 (103)
Q Consensus        42 ~c~~C~~~~~~~   53 (103)
                      .|+.|+..|.-.
T Consensus         4 ~Cp~C~~~y~i~   15 (36)
T PF13717_consen    4 TCPNCQAKYEID   15 (36)
T ss_pred             ECCCCCCEEeCC
Confidence            455555555443


No 67 
>KOG2186|consensus
Probab=92.79  E-value=0.095  Score=31.82  Aligned_cols=54  Identities=22%  Similarity=0.398  Sum_probs=36.1

Q ss_pred             eecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHHHhhCCCCCc
Q psy7454          41 FTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYD   98 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~   98 (103)
                      |.|.+||.....+. +.+| +....+ .-|.|.-|+..|-. -++..|....+....|
T Consensus         4 FtCnvCgEsvKKp~-vekH-~srCrn-~~fSCIDC~k~F~~-~sYknH~kCITEaQKY   57 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQ-VEKH-MSRCRN-AYFSCIDCGKTFER-VSYKNHTKCITEAQKY   57 (276)
T ss_pred             Eehhhhhhhccccc-hHHH-HHhccC-CeeEEeeccccccc-chhhhhhhhcchHHHh
Confidence            67888887666554 4556 555544 56788888888877 6777777766655444


No 68 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.41  E-value=0.15  Score=21.13  Aligned_cols=11  Identities=27%  Similarity=0.851  Sum_probs=6.9

Q ss_pred             ceeeCCCCCcc
Q psy7454          12 KYVCFACKFYT   22 (103)
Q Consensus        12 ~~~C~~C~~~f   22 (103)
                      .|.|..||..+
T Consensus         2 ~~~C~~CG~i~   12 (34)
T cd00729           2 VWVCPVCGYIH   12 (34)
T ss_pred             eEECCCCCCEe
Confidence            36677777554


No 69 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=92.10  E-value=0.13  Score=29.46  Aligned_cols=24  Identities=29%  Similarity=0.917  Sum_probs=15.5

Q ss_pred             CeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCc
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDY   77 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~   77 (103)
                      -++|.+||..              +.++.|..|+.||-
T Consensus       134 ~~vC~vCGy~--------------~~ge~P~~CPiCga  157 (166)
T COG1592         134 VWVCPVCGYT--------------HEGEAPEVCPICGA  157 (166)
T ss_pred             EEEcCCCCCc--------------ccCCCCCcCCCCCC
Confidence            5778888742              22466777888873


No 70 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=92.06  E-value=0.072  Score=24.14  Aligned_cols=31  Identities=26%  Similarity=0.418  Sum_probs=18.0

Q ss_pred             CceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCc
Q psy7454          11 YKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEF   48 (103)
Q Consensus        11 ~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~   48 (103)
                      +-|.|..||..|.....+      .. .....|+.||.
T Consensus         4 Yey~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (52)
T TIGR02605         4 YEYRCTACGHRFEVLQKM------SD-DPLATCPECGG   34 (52)
T ss_pred             EEEEeCCCCCEeEEEEec------CC-CCCCCCCCCCC
Confidence            347888888777543211      11 34456888875


No 71 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=92.01  E-value=0.22  Score=21.94  Aligned_cols=26  Identities=19%  Similarity=0.581  Sum_probs=14.0

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCcc
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFK   49 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~   49 (103)
                      |.|..||..|...           ...+..|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------CCCceECCCCCce
Confidence            5666666655321           2344566666643


No 72 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=91.93  E-value=0.22  Score=22.01  Aligned_cols=10  Identities=30%  Similarity=0.640  Sum_probs=6.0

Q ss_pred             eeeCCCCCcc
Q psy7454          13 YVCFACKFYT   22 (103)
Q Consensus        13 ~~C~~C~~~f   22 (103)
                      |.|+.||..|
T Consensus         4 y~C~~CG~~~   13 (46)
T PRK00398          4 YKCARCGREV   13 (46)
T ss_pred             EECCCCCCEE
Confidence            5666666554


No 73 
>KOG2893|consensus
Probab=91.70  E-value=0.059  Score=32.51  Aligned_cols=47  Identities=23%  Similarity=0.484  Sum_probs=36.3

Q ss_pred             eCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcC
Q psy7454          15 CFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHT   65 (103)
Q Consensus        15 C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~   65 (103)
                      |=.|++.|..+..|..|++.    +-|.|-+|.+.+.+-..|..|.+.+|-
T Consensus        13 cwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvhk   59 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVHK   59 (341)
T ss_pred             eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhhh
Confidence            66799999988888888653    557899998888887777777666653


No 74 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.24  E-value=0.17  Score=28.64  Aligned_cols=35  Identities=14%  Similarity=0.287  Sum_probs=22.0

Q ss_pred             cCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccc
Q psy7454          35 HLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKA   79 (103)
Q Consensus        35 h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f   79 (103)
                      .....-|.|+.|+..|.....+.          ..|.|+.||...
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME----------LNFTCPRCGAML  138 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH----------cCCcCCCCCCEe
Confidence            34455678888887776644431          247888888643


No 75 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=90.76  E-value=0.12  Score=22.03  Aligned_cols=30  Identities=23%  Similarity=0.312  Sum_probs=16.1

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCc
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEF   48 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~   48 (103)
                      -|.|+.||..|......      .. .....|+.||.
T Consensus         5 ~y~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (41)
T smart00834        5 EYRCEDCGHTFEVLQKI------SD-DPLATCPECGG   34 (41)
T ss_pred             EEEcCCCCCEEEEEEec------CC-CCCCCCCCCCC
Confidence            46777777766432221      11 33446777775


No 76 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=90.61  E-value=0.31  Score=22.87  Aligned_cols=33  Identities=21%  Similarity=0.474  Sum_probs=18.9

Q ss_pred             CCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCc
Q psy7454          39 KPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDY   77 (103)
Q Consensus        39 ~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~   77 (103)
                      -.|.|+.||........-      --....+|.|+.||.
T Consensus        24 ~~F~CPnCG~~~I~RC~~------CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCEK------CRKQSNPYTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeechh------HHhcCCceECCCCCC
Confidence            447888888763332211      111246788888884


No 77 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=90.42  E-value=0.18  Score=29.20  Aligned_cols=33  Identities=15%  Similarity=0.433  Sum_probs=19.8

Q ss_pred             CCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccc
Q psy7454          37 GEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKA   79 (103)
Q Consensus        37 ~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f   79 (103)
                      ...-|.|+.|+..|.....+          +..|.|+.||...
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~----------~~~F~Cp~Cg~~L  146 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAM----------EYGFRCPQCGEML  146 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHh----------hcCCcCCCCCCCC
Confidence            34557777777766554332          1247777777543


No 78 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=90.38  E-value=0.72  Score=25.79  Aligned_cols=39  Identities=13%  Similarity=0.335  Sum_probs=24.8

Q ss_pred             CCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          37 GEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        37 ~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      ...-|.|+.|+..|.....+.    .... ...|.|+.||....
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~----~~d~-~~~f~Cp~Cg~~l~  134 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQ----LLDM-DGTFTCPRCGEELE  134 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHH----hcCC-CCcEECCCCCCEEE
Confidence            445689999998887644321    1122 33489999997543


No 79 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=89.75  E-value=0.21  Score=21.70  Aligned_cols=30  Identities=20%  Similarity=0.453  Sum_probs=16.8

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCc
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEF   48 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~   48 (103)
                      -|.|..||..|.....      ... ..+..|+.||.
T Consensus         5 ey~C~~Cg~~fe~~~~------~~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQS------ISE-DDPVPCPECGS   34 (42)
T ss_pred             EEEeCCCCCEEEEEEE------cCC-CCCCcCCCCCC
Confidence            4777777777643221      111 34456777775


No 80 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=89.71  E-value=0.24  Score=20.80  Aligned_cols=9  Identities=22%  Similarity=0.556  Sum_probs=5.0

Q ss_pred             eeCCCCCcc
Q psy7454          14 VCFACKFYT   22 (103)
Q Consensus        14 ~C~~C~~~f   22 (103)
                      .|+.||..|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            455565554


No 81 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=89.36  E-value=0.21  Score=27.48  Aligned_cols=28  Identities=25%  Similarity=0.267  Sum_probs=17.3

Q ss_pred             CCCeeCCCCCccccCcHHHHHHHHhhCCCCC
Q psy7454          67 QKPYPCRYCDYKARETQALKVHTKRYHPKMY   97 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~~~l~~H~~~~~~~~~   97 (103)
                      +....|.+||+.|..   |++|++.|+|-.|
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCCCH
Confidence            334689999998886   5899999987654


No 82 
>PHA00626 hypothetical protein
Probab=89.17  E-value=0.37  Score=22.34  Aligned_cols=15  Identities=13%  Similarity=0.567  Sum_probs=9.3

Q ss_pred             CCCeecCCCCccccC
Q psy7454          38 EKPFTCNMCEFKCRD   52 (103)
Q Consensus        38 ~~~~~c~~C~~~~~~   52 (103)
                      ...|.|..||..|..
T Consensus        21 snrYkCkdCGY~ft~   35 (59)
T PHA00626         21 SDDYVCCDCGYNDSK   35 (59)
T ss_pred             CcceEcCCCCCeech
Confidence            455677777765544


No 83 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=88.90  E-value=0.48  Score=24.98  Aligned_cols=26  Identities=27%  Similarity=0.668  Sum_probs=23.5

Q ss_pred             CeeC----CCCCccccCcHHHHHHHHhhCC
Q psy7454          69 PYPC----RYCDYKARETQALKVHTKRYHP   94 (103)
Q Consensus        69 ~~~c----~~C~~~f~~~~~l~~H~~~~~~   94 (103)
                      .|.|    ..|+....+...+..|.+.+||
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3889    9999999999999999998875


No 84 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=88.53  E-value=0.72  Score=29.61  Aligned_cols=75  Identities=28%  Similarity=0.599  Sum_probs=51.4

Q ss_pred             eeCCCCCcccCchhHHHHHhhcCCCCCeecCCCC----ccccCchHHHHHHHHhcCCCCCeeCCC--CC----ccccCcH
Q psy7454          14 VCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCE----FKCRDNRTLKAHHINIHTGQKPYPCRY--CD----YKARETQ   83 (103)
Q Consensus        14 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~----~~~~~~~~l~~h~~~~h~~~~~~~c~~--C~----~~f~~~~   83 (103)
                      .|..|...|.+...|..|++... ++-+.|+.-+    +-|+.-..|..|     ...-.|.|.+  |-    .+|....
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~H-E~ChICD~v~p~~~QYFK~Y~~Le~H-----F~~~hy~ct~qtc~~~k~~vf~~~~  295 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRH-EACHICDMVGPIRYQYFKSYEDLEAH-----FRNAHYCCTFQTCRVGKCYVFPYHT  295 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhh-hhhhhhhccCccchhhhhCHHHHHHH-----hhcCceEEEEEEEecCcEEEeccHH
Confidence            59999999999999999988743 6666666544    234444555554     3333455542  22    4789999


Q ss_pred             HHHHHHHhhCC
Q psy7454          84 ALKVHTKRYHP   94 (103)
Q Consensus        84 ~l~~H~~~~~~   94 (103)
                      .|..|+...++
T Consensus       296 el~~h~~~~h~  306 (493)
T COG5236         296 ELLEHLTRFHK  306 (493)
T ss_pred             HHHHHHHHHhh
Confidence            99999887654


No 85 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=87.89  E-value=0.58  Score=20.31  Aligned_cols=23  Identities=39%  Similarity=0.642  Sum_probs=11.4

Q ss_pred             CCeeCCCCCccccC----cHHHHHHHH
Q psy7454          68 KPYPCRYCDYKARE----TQALKVHTK   90 (103)
Q Consensus        68 ~~~~c~~C~~~f~~----~~~l~~H~~   90 (103)
                      ....|..|++.+..    .+.|..|++
T Consensus        15 ~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   15 KKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             S-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             CeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            34566666665554    356666664


No 86 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=87.31  E-value=0.15  Score=20.23  Aligned_cols=9  Identities=22%  Similarity=0.567  Sum_probs=4.4

Q ss_pred             ecCCCCccc
Q psy7454          42 TCNMCEFKC   50 (103)
Q Consensus        42 ~c~~C~~~~   50 (103)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344555544


No 87 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=86.76  E-value=0.67  Score=24.60  Aligned_cols=26  Identities=12%  Similarity=0.064  Sum_probs=16.9

Q ss_pred             eeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccc
Q psy7454          14 VCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKC   50 (103)
Q Consensus        14 ~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~   50 (103)
                      .|+.||+.|+.           ....|.+|+.||+.|
T Consensus        11 idPetg~KFYD-----------LNrdPiVsPytG~s~   36 (129)
T COG4530          11 IDPETGKKFYD-----------LNRDPIVSPYTGKSY   36 (129)
T ss_pred             cCccccchhhc-----------cCCCccccCcccccc
Confidence            56777776653           234666777777777


No 88 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=86.27  E-value=0.72  Score=20.85  Aligned_cols=11  Identities=27%  Similarity=0.618  Sum_probs=6.2

Q ss_pred             ceeeCCCCCcc
Q psy7454          12 KYVCFACKFYT   22 (103)
Q Consensus        12 ~~~C~~C~~~f   22 (103)
                      .|.|..||+.|
T Consensus         6 ~Y~C~~Cg~~~   16 (49)
T COG1996           6 EYKCARCGREV   16 (49)
T ss_pred             EEEhhhcCCee
Confidence            45566665554


No 89 
>PF14353 CpXC:  CpXC protein
Probab=86.07  E-value=0.11  Score=28.20  Aligned_cols=47  Identities=21%  Similarity=0.157  Sum_probs=25.2

Q ss_pred             eeeCCCCCcccCchhHHHH--------HhhcC-CCCCeecCCCCccccCchHHHHH
Q psy7454          13 YVCFACKFYTYNTGNIKRH--------LGMHL-GEKPFTCNMCEFKCRDNRTLKAH   59 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h--------~~~h~-~~~~~~c~~C~~~~~~~~~l~~h   59 (103)
                      .+|+.|+..|.........        .++-. .--.+.|+.||..+.....+..|
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~Cg~~~~~~~p~lY~   57 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPSCGHKFRLEYPLLYH   57 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCCCCCceecCCCEEEE
Confidence            4688998877542110000        01111 12347899999877666555443


No 90 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=85.90  E-value=0.19  Score=28.44  Aligned_cols=15  Identities=13%  Similarity=0.239  Sum_probs=10.3

Q ss_pred             eecCCCCccccCchH
Q psy7454          41 FTCNMCEFKCRDNRT   55 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~   55 (103)
                      +.|+.||..|.....
T Consensus        29 ~~c~~c~~~f~~~e~   43 (154)
T PRK00464         29 RECLACGKRFTTFER   43 (154)
T ss_pred             eeccccCCcceEeEe
Confidence            678888877766543


No 91 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=85.61  E-value=1.3  Score=19.86  Aligned_cols=21  Identities=29%  Similarity=0.705  Sum_probs=11.9

Q ss_pred             eeCCCCCccccCc-----HHHHHHHH
Q psy7454          70 YPCRYCDYKARET-----QALKVHTK   90 (103)
Q Consensus        70 ~~c~~C~~~f~~~-----~~l~~H~~   90 (103)
                      -.|..|++.+...     +.|.+|+.
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            3566666555443     46666666


No 92 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=85.15  E-value=1.1  Score=17.25  Aligned_cols=19  Identities=16%  Similarity=0.396  Sum_probs=11.2

Q ss_pred             eCCCCCccccCcHHHHHHHH
Q psy7454          71 PCRYCDYKARETQALKVHTK   90 (103)
Q Consensus        71 ~c~~C~~~f~~~~~l~~H~~   90 (103)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            466676665 4455566654


No 93 
>KOG2593|consensus
Probab=84.59  E-value=0.91  Score=29.88  Aligned_cols=33  Identities=21%  Similarity=0.435  Sum_probs=14.1

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCC
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCE   47 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~   47 (103)
                      .|.|+.|++.|..   |.+-+..-.....|.|..|+
T Consensus       128 ~Y~Cp~C~kkyt~---Lea~~L~~~~~~~F~C~~C~  160 (436)
T KOG2593|consen  128 GYVCPNCQKKYTS---LEALQLLDNETGEFHCENCG  160 (436)
T ss_pred             cccCCccccchhh---hHHHHhhcccCceEEEecCC
Confidence            4555555554432   33333333333344555554


No 94 
>KOG4173|consensus
Probab=83.66  E-value=0.32  Score=28.83  Aligned_cols=78  Identities=26%  Similarity=0.463  Sum_probs=49.7

Q ss_pred             eeeCC--CCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcC---------CCCCeeCC--CCCccc
Q psy7454          13 YVCFA--CKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHT---------GQKPYPCR--YCDYKA   79 (103)
Q Consensus        13 ~~C~~--C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~---------~~~~~~c~--~C~~~f   79 (103)
                      +.|++  |-..|..-..+..|..+-.+   -.|+.|.+.|.+...|..|+...|.         |.--|.|.  .|+..|
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KF  156 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKF  156 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhh
Confidence            55666  44555555555555433222   2589999999888888777443332         33347775  488889


Q ss_pred             cCcHHHHHHHHhhC
Q psy7454          80 RETQALKVHTKRYH   93 (103)
Q Consensus        80 ~~~~~l~~H~~~~~   93 (103)
                      .+...-+.|+-..+
T Consensus       157 kT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  157 KTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhHHHHhc
Confidence            88888888876543


No 95 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=83.43  E-value=1.9  Score=17.60  Aligned_cols=10  Identities=30%  Similarity=0.753  Sum_probs=4.8

Q ss_pred             eeeCCCCCcc
Q psy7454          13 YVCFACKFYT   22 (103)
Q Consensus        13 ~~C~~C~~~f   22 (103)
                      |.|..||..+
T Consensus         1 Y~C~~Cg~~~   10 (32)
T PF03604_consen    1 YICGECGAEV   10 (32)
T ss_dssp             EBESSSSSSE
T ss_pred             CCCCcCCCee
Confidence            3455555443


No 96 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=83.33  E-value=0.77  Score=25.34  Aligned_cols=25  Identities=20%  Similarity=0.001  Sum_probs=19.0

Q ss_pred             eeCCCCCccccCcHHHHHHHHhhCCCCC
Q psy7454          70 YPCRYCDYKARETQALKVHTKRYHPKMY   97 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~   97 (103)
                      ..|.++|+.|.+   |++|+.+|++-.|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            478888888764   7888888876554


No 97 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=82.62  E-value=1.2  Score=19.33  Aligned_cols=12  Identities=17%  Similarity=0.562  Sum_probs=6.1

Q ss_pred             CCCeecCCCCcc
Q psy7454          38 EKPFTCNMCEFK   49 (103)
Q Consensus        38 ~~~~~c~~C~~~   49 (103)
                      ...+.|..||..
T Consensus        17 ~g~~vC~~CG~V   28 (43)
T PF08271_consen   17 RGELVCPNCGLV   28 (43)
T ss_dssp             TTEEEETTT-BB
T ss_pred             CCeEECCCCCCE
Confidence            344566666644


No 98 
>KOG2893|consensus
Probab=82.58  E-value=0.29  Score=29.65  Aligned_cols=41  Identities=27%  Similarity=0.557  Sum_probs=31.9

Q ss_pred             cCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHH
Q psy7454          43 CNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVH   88 (103)
Q Consensus        43 c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H   88 (103)
                      |=+|...|.....|.+| +    ..+.|+|-+|-+..-+--.|..|
T Consensus        13 cwycnrefddekiliqh-q----kakhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQH-Q----KAKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             eeecccccchhhhhhhh-h----hhccceeeeehhhhccCCCceee
Confidence            66799999999988887 4    45678999998876666666665


No 99 
>KOG4173|consensus
Probab=82.34  E-value=0.69  Score=27.47  Aligned_cols=50  Identities=18%  Similarity=0.440  Sum_probs=35.8

Q ss_pred             CCeecCC--CCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHHHhh
Q psy7454          39 KPFTCNM--CEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRY   92 (103)
Q Consensus        39 ~~~~c~~--C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~   92 (103)
                      ..+.|++  |...+........|....|..    .|.+|.++|++.-.|..|+.--
T Consensus        78 ~~~~cqvagc~~~~d~lD~~E~hY~~~h~~----sCs~C~r~~Pt~hLLd~HI~E~  129 (253)
T KOG4173|consen   78 PAFACQVAGCCQVFDALDDYEHHYHTLHGN----SCSFCKRAFPTGHLLDAHILEW  129 (253)
T ss_pred             ccccccccchHHHHhhhhhHHHhhhhcccc----hhHHHHHhCCchhhhhHHHHHH
Confidence            3466765  666777766666654344443    7999999999999999997653


No 100
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=81.94  E-value=1.3  Score=19.08  Aligned_cols=24  Identities=21%  Similarity=0.253  Sum_probs=16.7

Q ss_pred             eeeCCCCCcccC--chhHHHHHhhcC
Q psy7454          13 YVCFACKFYTYN--TGNIKRHLGMHL   36 (103)
Q Consensus        13 ~~C~~C~~~f~~--~~~l~~h~~~h~   36 (103)
                      -+|+.||..|..  ...-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            579999988765  345566766653


No 101
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=81.83  E-value=0.94  Score=18.22  Aligned_cols=9  Identities=22%  Similarity=0.748  Sum_probs=4.6

Q ss_pred             CCeecCCCC
Q psy7454          39 KPFTCNMCE   47 (103)
Q Consensus        39 ~~~~c~~C~   47 (103)
                      ..++|+.|+
T Consensus        18 ~~~vCp~C~   26 (30)
T PF08274_consen   18 ELLVCPECG   26 (30)
T ss_dssp             SSEEETTTT
T ss_pred             CEEeCCccc
Confidence            345555554


No 102
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=81.80  E-value=0.83  Score=17.38  Aligned_cols=9  Identities=33%  Similarity=1.017  Sum_probs=7.3

Q ss_pred             ceeeCCCCC
Q psy7454          12 KYVCFACKF   20 (103)
Q Consensus        12 ~~~C~~C~~   20 (103)
                      .|.|+.||.
T Consensus        16 ~f~CPnCG~   24 (24)
T PF07754_consen   16 PFPCPNCGF   24 (24)
T ss_pred             eEeCCCCCC
Confidence            689999984


No 103
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=80.49  E-value=1.5  Score=20.15  Aligned_cols=34  Identities=18%  Similarity=0.372  Sum_probs=15.9

Q ss_pred             CceeeCC--CCCcccCchhHHHHHhhcCCCCCeecCC
Q psy7454          11 YKYVCFA--CKFYTYNTGNIKRHLGMHLGEKPFTCNM   45 (103)
Q Consensus        11 ~~~~C~~--C~~~f~~~~~l~~h~~~h~~~~~~~c~~   45 (103)
                      .+..|+.  |...+ .+..|..|....-..++..|..
T Consensus         8 ~~v~C~~~cc~~~i-~r~~l~~H~~~~C~~~~v~C~~   43 (60)
T PF02176_consen    8 RPVPCPNGCCNEMI-PRKELDDHLENECPKRPVPCPY   43 (60)
T ss_dssp             SEEE-TT--S-BEE-ECCCHHHHHHTTSTTSEEE-SS
T ss_pred             CEeeCCCCCcccce-eHHHHHHHHHccCCCCcEECCC
Confidence            3455655  33323 3445666665444455556666


No 104
>KOG1280|consensus
Probab=80.41  E-value=2.3  Score=27.34  Aligned_cols=37  Identities=16%  Similarity=0.489  Sum_probs=23.1

Q ss_pred             CceeeCCCCCcccCchhHHHHHh-hcCCC-CCeecCCCC
Q psy7454          11 YKYVCFACKFYTYNTGNIKRHLG-MHLGE-KPFTCNMCE   47 (103)
Q Consensus        11 ~~~~C~~C~~~f~~~~~l~~h~~-~h~~~-~~~~c~~C~   47 (103)
                      ..|.|+.|+..-.....|..|.. .|... -..+|++|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            36888888877777777777754 34322 223566664


No 105
>KOG4167|consensus
Probab=80.30  E-value=0.33  Score=34.03  Aligned_cols=27  Identities=15%  Similarity=0.284  Sum_probs=23.2

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhhcC
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGMHL   36 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~h~   36 (103)
                      ...|.|..|++.|....++.+||++|.
T Consensus       790 ~giFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  790 TGIFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             CceeehHHHHHHHHHHhhhhHHHHHHH
Confidence            346999999999988888999999885


No 106
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=80.13  E-value=1.6  Score=19.73  Aligned_cols=13  Identities=15%  Similarity=0.181  Sum_probs=6.8

Q ss_pred             ceeeCCCCCcccC
Q psy7454          12 KYVCFACKFYTYN   24 (103)
Q Consensus        12 ~~~C~~C~~~f~~   24 (103)
                      .+.|..||..|..
T Consensus         4 ~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    4 TLTCKDCGAEFVF   16 (49)
T ss_pred             eEEcccCCCeEEE
Confidence            4555555555543


No 107
>KOG1146|consensus
Probab=79.58  E-value=0.21  Score=37.02  Aligned_cols=75  Identities=17%  Similarity=0.219  Sum_probs=49.2

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhc-----------------CCCCCeeCCCC
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIH-----------------TGQKPYPCRYC   75 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h-----------------~~~~~~~c~~C   75 (103)
                      +.|..|+..+.....+. +   -....+|.|..|...|...+.|..| .+.-                 ..-.+| |..|
T Consensus      1261 ~~c~~~~~~~~~~~~~~-~---l~~~~~~~~~~~~~~~~~~~~l~~~-~~k~~~~~~~~~~~~~~~l~~~d~~~~-c~~c 1334 (1406)
T KOG1146|consen 1261 GECGAVDELLTPSFGIS-T---LDVTHRYLCRQCKMAFDGEAPLTAH-QRKFCFAGRGSGGSMPPPLRVPDCTYH-CLAC 1334 (1406)
T ss_pred             chhhhccccccCcccee-e---cccchhHHHHHHHhhhcchhHHHHH-HHHHHhccCccccCCCCcccCcccccc-chHH
Confidence            66777776665544333 2   1234567777777777777777776 3221                 112345 8999


Q ss_pred             CccccCcHHHHHHHHhhC
Q psy7454          76 DYKARETQALKVHTKRYH   93 (103)
Q Consensus        76 ~~~f~~~~~l~~H~~~~~   93 (103)
                      ...|.....|..|++...
T Consensus      1335 ~~~~~~~~alqihm~~~~ 1352 (1406)
T KOG1146|consen 1335 EVLLSGREALQIHMRSSA 1352 (1406)
T ss_pred             HhhcchhHHHHHHHHHhh
Confidence            999999999999988744


No 108
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=79.49  E-value=0.4  Score=28.91  Aligned_cols=25  Identities=8%  Similarity=0.114  Sum_probs=17.0

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhh
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      ++...||+|+..|..+..+..-.++
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRi   41 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRI   41 (267)
T ss_pred             hceeccCcccchhhhhheeccceeE
Confidence            3457899999988766555444444


No 109
>KOG2785|consensus
Probab=79.31  E-value=2.3  Score=27.65  Aligned_cols=80  Identities=11%  Similarity=0.186  Sum_probs=45.9

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCe---e---cCCCCccccCchHHHHH--HHHhcCCCCCeeCCCCCccccCcH
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPF---T---CNMCEFKCRDNRTLKAH--HINIHTGQKPYPCRYCDYKARETQ   83 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~---~---c~~C~~~~~~~~~l~~h--~~~~h~~~~~~~c~~C~~~f~~~~   83 (103)
                      .|+|..|...|........|.++....-..   +   .++-...|........-  -...-....++.|..|.+.|....
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            489999999999887778888763211110   1   12221222211110000  000122345788999999999998


Q ss_pred             HHHHHHHh
Q psy7454          84 ALKVHTKR   91 (103)
Q Consensus        84 ~l~~H~~~   91 (103)
                      ....|+..
T Consensus        83 a~~~hl~S   90 (390)
T KOG2785|consen   83 AHENHLKS   90 (390)
T ss_pred             hHHHHHHH
Confidence            88888765


No 110
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=79.23  E-value=1.1  Score=22.80  Aligned_cols=32  Identities=22%  Similarity=0.474  Sum_probs=20.2

Q ss_pred             CCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          38 EKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        38 ~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      ...|.|+.|++.-     +    .+.-  ...|.|..||..|.
T Consensus        33 ~~~~~Cp~C~~~~-----V----kR~a--~GIW~C~kCg~~fA   64 (89)
T COG1997          33 RAKHVCPFCGRTT-----V----KRIA--TGIWKCRKCGAKFA   64 (89)
T ss_pred             hcCCcCCCCCCcc-----e----eeec--cCeEEcCCCCCeec
Confidence            3557899998531     1    2222  33688999988775


No 111
>KOG3408|consensus
Probab=78.96  E-value=1.3  Score=23.96  Aligned_cols=26  Identities=19%  Similarity=0.453  Sum_probs=21.5

Q ss_pred             CCCceeeCCCCCcccCchhHHHHHhh
Q psy7454           9 YRYKYVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus         9 ~~~~~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      |-..|-|-.|.+.|.+...|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            34468899999999999999999765


No 112
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=78.67  E-value=1.1  Score=17.33  Aligned_cols=11  Identities=18%  Similarity=0.386  Sum_probs=7.6

Q ss_pred             eeeCCCCCccc
Q psy7454          13 YVCFACKFYTY   23 (103)
Q Consensus        13 ~~C~~C~~~f~   23 (103)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            35788887764


No 113
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=77.82  E-value=2.5  Score=22.28  Aligned_cols=24  Identities=21%  Similarity=0.538  Sum_probs=17.9

Q ss_pred             ceee----CCCCCcccCchhHHHHHhhc
Q psy7454          12 KYVC----FACKFYTYNTGNIKRHLGMH   35 (103)
Q Consensus        12 ~~~C----~~C~~~f~~~~~l~~h~~~h   35 (103)
                      .|.|    ..|+..+.+...+..|.+.+
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~  107 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKE  107 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHh
Confidence            4778    78888777777788887654


No 114
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=77.75  E-value=4.6  Score=17.84  Aligned_cols=23  Identities=30%  Similarity=0.748  Sum_probs=14.5

Q ss_pred             ceeeCCCCCcccCchhHHHHHhh
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      .|.|-+|......++.|-.||+.
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHH
Confidence            36677776666666666666653


No 115
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=77.62  E-value=2  Score=24.28  Aligned_cols=33  Identities=24%  Similarity=0.674  Sum_probs=15.5

Q ss_pred             CCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCc
Q psy7454          39 KPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDY   77 (103)
Q Consensus        39 ~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~   77 (103)
                      -+|.|. |+..+...   .+| ...-.|+ .|.|..|+.
T Consensus       116 ~~Y~C~-C~q~~l~~---RRh-n~~~~g~-~YrC~~C~g  148 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRH-NTVRRGE-VYRCGKCGG  148 (156)
T ss_pred             eeEEee-cCCccchh---hhc-ccccccc-eEEeccCCc
Confidence            456666 66554332   222 1222233 566666654


No 116
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=77.15  E-value=2  Score=30.53  Aligned_cols=34  Identities=18%  Similarity=0.513  Sum_probs=15.6

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCC
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCE   47 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~   47 (103)
                      ..|..||..+.-+.- ..-+..|.......|-.||
T Consensus       436 l~C~~Cg~v~~Cp~C-d~~lt~H~~~~~L~CH~Cg  469 (730)
T COG1198         436 LLCRDCGYIAECPNC-DSPLTLHKATGQLRCHYCG  469 (730)
T ss_pred             eecccCCCcccCCCC-CcceEEecCCCeeEeCCCC
Confidence            346666655543211 0012334444555666665


No 117
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=77.00  E-value=2  Score=26.55  Aligned_cols=81  Identities=22%  Similarity=0.454  Sum_probs=41.4

Q ss_pred             CCCceeeCCCCCcccCchhHHHHHhhc--CCCCCeecCCCCccccCc------hHHHHHHHHh----cCCCCCeeCCCCC
Q psy7454           9 YRYKYVCFACKFYTYNTGNIKRHLGMH--LGEKPFTCNMCEFKCRDN------RTLKAHHINI----HTGQKPYPCRYCD   76 (103)
Q Consensus         9 ~~~~~~C~~C~~~f~~~~~l~~h~~~h--~~~~~~~c~~C~~~~~~~------~~l~~h~~~~----h~~~~~~~c~~C~   76 (103)
                      |.+.|.|..|+...-....|. |+.+-  .....|.|..|.+.-..+      ..-..| .+.    ....+++.|+.||
T Consensus       139 GGrif~CsfC~~flCEDDQFE-HQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddH-vrrKg~ky~k~k~~PCPKCg  216 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCEDDQFE-HQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDH-VRRKGFKYEKGKPIPCPKCG  216 (314)
T ss_pred             CCeEEEeecCCCeeeccchhh-hhhhhhhhhcccccccccccccchhhhheeeeehhhh-hhhcccccccCCCCCCCCCC
Confidence            456899999974433333343 55432  234456666665321111      001122 111    2234688999999


Q ss_pred             ccccCcHHHHHHHHh
Q psy7454          77 YKARETQALKVHTKR   91 (103)
Q Consensus        77 ~~f~~~~~l~~H~~~   91 (103)
                      ........|..-.++
T Consensus       217 ~et~eTkdLSmStR~  231 (314)
T PF06524_consen  217 YETQETKDLSMSTRS  231 (314)
T ss_pred             Ccccccccceeeeec
Confidence            776666555443333


No 118
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=76.95  E-value=1.5  Score=24.20  Aligned_cols=13  Identities=15%  Similarity=0.023  Sum_probs=7.5

Q ss_pred             ceeeCCCCCcccC
Q psy7454          12 KYVCFACKFYTYN   24 (103)
Q Consensus        12 ~~~C~~C~~~f~~   24 (103)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            3566666655543


No 119
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=76.18  E-value=2.3  Score=25.50  Aligned_cols=26  Identities=19%  Similarity=0.487  Sum_probs=14.6

Q ss_pred             CCeecCCCCccccCchHHHHHHHHhc
Q psy7454          39 KPFTCNMCEFKCRDNRTLKAHHINIH   64 (103)
Q Consensus        39 ~~~~c~~C~~~~~~~~~l~~h~~~~h   64 (103)
                      ..|.|..|++.|.....+..|+...|
T Consensus        76 ~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   76 DKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             CEECCCCCCcccCChHHHHHHHhhcC
Confidence            34667777777777777777644334


No 120
>KOG2593|consensus
Probab=76.01  E-value=3.8  Score=27.20  Aligned_cols=38  Identities=16%  Similarity=0.400  Sum_probs=26.9

Q ss_pred             CCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCc
Q psy7454          36 LGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDY   77 (103)
Q Consensus        36 ~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~   77 (103)
                      +...-|.|+.|.+.|.....++    ......--|.|..|+-
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~----L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ----LLDNETGEFHCENCGG  161 (436)
T ss_pred             cccccccCCccccchhhhHHHH----hhcccCceEEEecCCC
Confidence            4566799999999998766543    3333344689999984


No 121
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=75.43  E-value=2.9  Score=19.34  Aligned_cols=10  Identities=20%  Similarity=0.514  Sum_probs=6.1

Q ss_pred             eeeCCCCCcc
Q psy7454          13 YVCFACKFYT   22 (103)
Q Consensus        13 ~~C~~C~~~f   22 (103)
                      +.|+.||..+
T Consensus         3 ~~CP~CG~~i   12 (54)
T TIGR01206         3 FECPDCGAEI   12 (54)
T ss_pred             cCCCCCCCEE
Confidence            4666666554


No 122
>KOG4167|consensus
Probab=74.51  E-value=0.68  Score=32.57  Aligned_cols=25  Identities=24%  Similarity=0.462  Sum_probs=22.6

Q ss_pred             CeeCCCCCccccCcHHHHHHHHhhC
Q psy7454          69 PYPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        69 ~~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      .|.|..|+++|.-..++..||++|-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4899999999999999999999884


No 123
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=74.14  E-value=1.4  Score=21.62  Aligned_cols=42  Identities=12%  Similarity=0.214  Sum_probs=20.2

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecC--CCCccccCchHH
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCN--MCEFKCRDNRTL   56 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~--~C~~~~~~~~~l   56 (103)
                      +.|+.||..-.-..+-...  ....+.-+.|.  .||..|.....+
T Consensus         2 m~CP~Cg~~a~irtSr~~s--~~~~~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678          2 FHCPLCQHAAHARTSRYIT--DTTKERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             ccCCCCCCccEEEEChhcC--hhhheeeeecCCCCCCCEEEEEEEE
Confidence            4677777543221111111  11334456676  777777665443


No 124
>KOG2785|consensus
Probab=73.58  E-value=5.8  Score=25.93  Aligned_cols=50  Identities=18%  Similarity=0.424  Sum_probs=33.5

Q ss_pred             eecCCCCccccCchHHHHHHHHhcCC-----------------------CCCeeCCCCC---ccccCcHHHHHHHHh
Q psy7454          41 FTCNMCEFKCRDNRTLKAHHINIHTG-----------------------QKPYPCRYCD---YKARETQALKVHTKR   91 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~l~~h~~~~h~~-----------------------~~~~~c~~C~---~~f~~~~~l~~H~~~   91 (103)
                      -.|..|+..+.....-..| |..+.+                       .+.+.|..|.   +.|.+......||..
T Consensus       167 t~CLfC~~~~k~~e~~~~H-M~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  167 TDCLFCDKKSKSLEENLKH-MFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cceeecCCCcccHHHHHHH-HhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            3566666666666555555 433322                       2447888888   889988899999875


No 125
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=73.05  E-value=1.9  Score=25.84  Aligned_cols=29  Identities=17%  Similarity=0.458  Sum_probs=22.3

Q ss_pred             CCCeeCCCCCccccCcHHHHHHHHhhCCC
Q psy7454          67 QKPYPCRYCDYKARETQALKVHTKRYHPK   95 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~~~l~~H~~~~~~~   95 (103)
                      +..|.|..|++.|.-.-....|+..-|.|
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            45699999999999999999999876644


No 126
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=72.47  E-value=0.91  Score=23.30  Aligned_cols=31  Identities=26%  Similarity=0.652  Sum_probs=19.0

Q ss_pred             CCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          39 KPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        39 ~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      ..|.|+.||+.-     +    .+.-.+  .|.|..|++.|.
T Consensus        34 ~ky~Cp~Cgk~~-----v----kR~a~G--IW~C~~C~~~~A   64 (90)
T PF01780_consen   34 AKYTCPFCGKTS-----V----KRVATG--IWKCKKCGKKFA   64 (90)
T ss_dssp             S-BEESSSSSSE-----E----EEEETT--EEEETTTTEEEE
T ss_pred             CCCcCCCCCCce-----e----EEeeeE--EeecCCCCCEEe
Confidence            567888888643     1    122333  488888887664


No 127
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=71.92  E-value=1.5  Score=19.06  Aligned_cols=14  Identities=14%  Similarity=0.245  Sum_probs=10.9

Q ss_pred             eCCCCCccccCcHH
Q psy7454          71 PCRYCDYKARETQA   84 (103)
Q Consensus        71 ~c~~C~~~f~~~~~   84 (103)
                      .|.+||+.|.+..-
T Consensus        10 ~C~~C~rpf~WRKK   23 (42)
T PF10013_consen   10 ICPVCGRPFTWRKK   23 (42)
T ss_pred             cCcccCCcchHHHH
Confidence            68899998887643


No 128
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=71.42  E-value=1.1  Score=23.45  Aligned_cols=37  Identities=14%  Similarity=0.357  Sum_probs=18.2

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccC
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRD   52 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~   52 (103)
                      .|.|+.||..-.....+.    .-.......|..||..|..
T Consensus        22 ~FtCp~Cghe~vs~ctvk----k~~~~g~~~Cg~CGls~e~   58 (104)
T COG4888          22 TFTCPRCGHEKVSSCTVK----KTVNIGTAVCGNCGLSFEC   58 (104)
T ss_pred             eEecCccCCeeeeEEEEE----ecCceeEEEcccCcceEEE
Confidence            477888875433222211    1112233567777765543


No 129
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=71.39  E-value=3.1  Score=22.31  Aligned_cols=10  Identities=20%  Similarity=0.331  Sum_probs=4.7

Q ss_pred             eeeCCCCCcc
Q psy7454          13 YVCFACKFYT   22 (103)
Q Consensus        13 ~~C~~C~~~f   22 (103)
                      ..|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (115)
T TIGR00100        71 CECEDCSEEV   80 (115)
T ss_pred             EEcccCCCEE
Confidence            4455555443


No 130
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=71.13  E-value=1.9  Score=22.15  Aligned_cols=32  Identities=13%  Similarity=0.412  Sum_probs=20.3

Q ss_pred             CCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          38 EKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        38 ~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      ...|.|+.|++.-     +    .+.-.  -.|.|..|++.|.
T Consensus        34 ~a~y~CpfCgk~~-----v----kR~a~--GIW~C~~C~~~~A   65 (90)
T PTZ00255         34 HAKYFCPFCGKHA-----V----KRQAV--GIWRCKGCKKTVA   65 (90)
T ss_pred             hCCccCCCCCCCc-----e----eeeee--EEEEcCCCCCEEe
Confidence            4568899998531     1    12222  3688999988765


No 131
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=70.28  E-value=0.93  Score=19.44  Aligned_cols=8  Identities=25%  Similarity=1.094  Sum_probs=3.9

Q ss_pred             eecCCCCc
Q psy7454          41 FTCNMCEF   48 (103)
Q Consensus        41 ~~c~~C~~   48 (103)
                      |.|..|+.
T Consensus        29 y~C~~C~~   36 (40)
T smart00440       29 YVCTKCGH   36 (40)
T ss_pred             EEeCCCCC
Confidence            44555543


No 132
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=69.12  E-value=4.1  Score=21.80  Aligned_cols=10  Identities=20%  Similarity=0.597  Sum_probs=4.4

Q ss_pred             eeeCCCCCcc
Q psy7454          13 YVCFACKFYT   22 (103)
Q Consensus        13 ~~C~~C~~~f   22 (103)
                      ..|..||..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            3444444333


No 133
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=68.45  E-value=2.9  Score=20.74  Aligned_cols=33  Identities=21%  Similarity=0.514  Sum_probs=19.0

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCcc
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFK   49 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~   49 (103)
                      -+.|.|..|+..|    .+..+++-   .-.-.|+.|+..
T Consensus        10 tY~Y~c~~cg~~~----dvvq~~~d---dplt~ce~c~a~   42 (82)
T COG2331          10 TYSYECTECGNRF----DVVQAMTD---DPLTTCEECGAR   42 (82)
T ss_pred             ceEEeecccchHH----HHHHhccc---CccccChhhChH
Confidence            4568899998665    33333322   222368888753


No 134
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=68.41  E-value=1.9  Score=22.16  Aligned_cols=32  Identities=28%  Similarity=0.598  Sum_probs=19.8

Q ss_pred             CCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          38 EKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        38 ~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      ...|.|+.|++.-     +    .+.-.+  .|.|..|++.|.
T Consensus        33 ~a~y~CpfCgk~~-----v----kR~a~G--IW~C~~C~~~~A   64 (91)
T TIGR00280        33 KAKYVCPFCGKKT-----V----KRGSTG--IWTCRKCGAKFA   64 (91)
T ss_pred             hcCccCCCCCCCc-----e----EEEeeE--EEEcCCCCCEEe
Confidence            3568899998531     1    222223  688888887765


No 135
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=68.39  E-value=3.3  Score=17.64  Aligned_cols=13  Identities=15%  Similarity=0.381  Sum_probs=9.9

Q ss_pred             ceeeCCCCCcccC
Q psy7454          12 KYVCFACKFYTYN   24 (103)
Q Consensus        12 ~~~C~~C~~~f~~   24 (103)
                      ++.|..|+..|=.
T Consensus        12 ~f~C~~C~~~FC~   24 (39)
T smart00154       12 GFKCRHCGNLFCG   24 (39)
T ss_pred             CeECCccCCcccc
Confidence            6888888877754


No 136
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=68.07  E-value=3.5  Score=21.22  Aligned_cols=14  Identities=43%  Similarity=1.099  Sum_probs=8.9

Q ss_pred             CCeecCCCCccccC
Q psy7454          39 KPFTCNMCEFKCRD   52 (103)
Q Consensus        39 ~~~~c~~C~~~~~~   52 (103)
                      +|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45567777766644


No 137
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=67.74  E-value=2  Score=20.36  Aligned_cols=45  Identities=22%  Similarity=0.432  Sum_probs=27.5

Q ss_pred             HHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          31 HLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        31 h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      |..++.+..++.|+.-+..+..+..+..  + ..  +.-..|++|+..|+
T Consensus        15 ~~~I~~~~~~l~C~g~~~p~~HPrV~L~--m-g~--~gev~CPYC~t~y~   59 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPPNDHPRVFLD--M-GD--EGEVVCPYCSTRYR   59 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCCCCCCEEEEE--c-CC--CCcEecCccccEEE
Confidence            4556667778888776666555544432  2 12  22347888888775


No 138
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=67.69  E-value=4  Score=22.99  Aligned_cols=8  Identities=25%  Similarity=0.949  Sum_probs=5.2

Q ss_pred             eecCCCCc
Q psy7454          41 FTCNMCEF   48 (103)
Q Consensus        41 ~~c~~C~~   48 (103)
                      |.|..||.
T Consensus       113 l~C~~Cg~  120 (146)
T PF07295_consen  113 LVCENCGH  120 (146)
T ss_pred             EecccCCC
Confidence            66666664


No 139
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=67.22  E-value=4.9  Score=18.18  Aligned_cols=10  Identities=30%  Similarity=0.999  Sum_probs=5.9

Q ss_pred             CeeCCCCCcc
Q psy7454          69 PYPCRYCDYK   78 (103)
Q Consensus        69 ~~~c~~C~~~   78 (103)
                      .+.|..||..
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            4566666653


No 140
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=66.49  E-value=4.8  Score=17.14  Aligned_cols=18  Identities=22%  Similarity=0.183  Sum_probs=9.5

Q ss_pred             CeecCCCCccccCchHHH
Q psy7454          40 PFTCNMCEFKCRDNRTLK   57 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~   57 (103)
                      ...|..|+..+.....|.
T Consensus        19 id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEECCCCCeEEccHHHHH
Confidence            345666665555554443


No 141
>KOG2482|consensus
Probab=66.07  E-value=4  Score=26.36  Aligned_cols=23  Identities=30%  Similarity=0.694  Sum_probs=21.1

Q ss_pred             CeeCCCCCccccCcHHHHHHHHh
Q psy7454          69 PYPCRYCDYKARETQALKVHTKR   91 (103)
Q Consensus        69 ~~~c~~C~~~f~~~~~l~~H~~~   91 (103)
                      .+.|..|.+.|+....|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            36899999999999999999985


No 142
>COG1773 Rubredoxin [Energy production and conversion]
Probab=65.83  E-value=3.6  Score=19.09  Aligned_cols=13  Identities=23%  Similarity=0.697  Sum_probs=9.5

Q ss_pred             CeeCCCCCccccC
Q psy7454          69 PYPCRYCDYKARE   81 (103)
Q Consensus        69 ~~~c~~C~~~f~~   81 (103)
                      .|+|..||.+|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            5778888877764


No 143
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=64.91  E-value=3.1  Score=18.92  Aligned_cols=11  Identities=18%  Similarity=0.226  Sum_probs=5.8

Q ss_pred             eeCCCCCcccC
Q psy7454          14 VCFACKFYTYN   24 (103)
Q Consensus        14 ~C~~C~~~f~~   24 (103)
                      .||+|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            89999988865


No 144
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.15  E-value=5.8  Score=18.81  Aligned_cols=40  Identities=15%  Similarity=0.336  Sum_probs=23.6

Q ss_pred             eeCCCCCc-ccCchhHHHHHhhcCCCCCeecCCCCccccCc
Q psy7454          14 VCFACKFY-TYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDN   53 (103)
Q Consensus        14 ~C~~C~~~-f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~   53 (103)
                      .|..|++. +.....+..-+........|-|+.|......+
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva~k   44 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVAIK   44 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhchh
Confidence            56677654 55555555444334456678888887655443


No 145
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=63.63  E-value=2.6  Score=21.65  Aligned_cols=32  Identities=25%  Similarity=0.534  Sum_probs=19.8

Q ss_pred             CCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          38 EKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        38 ~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      ...|.|+.|++.-     +    .+.-.+  .|.|..|++.|.
T Consensus        34 ~a~y~CpfCgk~~-----v----kR~a~G--IW~C~~C~~~~A   65 (90)
T PRK03976         34 RAKHVCPVCGRPK-----V----KRVGTG--IWECRKCGAKFA   65 (90)
T ss_pred             hcCccCCCCCCCc-----e----EEEEEE--EEEcCCCCCEEe
Confidence            3568899997431     1    222223  688888887765


No 146
>KOG2807|consensus
Probab=63.14  E-value=11  Score=24.27  Aligned_cols=26  Identities=15%  Similarity=0.235  Sum_probs=21.7

Q ss_pred             CCeeCCCCCccccCcHHHHHHHHhhC
Q psy7454          68 KPYPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        68 ~~~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      ..|.|..|...|-...+.-.|...|.
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh~  369 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLHN  369 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhhc
Confidence            35888999999999888888888875


No 147
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=62.85  E-value=7.5  Score=18.48  Aligned_cols=15  Identities=13%  Similarity=0.702  Sum_probs=9.4

Q ss_pred             CCCeeCCCCCccccC
Q psy7454          67 QKPYPCRYCDYKARE   81 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~   81 (103)
                      .+.|.|+.||.....
T Consensus        44 ~r~~~C~~Cg~~~~r   58 (69)
T PF07282_consen   44 GRVFTCPNCGFEMDR   58 (69)
T ss_pred             cceEEcCCCCCEECc
Confidence            445677777765443


No 148
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=62.33  E-value=4.1  Score=17.61  Aligned_cols=14  Identities=14%  Similarity=0.232  Sum_probs=8.2

Q ss_pred             CceeeCCCCCcccC
Q psy7454          11 YKYVCFACKFYTYN   24 (103)
Q Consensus        11 ~~~~C~~C~~~f~~   24 (103)
                      -++.|+.|+..|=.
T Consensus        12 ~~~~C~~C~~~FC~   25 (43)
T PF01428_consen   12 LPFKCKHCGKSFCL   25 (43)
T ss_dssp             SHEE-TTTS-EE-T
T ss_pred             CCeECCCCCcccCc
Confidence            46888888887754


No 149
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=62.30  E-value=6.5  Score=20.74  Aligned_cols=13  Identities=15%  Similarity=0.181  Sum_probs=8.5

Q ss_pred             ceeeCCCCCcccC
Q psy7454          12 KYVCFACKFYTYN   24 (103)
Q Consensus        12 ~~~C~~C~~~f~~   24 (103)
                      |+.|..||..|..
T Consensus         2 pH~CtrCG~vf~~   14 (112)
T COG3364           2 PHQCTRCGEVFDD   14 (112)
T ss_pred             Cceeccccccccc
Confidence            4567777777655


No 150
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=62.02  E-value=5.2  Score=21.37  Aligned_cols=11  Identities=18%  Similarity=0.199  Sum_probs=6.2

Q ss_pred             eeeCCCCCccc
Q psy7454          13 YVCFACKFYTY   23 (103)
Q Consensus        13 ~~C~~C~~~f~   23 (103)
                      ..|..||..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            55666666654


No 151
>KOG1280|consensus
Probab=61.84  E-value=9  Score=24.85  Aligned_cols=25  Identities=28%  Similarity=0.587  Sum_probs=12.4

Q ss_pred             eecCCCCccccCchHHHHHHHHhcC
Q psy7454          41 FTCNMCEFKCRDNRTLKAHHINIHT   65 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~l~~h~~~~h~   65 (103)
                      |.|++|+..-.....|..|....|.
T Consensus        80 ftCPyC~~~Gfte~~f~~Hv~s~Hp  104 (381)
T KOG1280|consen   80 FTCPYCGIMGFTERQFGTHVLSQHP  104 (381)
T ss_pred             ccCCcccccccchhHHHHHhhhcCc
Confidence            4555555555555555555333333


No 152
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=61.34  E-value=5.6  Score=21.41  Aligned_cols=10  Identities=20%  Similarity=0.474  Sum_probs=4.6

Q ss_pred             eeeCCCCCcc
Q psy7454          13 YVCFACKFYT   22 (103)
Q Consensus        13 ~~C~~C~~~f   22 (103)
                      ..|..||..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            4455554333


No 153
>PRK04351 hypothetical protein; Provisional
Probab=61.22  E-value=7.9  Score=21.87  Aligned_cols=33  Identities=21%  Similarity=0.442  Sum_probs=18.9

Q ss_pred             CeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccC
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARE   81 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~   81 (103)
                      .|.|..||..+...        +.+ +...|.|..|+..+..
T Consensus       112 ~Y~C~~Cg~~~~r~--------Rr~-n~~~yrCg~C~g~L~~  144 (149)
T PRK04351        112 LYECQSCGQQYLRK--------RRI-NTKRYRCGKCRGKLKL  144 (149)
T ss_pred             EEECCCCCCEeeee--------eec-CCCcEEeCCCCcEeee
Confidence            37787787654321        112 2356788888765543


No 154
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=59.99  E-value=6.9  Score=26.64  Aligned_cols=13  Identities=31%  Similarity=0.761  Sum_probs=6.2

Q ss_pred             cCCCCCeecCCCC
Q psy7454          35 HLGEKPFTCNMCE   47 (103)
Q Consensus        35 h~~~~~~~c~~C~   47 (103)
                      |.......|..||
T Consensus       235 h~~~~~l~Ch~Cg  247 (505)
T TIGR00595       235 HKKEGKLRCHYCG  247 (505)
T ss_pred             ecCCCeEEcCCCc
Confidence            3334444555555


No 155
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=59.92  E-value=3.8  Score=17.18  Aligned_cols=14  Identities=21%  Similarity=0.657  Sum_probs=6.4

Q ss_pred             hhcCCCCCeecCCC
Q psy7454          33 GMHLGEKPFTCNMC   46 (103)
Q Consensus        33 ~~h~~~~~~~c~~C   46 (103)
                      ....|...|.|..|
T Consensus        22 ~~~~G~qryrC~~C   35 (36)
T PF03811_consen   22 KSPSGHQRYRCKDC   35 (36)
T ss_pred             CCCCCCEeEecCcC
Confidence            33344444555544


No 156
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=59.67  E-value=8  Score=17.97  Aligned_cols=11  Identities=27%  Similarity=0.727  Sum_probs=5.7

Q ss_pred             CCCeecCCCCc
Q psy7454          38 EKPFTCNMCEF   48 (103)
Q Consensus        38 ~~~~~c~~C~~   48 (103)
                      ...|.|+.||-
T Consensus        12 ~v~~~Cp~cGi   22 (55)
T PF13824_consen   12 HVNFECPDCGI   22 (55)
T ss_pred             ccCCcCCCCCC
Confidence            34455555553


No 157
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=59.62  E-value=5  Score=25.61  Aligned_cols=49  Identities=14%  Similarity=0.242  Sum_probs=31.6

Q ss_pred             ecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHHHhhC
Q psy7454          42 TCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        42 ~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      .|-.|...|..+..-.-   ...+....|.|..|...|-...+.-.|...|.
T Consensus       364 ~Cf~CQ~~fp~~~~~~~---~~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh~  412 (421)
T COG5151         364 HCFVCQGPFPKPPVSPF---DESTSSGRYQCELCKSTFCSDCDVFIHETLHF  412 (421)
T ss_pred             cceeccCCCCCCCCCcc---cccccccceechhhhhhhhhhhHHHHHHHHhh
Confidence            36666655555432111   11223456999999999999988888888774


No 158
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=59.42  E-value=2.9  Score=17.82  Aligned_cols=12  Identities=33%  Similarity=0.933  Sum_probs=5.1

Q ss_pred             CCCeeCCCCCcc
Q psy7454          67 QKPYPCRYCDYK   78 (103)
Q Consensus        67 ~~~~~c~~C~~~   78 (103)
                      .+.|.|..|+..
T Consensus        22 ~~~w~C~~C~~~   33 (40)
T PF04810_consen   22 GKTWICNFCGTK   33 (40)
T ss_dssp             TTEEEETTT--E
T ss_pred             CCEEECcCCCCc
Confidence            344555555543


No 159
>PRK14873 primosome assembly protein PriA; Provisional
Probab=58.95  E-value=14  Score=26.28  Aligned_cols=13  Identities=15%  Similarity=0.335  Sum_probs=7.8

Q ss_pred             cCCCCCeecCCCC
Q psy7454          35 HLGEKPFTCNMCE   47 (103)
Q Consensus        35 h~~~~~~~c~~C~   47 (103)
                      |...+...|..||
T Consensus       405 h~~~~~l~Ch~CG  417 (665)
T PRK14873        405 PSAGGTPRCRWCG  417 (665)
T ss_pred             ecCCCeeECCCCc
Confidence            4444556677776


No 160
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=58.82  E-value=9.7  Score=25.77  Aligned_cols=26  Identities=19%  Similarity=0.420  Sum_probs=22.0

Q ss_pred             CCeeCCCCCccccCcHHHHHHHHhhC
Q psy7454          68 KPYPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        68 ~~~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      +-|.|+.|.+.|.....+..|+-.-|
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhh
Confidence            35789999999999999999988644


No 161
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=57.97  E-value=2.2  Score=19.48  Aligned_cols=24  Identities=17%  Similarity=0.265  Sum_probs=8.2

Q ss_pred             CeeCCCCCccccCcHHHHHHHHhh
Q psy7454          69 PYPCRYCDYKARETQALKVHTKRY   92 (103)
Q Consensus        69 ~~~c~~C~~~f~~~~~l~~H~~~~   92 (103)
                      .|.|+.|...|-..-++-.|..+|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTTS-
T ss_pred             eEECCCCCCccccCcChhhhcccc
Confidence            355555555554444444444333


No 162
>PLN02294 cytochrome c oxidase subunit Vb
Probab=57.81  E-value=6.7  Score=22.72  Aligned_cols=15  Identities=20%  Similarity=0.439  Sum_probs=12.4

Q ss_pred             CCCeeCCCCCccccC
Q psy7454          67 QKPYPCRYCDYKARE   81 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~   81 (103)
                      .++..|++||..|.-
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            468899999998874


No 163
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=55.95  E-value=15  Score=22.77  Aligned_cols=11  Identities=18%  Similarity=0.797  Sum_probs=7.6

Q ss_pred             CCceeeCCCCC
Q psy7454          10 RYKYVCFACKF   20 (103)
Q Consensus        10 ~~~~~C~~C~~   20 (103)
                      .+.|.|..|+.
T Consensus       110 drqFaC~~Cd~  120 (278)
T PF15135_consen  110 DRQFACSSCDH  120 (278)
T ss_pred             ceeeeccccch
Confidence            35688888853


No 164
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=55.61  E-value=8.3  Score=20.15  Aligned_cols=18  Identities=28%  Similarity=0.558  Sum_probs=13.6

Q ss_pred             HhcCCCCCeeCCCCCcccc
Q psy7454          62 NIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        62 ~~h~~~~~~~c~~C~~~f~   80 (103)
                      ..+.+ ++..|..||..|.
T Consensus        73 ~l~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          73 WLEKG-KPKRCPECGHVFK   90 (97)
T ss_pred             EEeCC-CceeCCCCCcEEE
Confidence            33444 6899999998886


No 165
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=55.27  E-value=6.3  Score=17.86  Aligned_cols=12  Identities=42%  Similarity=1.029  Sum_probs=9.2

Q ss_pred             eeCCCCCccccC
Q psy7454          70 YPCRYCDYKARE   81 (103)
Q Consensus        70 ~~c~~C~~~f~~   81 (103)
                      |+|..||.++.-
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            678888887764


No 166
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=55.00  E-value=15  Score=16.69  Aligned_cols=9  Identities=33%  Similarity=1.158  Sum_probs=5.9

Q ss_pred             CeeCCCCCc
Q psy7454          69 PYPCRYCDY   77 (103)
Q Consensus        69 ~~~c~~C~~   77 (103)
                      .|.|..||.
T Consensus        37 R~~CGkCgy   45 (51)
T COG1998          37 RWACGKCGY   45 (51)
T ss_pred             eeEeccccc
Confidence            466777765


No 167
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=54.86  E-value=6.8  Score=21.01  Aligned_cols=7  Identities=29%  Similarity=0.900  Sum_probs=3.2

Q ss_pred             ecCCCCc
Q psy7454          42 TCNMCEF   48 (103)
Q Consensus        42 ~c~~C~~   48 (103)
                      .|..|+.
T Consensus        72 ~C~~Cg~   78 (114)
T PRK03681         72 WCETCQQ   78 (114)
T ss_pred             EcccCCC
Confidence            4444443


No 168
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=54.06  E-value=6.8  Score=21.86  Aligned_cols=32  Identities=22%  Similarity=0.515  Sum_probs=16.5

Q ss_pred             CeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      .|.|..|+..+....       +.  ....|.|..|+..+.
T Consensus       123 ~~~C~~C~~~~~r~~-------~~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  123 VYRCPSCGREYKRHR-------RS--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             EEEcCCCCCEeeeec-------cc--chhhEECCCCCCEEE
Confidence            466777775542221       11  222367777775543


No 169
>KOG0227|consensus
Probab=53.86  E-value=7.6  Score=22.97  Aligned_cols=28  Identities=21%  Similarity=0.365  Sum_probs=21.4

Q ss_pred             CCCCCCCCCceeeCCCCCcccCchhHHHHH
Q psy7454           3 MPRPNAYRYKYVCFACKFYTYNTGNIKRHL   32 (103)
Q Consensus         3 ~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~   32 (103)
                      +|+.|.|.  |.|..|......+.++.+|.
T Consensus        46 ~mkNh~G~--yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   46 FMKNHLGK--YECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             hhhccCcc--eeehhhhhhhcchhhhhhhh
Confidence            45677776  99999988777777777663


No 170
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=53.51  E-value=7  Score=16.85  Aligned_cols=11  Identities=36%  Similarity=1.008  Sum_probs=6.3

Q ss_pred             CeeCCCCCccc
Q psy7454          69 PYPCRYCDYKA   79 (103)
Q Consensus        69 ~~~c~~C~~~f   79 (103)
                      +-.|++||..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            34666666554


No 171
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=53.46  E-value=12  Score=21.93  Aligned_cols=32  Identities=19%  Similarity=0.566  Sum_probs=16.8

Q ss_pred             CCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCc
Q psy7454          36 LGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDY   77 (103)
Q Consensus        36 ~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~   77 (103)
                      ....-|.|+.|...+......       ..+   |.|+.||.
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~-------~~~---F~Cp~Cg~  140 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAM-------ELG---FTCPKCGE  140 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHH-------HhC---CCCCCCCc
Confidence            344557776666554432221       122   67777775


No 172
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=53.36  E-value=6.1  Score=16.61  Aligned_cols=15  Identities=13%  Similarity=0.184  Sum_probs=9.0

Q ss_pred             eCCCCCccccCcHHH
Q psy7454          71 PCRYCDYKARETQAL   85 (103)
Q Consensus        71 ~c~~C~~~f~~~~~l   85 (103)
                      .|..|++.|.+.++-
T Consensus         4 ~CprC~kg~Hwa~~C   18 (36)
T PF14787_consen    4 LCPRCGKGFHWASEC   18 (36)
T ss_dssp             C-TTTSSSCS-TTT-
T ss_pred             cCcccCCCcchhhhh
Confidence            577888888776654


No 173
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=53.03  E-value=2.7  Score=29.69  Aligned_cols=29  Identities=24%  Similarity=0.644  Sum_probs=17.1

Q ss_pred             ecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCc
Q psy7454          42 TCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDY   77 (103)
Q Consensus        42 ~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~   77 (103)
                      -|+.|.+-|..+..     ++.|..  |..|+.||-
T Consensus       153 lC~~C~~EY~dP~n-----RRfHAQ--p~aCp~CGP  181 (750)
T COG0068         153 LCPFCDKEYKDPLN-----RRFHAQ--PIACPKCGP  181 (750)
T ss_pred             CCHHHHHHhcCccc-----cccccc--cccCcccCC
Confidence            47777665555432     344543  567888885


No 174
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=53.03  E-value=4.5  Score=24.36  Aligned_cols=32  Identities=9%  Similarity=-0.091  Sum_probs=0.0

Q ss_pred             CeeCCCCCccccCcHHHHHHHHhhCCCCCcccc
Q psy7454          69 PYPCRYCDYKARETQALKVHTKRYHPKMYDVEY  101 (103)
Q Consensus        69 ~~~c~~C~~~f~~~~~l~~H~~~~~~~~~~~~~  101 (103)
                      -..|+.||...+ .+.|..|+++...+..|++.
T Consensus       168 ~~~cPitGe~IP-~~e~~eHmRi~LlDP~wkEq  199 (229)
T PF12230_consen  168 MIICPITGEMIP-ADEMDEHMRIELLDPRWKEQ  199 (229)
T ss_dssp             ---------------------------------
T ss_pred             cccccccccccc-cccccccccccccccccccc
Confidence            357888887654 45677888887777777654


No 175
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=52.70  E-value=2.8  Score=18.82  Aligned_cols=13  Identities=15%  Similarity=0.294  Sum_probs=10.4

Q ss_pred             eCCCCCccccCcH
Q psy7454          71 PCRYCDYKARETQ   83 (103)
Q Consensus        71 ~c~~C~~~f~~~~   83 (103)
                      +|++|++.|.+..
T Consensus        14 ICpvCqRPFsWRk   26 (54)
T COG4338          14 ICPVCQRPFSWRK   26 (54)
T ss_pred             hhhhhcCchHHHH
Confidence            6889999888754


No 176
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=52.56  E-value=6  Score=17.34  Aligned_cols=11  Identities=27%  Similarity=0.833  Sum_probs=6.5

Q ss_pred             CCCeeCCCCCc
Q psy7454          67 QKPYPCRYCDY   77 (103)
Q Consensus        67 ~~~~~c~~C~~   77 (103)
                      ...|.|..|++
T Consensus        35 ~~~~~C~~C~~   45 (46)
T PF12760_consen   35 RGRYRCKACRK   45 (46)
T ss_pred             CCeEECCCCCC
Confidence            34567766653


No 177
>KOG2907|consensus
Probab=52.20  E-value=9.8  Score=20.46  Aligned_cols=13  Identities=46%  Similarity=0.940  Sum_probs=9.0

Q ss_pred             CeeCCCCCccccC
Q psy7454          69 PYPCRYCDYKARE   81 (103)
Q Consensus        69 ~~~c~~C~~~f~~   81 (103)
                      -|.|+.|+..|..
T Consensus       102 FYTC~kC~~k~~e  114 (116)
T KOG2907|consen  102 FYTCPKCKYKFTE  114 (116)
T ss_pred             EEEcCccceeeec
Confidence            4678888776653


No 178
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=52.19  E-value=7.9  Score=17.29  Aligned_cols=13  Identities=31%  Similarity=0.812  Sum_probs=9.2

Q ss_pred             eeCCCCCccccCc
Q psy7454          70 YPCRYCDYKARET   82 (103)
Q Consensus        70 ~~c~~C~~~f~~~   82 (103)
                      |.|..||.++...
T Consensus         2 y~C~~CgyvYd~~   14 (47)
T PF00301_consen    2 YQCPVCGYVYDPE   14 (47)
T ss_dssp             EEETTTSBEEETT
T ss_pred             cCCCCCCEEEcCC
Confidence            6788888776643


No 179
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=51.81  E-value=16  Score=16.57  Aligned_cols=12  Identities=17%  Similarity=0.725  Sum_probs=6.2

Q ss_pred             eecCCCCccccC
Q psy7454          41 FTCNMCEFKCRD   52 (103)
Q Consensus        41 ~~c~~C~~~~~~   52 (103)
                      ..|..||..+..
T Consensus        29 W~C~~Cgh~w~~   40 (55)
T PF14311_consen   29 WKCPKCGHEWKA   40 (55)
T ss_pred             EECCCCCCeeEc
Confidence            456666554433


No 180
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=51.56  E-value=13  Score=19.67  Aligned_cols=12  Identities=17%  Similarity=0.204  Sum_probs=7.8

Q ss_pred             ceeeCCCCCccc
Q psy7454          12 KYVCFACKFYTY   23 (103)
Q Consensus        12 ~~~C~~C~~~f~   23 (103)
                      |-.|+.||....
T Consensus         2 p~~CpYCg~~~~   13 (102)
T PF11672_consen    2 PIICPYCGGPAE   13 (102)
T ss_pred             CcccCCCCCeeE
Confidence            557888875543


No 181
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=51.16  E-value=19  Score=16.41  Aligned_cols=32  Identities=22%  Similarity=0.482  Sum_probs=17.4

Q ss_pred             ecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcc
Q psy7454          42 TCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYK   78 (103)
Q Consensus        42 ~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~   78 (103)
                      .|..|.........  .   ....++....|+.||+.
T Consensus        24 ~C~gC~~~l~~~~~--~---~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQEL--N---EIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHHH--H---HHHcCCCeEECcCCCcc
Confidence            67777655433221  1   22233456678888863


No 182
>KOG0696|consensus
Probab=50.68  E-value=4  Score=27.48  Aligned_cols=41  Identities=17%  Similarity=0.284  Sum_probs=20.7

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHH
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAH   59 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h   59 (103)
                      +..|.|++|.        +..|.+.|. --.|.|+.-++++.+...-..|
T Consensus        71 KQGfQCqvC~--------fvvHkrChe-fVtF~CPGadkg~dtDdpr~kH  111 (683)
T KOG0696|consen   71 KQGFQCQVCC--------FVVHKRCHE-FVTFSCPGADKGPDTDDPRSKH  111 (683)
T ss_pred             cCceeeeEEe--------ehhhhhhcc-eEEEECCCCCCCCCCCCccccc
Confidence            3446666663        455666653 2345565555555544443333


No 183
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.59  E-value=5.5  Score=21.84  Aligned_cols=18  Identities=22%  Similarity=0.350  Sum_probs=11.6

Q ss_pred             CCCCeeCCCCCccccCcH
Q psy7454          66 GQKPYPCRYCDYKARETQ   83 (103)
Q Consensus        66 ~~~~~~c~~C~~~f~~~~   83 (103)
                      -+.|--|..||..|+|.-
T Consensus        65 ye~psfchncgs~fpwte   82 (160)
T COG4306          65 YEPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             CCCcchhhcCCCCCCcHH
Confidence            345556777777777653


No 184
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=50.37  E-value=14  Score=20.55  Aligned_cols=33  Identities=21%  Similarity=0.434  Sum_probs=17.6

Q ss_pred             CeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      .|.|..|+..+..      + . .+..-..|.|..|+..+.
T Consensus       112 ~y~C~~C~~~~~~------~-r-r~~~~~~y~C~~C~g~l~  144 (146)
T smart00731      112 PYRCTGCGQRYLR------V-R-RSNNVSRYRCGKCGGKLI  144 (146)
T ss_pred             EEECCCCCCCCce------E-c-cccCcceEEcCCCCCEEE
Confidence            5677777755431      1 1 122224577777776543


No 185
>KOG0717|consensus
Probab=49.88  E-value=12  Score=25.40  Aligned_cols=21  Identities=19%  Similarity=0.377  Sum_probs=18.5

Q ss_pred             eeeCCCCCcccCchhHHHHHh
Q psy7454          13 YVCFACKFYTYNTGNIKRHLG   33 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~   33 (103)
                      +-|.+|+++|.+.-.+..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            789999999999988888864


No 186
>KOG3507|consensus
Probab=49.66  E-value=14  Score=17.39  Aligned_cols=9  Identities=44%  Similarity=1.091  Sum_probs=4.3

Q ss_pred             CeeCCCCCc
Q psy7454          69 PYPCRYCDY   77 (103)
Q Consensus        69 ~~~c~~C~~   77 (103)
                      .+.|..||.
T Consensus        37 ~irCReCG~   45 (62)
T KOG3507|consen   37 VIRCRECGY   45 (62)
T ss_pred             cEehhhcch
Confidence            344555553


No 187
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=49.57  E-value=9.7  Score=16.00  Aligned_cols=12  Identities=25%  Similarity=0.376  Sum_probs=6.6

Q ss_pred             CceeeCCCCCcc
Q psy7454          11 YKYVCFACKFYT   22 (103)
Q Consensus        11 ~~~~C~~C~~~f   22 (103)
                      +.|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            468899998654


No 188
>KOG2482|consensus
Probab=49.52  E-value=11  Score=24.43  Aligned_cols=23  Identities=17%  Similarity=0.475  Sum_probs=20.7

Q ss_pred             ceeeCCCCCcccCchhHHHHHhh
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGM   34 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~   34 (103)
                      .+.|-.|.+.|..+..|..||+.
T Consensus       195 r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHh
Confidence            47899999999999999999974


No 189
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=49.50  E-value=13  Score=24.89  Aligned_cols=13  Identities=31%  Similarity=0.902  Sum_probs=7.0

Q ss_pred             CeecCCCCccccC
Q psy7454          40 PFTCNMCEFKCRD   52 (103)
Q Consensus        40 ~~~c~~C~~~~~~   52 (103)
                      -|.|..||..+..
T Consensus       367 g~rC~kCg~~~~~  379 (421)
T COG1571         367 GFRCKKCGTRARE  379 (421)
T ss_pred             CcccccccccCCc
Confidence            5556666554443


No 190
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=48.61  E-value=14  Score=17.45  Aligned_cols=12  Identities=17%  Similarity=0.243  Sum_probs=4.8

Q ss_pred             ceeeCCCCCccc
Q psy7454          12 KYVCFACKFYTY   23 (103)
Q Consensus        12 ~~~C~~C~~~f~   23 (103)
                      .-.|..|++.|.
T Consensus         9 ~~~C~~C~~~F~   20 (69)
T PF01363_consen    9 ASNCMICGKKFS   20 (69)
T ss_dssp             -SB-TTT--B-B
T ss_pred             CCcCcCcCCcCC
Confidence            356777887774


No 191
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=48.57  E-value=14  Score=25.04  Aligned_cols=26  Identities=15%  Similarity=0.294  Sum_probs=21.5

Q ss_pred             ceeeCCCCCcccCchhHHHHHh-hcCC
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLG-MHLG   37 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~-~h~~   37 (103)
                      -+.|+.|++.|.....+..|+. .|.+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            4789999999999999999975 4543


No 192
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=48.16  E-value=9.9  Score=21.04  Aligned_cols=14  Identities=14%  Similarity=0.166  Sum_probs=10.5

Q ss_pred             ceeeCCCCCcccCc
Q psy7454          12 KYVCFACKFYTYNT   25 (103)
Q Consensus        12 ~~~C~~C~~~f~~~   25 (103)
                      |+.|..||+.|..-
T Consensus         1 PH~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    1 PHQCTKCGRVFEDG   14 (131)
T ss_pred             CcccCcCCCCcCCC
Confidence            56788888888753


No 193
>PTZ00448 hypothetical protein; Provisional
Probab=48.15  E-value=13  Score=24.41  Aligned_cols=24  Identities=17%  Similarity=0.419  Sum_probs=18.7

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhc
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMH   35 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h   35 (103)
                      .|.|..|+..|.+......|.++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            477999998887777777787764


No 194
>PHA02998 RNA polymerase subunit; Provisional
Probab=48.12  E-value=5.6  Score=23.22  Aligned_cols=11  Identities=27%  Similarity=0.679  Sum_probs=6.6

Q ss_pred             eeCCCCCcccc
Q psy7454          70 YPCRYCDYKAR   80 (103)
Q Consensus        70 ~~c~~C~~~f~   80 (103)
                      |.|..||..|.
T Consensus       172 YkC~~CG~~wk  182 (195)
T PHA02998        172 HACRDCKKHFK  182 (195)
T ss_pred             EEcCCCCCccC
Confidence            56666665554


No 195
>KOG2231|consensus
Probab=48.06  E-value=48  Score=23.80  Aligned_cols=17  Identities=29%  Similarity=0.694  Sum_probs=7.9

Q ss_pred             cCCCCccccCchHHHHH
Q psy7454          43 CNMCEFKCRDNRTLKAH   59 (103)
Q Consensus        43 c~~C~~~~~~~~~l~~h   59 (103)
                      |..|...|.....|..|
T Consensus       185 C~~C~~~fld~~el~rH  201 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRH  201 (669)
T ss_pred             chhhhhhhccHHHHHHh
Confidence            44444444444444443


No 196
>PRK05580 primosome assembly protein PriA; Validated
Probab=47.64  E-value=24  Score=25.11  Aligned_cols=8  Identities=25%  Similarity=0.945  Sum_probs=3.7

Q ss_pred             eeCCCCCc
Q psy7454          14 VCFACKFY   21 (103)
Q Consensus        14 ~C~~C~~~   21 (103)
                      .|..||..
T Consensus       383 ~C~~Cg~~  390 (679)
T PRK05580        383 LCRDCGWV  390 (679)
T ss_pred             EhhhCcCc
Confidence            35555443


No 197
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=47.31  E-value=35  Score=20.37  Aligned_cols=13  Identities=15%  Similarity=0.309  Sum_probs=8.5

Q ss_pred             CCeecCCCCcccc
Q psy7454          39 KPFTCNMCEFKCR   51 (103)
Q Consensus        39 ~~~~c~~C~~~~~   51 (103)
                      -.+.|..||..+.
T Consensus        29 ~lvrC~eCG~V~~   41 (201)
T COG1326          29 PLVRCEECGTVHP   41 (201)
T ss_pred             eEEEccCCCcEee
Confidence            4567888876553


No 198
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=46.82  E-value=17  Score=19.44  Aligned_cols=13  Identities=15%  Similarity=0.636  Sum_probs=7.7

Q ss_pred             CCeecCCCCcccc
Q psy7454          39 KPFTCNMCEFKCR   51 (103)
Q Consensus        39 ~~~~c~~C~~~~~   51 (103)
                      ..+.|+.|+.-+.
T Consensus        18 ~~~iCpeC~~EW~   30 (109)
T TIGR00686        18 TQLICPSCLYEWN   30 (109)
T ss_pred             CeeECcccccccc
Confidence            3467777765443


No 199
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=46.42  E-value=11  Score=15.58  Aligned_cols=12  Identities=17%  Similarity=0.168  Sum_probs=5.4

Q ss_pred             eeeCCCCCcccC
Q psy7454          13 YVCFACKFYTYN   24 (103)
Q Consensus        13 ~~C~~C~~~f~~   24 (103)
                      -.|..|++.|..
T Consensus         4 ~~C~eC~~~f~d   15 (34)
T PF01286_consen    4 PKCDECGKPFMD   15 (34)
T ss_dssp             EE-TTT--EES-
T ss_pred             chHhHhCCHHHH
Confidence            367777777754


No 200
>KOG2071|consensus
Probab=44.99  E-value=19  Score=25.17  Aligned_cols=27  Identities=15%  Similarity=0.431  Sum_probs=22.4

Q ss_pred             CCCeeCCCCCccccCcHHHHHHHHhhC
Q psy7454          67 QKPYPCRYCDYKARETQALKVHTKRYH   93 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~~~l~~H~~~~~   93 (103)
                      ..|-.|..||..|........|+..|-
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456789999999999988888877764


No 201
>PRK00420 hypothetical protein; Validated
Probab=44.96  E-value=25  Score=18.94  Aligned_cols=7  Identities=14%  Similarity=0.211  Sum_probs=3.3

Q ss_pred             eCCCCCc
Q psy7454          71 PCRYCDY   77 (103)
Q Consensus        71 ~c~~C~~   77 (103)
                      .|+.||.
T Consensus        42 ~Cp~Cg~   48 (112)
T PRK00420         42 VCPVHGK   48 (112)
T ss_pred             ECCCCCC
Confidence            4444444


No 202
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=44.88  E-value=9.1  Score=17.02  Aligned_cols=10  Identities=20%  Similarity=0.524  Sum_probs=4.6

Q ss_pred             ceeeCCCCCc
Q psy7454          12 KYVCFACKFY   21 (103)
Q Consensus        12 ~~~C~~C~~~   21 (103)
                      +-.|.+|++.
T Consensus        11 ~~~C~~C~~~   20 (53)
T PF00130_consen   11 PTYCDVCGKF   20 (53)
T ss_dssp             TEB-TTSSSB
T ss_pred             CCCCcccCcc
Confidence            4455555544


No 203
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=44.52  E-value=11  Score=18.02  Aligned_cols=14  Identities=14%  Similarity=0.190  Sum_probs=9.4

Q ss_pred             CCceeeCCCCCccc
Q psy7454          10 RYKYVCFACKFYTY   23 (103)
Q Consensus        10 ~~~~~C~~C~~~f~   23 (103)
                      +....|+.|++.|.
T Consensus        51 eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   51 EGELICPECGREYP   64 (68)
T ss_dssp             TTEEEETTTTEEEE
T ss_pred             CCEEEcCCCCCEEe
Confidence            44577777777664


No 204
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=44.33  E-value=23  Score=16.56  Aligned_cols=11  Identities=18%  Similarity=0.697  Sum_probs=5.7

Q ss_pred             CCCeecCCCCc
Q psy7454          38 EKPFTCNMCEF   48 (103)
Q Consensus        38 ~~~~~c~~C~~   48 (103)
                      ...|.|+.|..
T Consensus        29 i~tYmC~eC~~   39 (56)
T PF09963_consen   29 IHTYMCDECKE   39 (56)
T ss_pred             CcceeChhHHH
Confidence            44455665543


No 205
>KOG0717|consensus
Probab=43.93  E-value=16  Score=24.85  Aligned_cols=22  Identities=23%  Similarity=0.460  Sum_probs=19.0

Q ss_pred             eeCCCCCccccCcHHHHHHHHh
Q psy7454          70 YPCRYCDYKARETQALKVHTKR   91 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~   91 (103)
                      +-|.+|.+.|.+...+.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6799999999999999998654


No 206
>KOG3183|consensus
Probab=43.69  E-value=19  Score=22.19  Aligned_cols=41  Identities=15%  Similarity=0.335  Sum_probs=24.2

Q ss_pred             ceeeCCCCCcccCc-hhHHHHH---hhcCCCCCeecCCCCccccC
Q psy7454          12 KYVCFACKFYTYNT-GNIKRHL---GMHLGEKPFTCNMCEFKCRD   52 (103)
Q Consensus        12 ~~~C~~C~~~f~~~-~~l~~h~---~~h~~~~~~~c~~C~~~~~~   52 (103)
                      ||.|+.|+..|-.. ..+..|-   .....+.--+|+.|.+....
T Consensus        23 Pf~Cd~C~~~FC~eHrsye~H~Cp~~~~~~~~v~icp~cs~pv~~   67 (250)
T KOG3183|consen   23 PFKCDGCSGIFCLEHRSYESHHCPKGLRIDVQVPICPLCSKPVPT   67 (250)
T ss_pred             ceeeCCccchhhhccchHhhcCCCcccccceeecccCCCCCCCCC
Confidence            79999999887654 3344442   12233444467777655443


No 207
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=43.51  E-value=20  Score=16.86  Aligned_cols=13  Identities=23%  Similarity=0.588  Sum_probs=7.6

Q ss_pred             CCCCCeeCCCCCc
Q psy7454          65 TGQKPYPCRYCDY   77 (103)
Q Consensus        65 ~~~~~~~c~~C~~   77 (103)
                      .|++.-.|+.|..
T Consensus        40 ~GE~VArCPSCSL   52 (67)
T COG5216          40 NGEVVARCPSCSL   52 (67)
T ss_pred             CCceEEEcCCceE
Confidence            4555566666654


No 208
>KOG0782|consensus
Probab=43.33  E-value=2.9  Score=28.96  Aligned_cols=51  Identities=18%  Similarity=0.335  Sum_probs=30.4

Q ss_pred             hhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCC-CeeCCCCCccccCcH
Q psy7454          26 GNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQK-PYPCRYCDYKARETQ   83 (103)
Q Consensus        26 ~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~-~~~c~~C~~~f~~~~   83 (103)
                      ..|.+|.=+|.....-.|..||++|..+-.+       |..+. ...|.+|...|....
T Consensus       239 ~~fvrHHWVHrrRqeGkC~~CgKgFQQKf~F-------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCNTCGKGFQQKFFF-------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchHHhHhhHhhhccccchhhhhhhhheee-------ccccEEEEEehHHHHHhhcch
Confidence            4566665566554445788888887554333       33332 457888877766543


No 209
>KOG1940|consensus
Probab=43.30  E-value=24  Score=22.28  Aligned_cols=8  Identities=38%  Similarity=1.211  Sum_probs=4.5

Q ss_pred             eecCCCCc
Q psy7454          41 FTCNMCEF   48 (103)
Q Consensus        41 ~~c~~C~~   48 (103)
                      |.|++|.+
T Consensus       197 y~CP~C~~  204 (276)
T KOG1940|consen  197 YTCPICSK  204 (276)
T ss_pred             CCCCcccc
Confidence            55555554


No 210
>COG2879 Uncharacterized small protein [Function unknown]
Probab=41.20  E-value=37  Score=16.27  Aligned_cols=19  Identities=16%  Similarity=0.300  Sum_probs=14.3

Q ss_pred             CcHHHHHHHHhhCCCCCcc
Q psy7454          81 ETQALKVHTKRYHPKMYDV   99 (103)
Q Consensus        81 ~~~~l~~H~~~~~~~~~~~   99 (103)
                      .-.++..|++.+++++|..
T Consensus        24 dYdnYVehmr~~hPd~p~m   42 (65)
T COG2879          24 DYDNYVEHMRKKHPDKPPM   42 (65)
T ss_pred             cHHHHHHHHHHhCcCCCcc
Confidence            3456778999988888864


No 211
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=41.13  E-value=31  Score=14.16  Aligned_cols=20  Identities=20%  Similarity=0.240  Sum_probs=10.1

Q ss_pred             ceeeCCCCCcccCchhHHHHH
Q psy7454          12 KYVCFACKFYTYNTGNIKRHL   32 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~   32 (103)
                      .+.|+.|++.+.. .-+..|.
T Consensus         4 ~~~C~nC~R~v~a-~RfA~HL   23 (33)
T PF08209_consen    4 YVECPNCGRPVAA-SRFAPHL   23 (33)
T ss_dssp             EEE-TTTSSEEEG-GGHHHHH
T ss_pred             eEECCCCcCCcch-hhhHHHH
Confidence            3567777766543 3344453


No 212
>KOG1088|consensus
Probab=40.23  E-value=16  Score=19.88  Aligned_cols=19  Identities=11%  Similarity=-0.036  Sum_probs=11.7

Q ss_pred             CCCCCceeeCCCCCcccCc
Q psy7454           7 NAYRYKYVCFACKFYTYNT   25 (103)
Q Consensus         7 h~~~~~~~C~~C~~~f~~~   25 (103)
                      +-.+....|+.||+.|.-+
T Consensus        93 ~v~EG~l~CpetG~vfpI~  111 (124)
T KOG1088|consen   93 DVIEGELVCPETGRVFPIS  111 (124)
T ss_pred             hhccceEecCCCCcEeecc
Confidence            3344557777777777543


No 213
>PF12773 DZR:  Double zinc ribbon
Probab=40.21  E-value=17  Score=15.91  Aligned_cols=8  Identities=25%  Similarity=0.538  Sum_probs=3.8

Q ss_pred             eecCCCCc
Q psy7454          41 FTCNMCEF   48 (103)
Q Consensus        41 ~~c~~C~~   48 (103)
                      ..|+.|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            34555543


No 214
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=40.05  E-value=18  Score=14.79  Aligned_cols=12  Identities=25%  Similarity=0.257  Sum_probs=8.6

Q ss_pred             ceeeCCCCCccc
Q psy7454          12 KYVCFACKFYTY   23 (103)
Q Consensus        12 ~~~C~~C~~~f~   23 (103)
                      .+.|..||..|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            467888887663


No 215
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=40.04  E-value=7.8  Score=23.04  Aligned_cols=35  Identities=26%  Similarity=0.505  Sum_probs=18.1

Q ss_pred             eeeCCCCCcccCchhHHHHHhh----cCCC---CCeecCCCCccccCc
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGM----HLGE---KPFTCNMCEFKCRDN   53 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~----h~~~---~~~~c~~C~~~~~~~   53 (103)
                      ..||+||..+      ..|+..    +.|+   ....|..||..+...
T Consensus        15 ~~CPvCg~~l------~~~~~~~~IPyFG~V~i~t~~C~~CgYR~~DV   56 (201)
T COG1779          15 IDCPVCGGTL------KAHMYLYDIPYFGEVLISTGVCERCGYRSTDV   56 (201)
T ss_pred             ecCCccccee------eEEEeeecCCccceEEEEEEEccccCCcccce
Confidence            5688887533      223222    2332   234677777655443


No 216
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=39.98  E-value=10  Score=20.38  Aligned_cols=16  Identities=25%  Similarity=0.432  Sum_probs=11.5

Q ss_pred             CCceeeCCCCCcccCc
Q psy7454          10 RYKYVCFACKFYTYNT   25 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~   25 (103)
                      ...+.|+.||......
T Consensus        20 ~~~l~C~kCgye~~~~   35 (113)
T COG1594          20 GGKLVCRKCGYEEEAS   35 (113)
T ss_pred             CcEEECCCCCcchhcc
Confidence            3468899999776544


No 217
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=39.98  E-value=15  Score=20.19  Aligned_cols=16  Identities=19%  Similarity=0.341  Sum_probs=12.5

Q ss_pred             CCceeeCCCCCcccCc
Q psy7454          10 RYKYVCFACKFYTYNT   25 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~   25 (103)
                      ...|.|+.|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            4468999999988753


No 218
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=39.86  E-value=18  Score=18.99  Aligned_cols=8  Identities=25%  Similarity=0.775  Sum_probs=5.3

Q ss_pred             ceeeCCCC
Q psy7454          12 KYVCFACK   19 (103)
Q Consensus        12 ~~~C~~C~   19 (103)
                      .|.|+.|+
T Consensus        21 ~f~CP~Cg   28 (99)
T PRK14892         21 IFECPRCG   28 (99)
T ss_pred             EeECCCCC
Confidence            46677776


No 219
>KOG4727|consensus
Probab=39.81  E-value=24  Score=20.60  Aligned_cols=22  Identities=23%  Similarity=0.412  Sum_probs=18.0

Q ss_pred             CceeeCCCCCcccCchhHHHHH
Q psy7454          11 YKYVCFACKFYTYNTGNIKRHL   32 (103)
Q Consensus        11 ~~~~C~~C~~~f~~~~~l~~h~   32 (103)
                      ..|-|.+|+..|...-++..|+
T Consensus        74 ~GyyCdVCdcvvKDSinflDHi   95 (193)
T KOG4727|consen   74 GGYYCDVCDCVVKDSINFLDHI   95 (193)
T ss_pred             CceeeeecceeehhhHHHHHHh
Confidence            3588999999998888887775


No 220
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=39.67  E-value=27  Score=16.19  Aligned_cols=32  Identities=19%  Similarity=0.363  Sum_probs=16.1

Q ss_pred             CCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCC
Q psy7454          38 EKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRY   74 (103)
Q Consensus        38 ~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~   74 (103)
                      +.|+....|+..|...+.+..  +   .......|++
T Consensus        22 ~~PV~s~~C~H~fek~aI~~~--i---~~~~~~~CPv   53 (57)
T PF11789_consen   22 EDPVKSKKCGHTFEKEAILQY--I---QRNGSKRCPV   53 (57)
T ss_dssp             SSEEEESSS--EEEHHHHHHH--C---TTTS-EE-SC
T ss_pred             hCCcCcCCCCCeecHHHHHHH--H---HhcCCCCCCC
Confidence            456667788887776654422  2   2344567776


No 221
>KOG2636|consensus
Probab=39.63  E-value=26  Score=23.76  Aligned_cols=27  Identities=15%  Similarity=0.586  Sum_probs=19.7

Q ss_pred             hhcCCCCCeecCCCC-ccccCchHHHHH
Q psy7454          33 GMHLGEKPFTCNMCE-FKCRDNRTLKAH   59 (103)
Q Consensus        33 ~~h~~~~~~~c~~C~-~~~~~~~~l~~h   59 (103)
                      +.|.-...|.|.+|| +.+.-+..+.+|
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHH
Confidence            456666778888888 677777777776


No 222
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=39.25  E-value=34  Score=15.71  Aligned_cols=10  Identities=40%  Similarity=1.079  Sum_probs=5.5

Q ss_pred             CCeeCCCCCc
Q psy7454          68 KPYPCRYCDY   77 (103)
Q Consensus        68 ~~~~c~~C~~   77 (103)
                      ..|.|..||.
T Consensus        43 i~y~C~~Cg~   52 (54)
T PF10058_consen   43 IQYRCPYCGA   52 (54)
T ss_pred             eEEEcCCCCC
Confidence            3456666653


No 223
>KOG1842|consensus
Probab=39.24  E-value=19  Score=24.36  Aligned_cols=29  Identities=21%  Similarity=0.362  Sum_probs=17.9

Q ss_pred             CCeecCCCCccccCchHHHHHHHHhcCCC
Q psy7454          39 KPFTCNMCEFKCRDNRTLKAHHINIHTGQ   67 (103)
Q Consensus        39 ~~~~c~~C~~~~~~~~~l~~h~~~~h~~~   67 (103)
                      +.|.|++|...|..-..|..|....|.++
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH~~e   42 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEHFEE   42 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhcccc
Confidence            34667777777777777766644445444


No 224
>PRK05978 hypothetical protein; Provisional
Probab=39.15  E-value=12  Score=21.25  Aligned_cols=11  Identities=18%  Similarity=0.452  Sum_probs=6.5

Q ss_pred             eCCCCCccccC
Q psy7454          71 PCRYCDYKARE   81 (103)
Q Consensus        71 ~c~~C~~~f~~   81 (103)
                      .|+.||..|..
T Consensus        54 ~C~~CG~~~~~   64 (148)
T PRK05978         54 HCAACGEDFTH   64 (148)
T ss_pred             CccccCCcccc
Confidence            56666665543


No 225
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=39.09  E-value=17  Score=20.33  Aligned_cols=44  Identities=16%  Similarity=0.194  Sum_probs=23.1

Q ss_pred             eecCCCCccccCchHHHHH-HH---HhcCCCCCeeCCCCCccccCcHH
Q psy7454          41 FTCNMCEFKCRDNRTLKAH-HI---NIHTGQKPYPCRYCDYKARETQA   84 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~l~~h-~~---~~h~~~~~~~c~~C~~~f~~~~~   84 (103)
                      -.|..|+..+...+.-..- ..   .....+.-+.|+.||+.|=.-+.
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH  139 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSH  139 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEeccccc
Confidence            5799998755443221000 00   00112346899999998744333


No 226
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=38.53  E-value=17  Score=22.19  Aligned_cols=15  Identities=27%  Similarity=0.306  Sum_probs=12.6

Q ss_pred             CCCeeCCCCCccccC
Q psy7454          67 QKPYPCRYCDYKARE   81 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~   81 (103)
                      .++..|..||..|.-
T Consensus       179 GkpqRCpECGqVFKL  193 (268)
T PTZ00043        179 GFLYRCGECDQIFML  193 (268)
T ss_pred             CCCccCCCCCcEEEE
Confidence            468899999998875


No 227
>PRK12722 transcriptional activator FlhC; Provisional
Probab=38.48  E-value=27  Score=20.68  Aligned_cols=9  Identities=22%  Similarity=0.870  Sum_probs=5.7

Q ss_pred             CeeCCCCCc
Q psy7454          69 PYPCRYCDY   77 (103)
Q Consensus        69 ~~~c~~C~~   77 (103)
                      .|.|+.|..
T Consensus       154 ~f~CplC~~  162 (187)
T PRK12722        154 SFVCGLCQP  162 (187)
T ss_pred             CCcCCCCCC
Confidence            566776654


No 228
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=38.35  E-value=23  Score=19.04  Aligned_cols=17  Identities=18%  Similarity=0.075  Sum_probs=11.0

Q ss_pred             CCCcccC-chhHHHHHhh
Q psy7454          18 CKFYTYN-TGNIKRHLGM   34 (103)
Q Consensus        18 C~~~f~~-~~~l~~h~~~   34 (103)
                      ||..|.. ..+.+.|-.+
T Consensus        29 CGh~f~d~r~NwK~~alv   46 (112)
T PF08882_consen   29 CGHEFCDARENWKLGALV   46 (112)
T ss_pred             CCCeecChhcChhhCcEE
Confidence            9988876 3556655443


No 229
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=37.60  E-value=20  Score=24.29  Aligned_cols=14  Identities=14%  Similarity=0.650  Sum_probs=6.7

Q ss_pred             CCeecCCCCccccC
Q psy7454          39 KPFTCNMCEFKCRD   52 (103)
Q Consensus        39 ~~~~c~~C~~~~~~   52 (103)
                      ..|.|..||..|..
T Consensus       424 ~~~~c~~c~~~yd~  437 (479)
T PRK05452        424 PRMQCSVCQWIYDP  437 (479)
T ss_pred             CeEEECCCCeEECC
Confidence            34555555544443


No 230
>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification]
Probab=37.40  E-value=29  Score=20.49  Aligned_cols=27  Identities=22%  Similarity=0.472  Sum_probs=20.1

Q ss_pred             CCCCCCCCceeeCCCCCcccCchhHHHHH
Q psy7454           4 PRPNAYRYKYVCFACKFYTYNTGNIKRHL   32 (103)
Q Consensus         4 ~~~h~~~~~~~C~~C~~~f~~~~~l~~h~   32 (103)
                      ++.|.|.  |.|..|.....++.++..|.
T Consensus        47 ~knh~Gk--~vC~LC~T~H~~e~Sy~~H~   73 (222)
T COG5246          47 SKNHTGK--YVCLLCKTKHLTEMSYVKHR   73 (222)
T ss_pred             hhcCCCc--EEeeeeccccccHHHHHHhh
Confidence            4556666  89999988877777777664


No 231
>PRK12860 transcriptional activator FlhC; Provisional
Probab=37.19  E-value=27  Score=20.69  Aligned_cols=11  Identities=27%  Similarity=0.347  Sum_probs=6.3

Q ss_pred             eecCCCCcccc
Q psy7454          41 FTCNMCEFKCR   51 (103)
Q Consensus        41 ~~c~~C~~~~~   51 (103)
                      ..|..||..|.
T Consensus       135 ~~C~~Cgg~fv  145 (189)
T PRK12860        135 ARCCRCGGKFV  145 (189)
T ss_pred             ccCCCCCCCee
Confidence            35666665553


No 232
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=37.00  E-value=22  Score=14.15  Aligned_cols=11  Identities=36%  Similarity=0.621  Sum_probs=5.1

Q ss_pred             ceeeCCCCCcc
Q psy7454          12 KYVCFACKFYT   22 (103)
Q Consensus        12 ~~~C~~C~~~f   22 (103)
                      .|.|+.|+..+
T Consensus        13 kY~Cp~C~~~~   23 (30)
T PF04438_consen   13 KYRCPRCGARY   23 (30)
T ss_dssp             SEE-TTT--EE
T ss_pred             EEECCCcCCce
Confidence            47777776543


No 233
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=36.86  E-value=26  Score=19.10  Aligned_cols=6  Identities=33%  Similarity=1.143  Sum_probs=3.4

Q ss_pred             eCCCCC
Q psy7454          71 PCRYCD   76 (103)
Q Consensus        71 ~c~~C~   76 (103)
                      .|+.||
T Consensus        94 ~CP~Cg   99 (124)
T PRK00762         94 ECPVCG   99 (124)
T ss_pred             cCcCCC
Confidence            455555


No 234
>PRK10220 hypothetical protein; Provisional
Probab=36.73  E-value=37  Score=18.25  Aligned_cols=13  Identities=23%  Similarity=0.700  Sum_probs=7.5

Q ss_pred             CeecCCCCccccC
Q psy7454          40 PFTCNMCEFKCRD   52 (103)
Q Consensus        40 ~~~c~~C~~~~~~   52 (103)
                      .+.|+.|+.-+..
T Consensus        20 ~~vCpeC~hEW~~   32 (111)
T PRK10220         20 MYICPECAHEWND   32 (111)
T ss_pred             eEECCcccCcCCc
Confidence            4667777654433


No 235
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=35.76  E-value=13  Score=17.41  Aligned_cols=16  Identities=19%  Similarity=0.478  Sum_probs=10.3

Q ss_pred             CCCeeCCCCCccccCc
Q psy7454          67 QKPYPCRYCDYKARET   82 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~   82 (103)
                      ...|.|..||..+-..
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            4567788888766654


No 236
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=35.68  E-value=30  Score=21.66  Aligned_cols=15  Identities=13%  Similarity=0.622  Sum_probs=8.4

Q ss_pred             CCeeCCCCCccccCc
Q psy7454          68 KPYPCRYCDYKARET   82 (103)
Q Consensus        68 ~~~~c~~C~~~f~~~   82 (103)
                      +.|.|+.||..+...
T Consensus       321 r~~~C~~cg~~~~rD  335 (364)
T COG0675         321 RLFKCPRCGFVHDRD  335 (364)
T ss_pred             eeEECCCCCCeehhh
Confidence            346677776554433


No 237
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=35.61  E-value=25  Score=14.50  Aligned_cols=12  Identities=42%  Similarity=0.830  Sum_probs=7.8

Q ss_pred             CceeeCCCCCcc
Q psy7454          11 YKYVCFACKFYT   22 (103)
Q Consensus        11 ~~~~C~~C~~~f   22 (103)
                      ..+.|+.||...
T Consensus        21 ~R~vC~~Cg~Ih   32 (34)
T PF14803_consen   21 ERLVCPACGFIH   32 (34)
T ss_dssp             -EEEETTTTEEE
T ss_pred             cceECCCCCCEE
Confidence            357788887654


No 238
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=35.61  E-value=19  Score=15.23  Aligned_cols=12  Identities=25%  Similarity=0.418  Sum_probs=8.6

Q ss_pred             eeeCCCCCcccC
Q psy7454          13 YVCFACKFYTYN   24 (103)
Q Consensus        13 ~~C~~C~~~f~~   24 (103)
                      +.|+.||..+.+
T Consensus        33 ~~C~~CGE~~~~   44 (46)
T TIGR03831        33 LVCPQCGEEYLD   44 (46)
T ss_pred             cccccCCCEeeC
Confidence            568888877643


No 239
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=35.49  E-value=25  Score=14.18  Aligned_cols=11  Identities=27%  Similarity=0.540  Sum_probs=7.5

Q ss_pred             ceeeCCCCCcc
Q psy7454          12 KYVCFACKFYT   22 (103)
Q Consensus        12 ~~~C~~C~~~f   22 (103)
                      .|+|..||...
T Consensus         4 ~ykC~~CGniv   14 (34)
T cd00974           4 VYKCEICGNIV   14 (34)
T ss_pred             EEEcCCCCcEE
Confidence            57777777554


No 240
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=35.25  E-value=24  Score=14.18  Aligned_cols=12  Identities=25%  Similarity=0.473  Sum_probs=8.7

Q ss_pred             CceeeCCCCCcc
Q psy7454          11 YKYVCFACKFYT   22 (103)
Q Consensus        11 ~~~~C~~C~~~f   22 (103)
                      +.|+|..||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            368888888655


No 241
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=35.07  E-value=37  Score=15.18  Aligned_cols=10  Identities=20%  Similarity=0.418  Sum_probs=6.2

Q ss_pred             eeCCCCCccc
Q psy7454          14 VCFACKFYTY   23 (103)
Q Consensus        14 ~C~~C~~~f~   23 (103)
                      .|..|++.|.
T Consensus         4 ~C~~C~~~F~   13 (57)
T cd00065           4 SCMGCGKPFT   13 (57)
T ss_pred             cCcccCcccc
Confidence            4666766664


No 242
>KOG2923|consensus
Probab=34.81  E-value=31  Score=16.57  Aligned_cols=10  Identities=20%  Similarity=0.600  Sum_probs=4.1

Q ss_pred             CCCeeCCCCC
Q psy7454          67 QKPYPCRYCD   76 (103)
Q Consensus        67 ~~~~~c~~C~   76 (103)
                      +....|+.|.
T Consensus        42 e~Va~CpsCS   51 (67)
T KOG2923|consen   42 EDVARCPSCS   51 (67)
T ss_pred             CeeecCCCce
Confidence            3333444443


No 243
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=34.63  E-value=16  Score=20.45  Aligned_cols=18  Identities=33%  Similarity=0.693  Sum_probs=13.3

Q ss_pred             hcCCCCCeeCCCCCccccC
Q psy7454          63 IHTGQKPYPCRYCDYKARE   81 (103)
Q Consensus        63 ~h~~~~~~~c~~C~~~f~~   81 (103)
                      .+.+ ++..|..||..|.-
T Consensus       107 l~~g-~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  107 LHKG-KPQRCPECGQVFKL  124 (136)
T ss_dssp             EETT-SEEEETTTEEEEEE
T ss_pred             EeCC-CccCCCCCCeEEEE
Confidence            3444 58899999988863


No 244
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF15616 TerY-C:  TerY-C metal binding domain
Probab=34.17  E-value=15  Score=20.43  Aligned_cols=13  Identities=23%  Similarity=0.815  Sum_probs=8.7

Q ss_pred             CCCCeeCCCCCcc
Q psy7454          66 GQKPYPCRYCDYK   78 (103)
Q Consensus        66 ~~~~~~c~~C~~~   78 (103)
                      ++.-..|++|+..
T Consensus       102 g~~~~~CPwCg~~  114 (131)
T PF15616_consen  102 GEGEVTCPWCGNE  114 (131)
T ss_pred             CCCCEECCCCCCe
Confidence            3445688888864


No 246
>KOG4118|consensus
Probab=33.78  E-value=23  Score=17.10  Aligned_cols=29  Identities=24%  Similarity=0.394  Sum_probs=14.7

Q ss_pred             eeCCCCCccccCcHHHHHHHHhhCCCCCc
Q psy7454          70 YPCRYCDYKARETQALKVHTKRYHPKMYD   98 (103)
Q Consensus        70 ~~c~~C~~~f~~~~~l~~H~~~~~~~~~~   98 (103)
                      +.|.+|.-.-.....+..|.-.-++..|+
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk~~~   67 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPKEPL   67 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCCCCC
Confidence            45555555555555555555554444443


No 247
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=33.67  E-value=14  Score=16.25  Aligned_cols=6  Identities=17%  Similarity=0.290  Sum_probs=2.9

Q ss_pred             CCcccc
Q psy7454          75 CDYKAR   80 (103)
Q Consensus        75 C~~~f~   80 (103)
                      ||..|.
T Consensus        33 Cg~tfv   38 (47)
T PF04606_consen   33 CGHTFV   38 (47)
T ss_pred             CCCEEE
Confidence            555443


No 248
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=32.49  E-value=65  Score=20.58  Aligned_cols=24  Identities=33%  Similarity=0.573  Sum_probs=16.9

Q ss_pred             CCCeeCCCCCccccCcHHHHHHHH
Q psy7454          67 QKPYPCRYCDYKARETQALKVHTK   90 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~~~l~~H~~   90 (103)
                      ..-|.|..|-+-|.....+.+|+.
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHH
Confidence            445777777777777777777766


No 249
>KOG1994|consensus
Probab=32.35  E-value=25  Score=21.51  Aligned_cols=25  Identities=24%  Similarity=0.546  Sum_probs=20.5

Q ss_pred             CCCCeeCCCCCccccCcHHHHHHHH
Q psy7454          66 GQKPYPCRYCDYKARETQALKVHTK   90 (103)
Q Consensus        66 ~~~~~~c~~C~~~f~~~~~l~~H~~   90 (103)
                      ....|-|.+||-.|.....|..|=.
T Consensus       236 R~eh~YC~fCG~~y~~~edl~ehCP  260 (268)
T KOG1994|consen  236 RSEHYYCFFCGIKYKDEEDLYEHCP  260 (268)
T ss_pred             hccceEEEEeccccCCHHHHHHhCC
Confidence            4567899999999999999887743


No 250
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=31.76  E-value=18  Score=17.51  Aligned_cols=34  Identities=18%  Similarity=0.431  Sum_probs=15.5

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCc
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEF   48 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~   48 (103)
                      .|+|..|+..-..  .+..+ .-+.|.--..|+.|..
T Consensus         4 ~FTC~~C~~Rs~~--~~sk~-aY~~GvViv~C~gC~~   37 (66)
T PF05180_consen    4 TFTCNKCGTRSAK--MFSKQ-AYHKGVVIVQCPGCKN   37 (66)
T ss_dssp             EEEETTTTEEEEE--EEEHH-HHHTSEEEEE-TTS--
T ss_pred             EEEcCCCCCccce--eeCHH-HHhCCeEEEECCCCcc
Confidence            3778888633221  11111 3334555566777764


No 251
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=31.60  E-value=45  Score=21.07  Aligned_cols=25  Identities=20%  Similarity=0.448  Sum_probs=16.1

Q ss_pred             CeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccc
Q psy7454          40 PFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKA   79 (103)
Q Consensus        40 ~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f   79 (103)
                      .|.|+.|...|...               |-.|..||-.|
T Consensus       255 GyvCs~Clsi~C~~---------------p~~C~~Cgt~f  279 (279)
T TIGR00627       255 GFVCSVCLSVLCQY---------------TPICKTCKTAF  279 (279)
T ss_pred             eEECCCccCCcCCC---------------CCCCCCCCCCC
Confidence            38888887665431               12788887654


No 252
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=31.49  E-value=21  Score=16.56  Aligned_cols=10  Identities=50%  Similarity=0.916  Sum_probs=3.0

Q ss_pred             ceeeCCCCCc
Q psy7454          12 KYVCFACKFY   21 (103)
Q Consensus        12 ~~~C~~C~~~   21 (103)
                      .|.|+.||.+
T Consensus        33 ~y~Cp~CgAt   42 (55)
T PF05741_consen   33 KYVCPICGAT   42 (55)
T ss_dssp             G---TTT---
T ss_pred             cCcCCCCcCc
Confidence            4788888755


No 253
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=30.94  E-value=28  Score=15.89  Aligned_cols=15  Identities=20%  Similarity=0.547  Sum_probs=8.5

Q ss_pred             CCCCeeCCCCCcccc
Q psy7454          66 GQKPYPCRYCDYKAR   80 (103)
Q Consensus        66 ~~~~~~c~~C~~~f~   80 (103)
                      ....+.|.+|++.+.
T Consensus        32 ~~~~~rC~YCe~~~~   46 (52)
T PF02748_consen   32 EPIKLRCHYCERIIT   46 (52)
T ss_dssp             TTCEEEETTT--EEE
T ss_pred             CCCEEEeeCCCCEec
Confidence            445677888877654


No 254
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=30.92  E-value=8.8  Score=15.38  Aligned_cols=6  Identities=33%  Similarity=1.209  Sum_probs=2.3

Q ss_pred             ecCCCC
Q psy7454          42 TCNMCE   47 (103)
Q Consensus        42 ~c~~C~   47 (103)
                      .|..|+
T Consensus        29 ~C~~C~   34 (39)
T smart00132       29 KCSKCG   34 (39)
T ss_pred             CCcccC
Confidence            333333


No 255
>KOG0978|consensus
Probab=30.49  E-value=24  Score=25.33  Aligned_cols=13  Identities=15%  Similarity=0.439  Sum_probs=7.9

Q ss_pred             eCCCCCccccCcH
Q psy7454          71 PCRYCDYKARETQ   83 (103)
Q Consensus        71 ~c~~C~~~f~~~~   83 (103)
                      +||.|+..|....
T Consensus       680 KCP~Cn~aFganD  692 (698)
T KOG0978|consen  680 KCPKCNAAFGAND  692 (698)
T ss_pred             CCCCCCCCCCccc
Confidence            5666666665443


No 256
>PF14369 zf-RING_3:  zinc-finger
Probab=30.38  E-value=24  Score=14.56  Aligned_cols=10  Identities=20%  Similarity=0.228  Sum_probs=8.2

Q ss_pred             eeCCCCCccc
Q psy7454          14 VCFACKFYTY   23 (103)
Q Consensus        14 ~C~~C~~~f~   23 (103)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            5999998875


No 257
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=30.20  E-value=7.2  Score=17.57  Aligned_cols=14  Identities=29%  Similarity=0.631  Sum_probs=8.1

Q ss_pred             CCeecCCCCccccC
Q psy7454          39 KPFTCNMCEFKCRD   52 (103)
Q Consensus        39 ~~~~c~~C~~~~~~   52 (103)
                      .-|.|..|+..+..
T Consensus        25 ~Cf~C~~C~~~l~~   38 (58)
T PF00412_consen   25 ECFKCSKCGKPLND   38 (58)
T ss_dssp             TTSBETTTTCBTTT
T ss_pred             cccccCCCCCccCC
Confidence            44566777655443


No 258
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=29.86  E-value=40  Score=19.18  Aligned_cols=10  Identities=20%  Similarity=0.610  Sum_probs=5.4

Q ss_pred             CCeecCCCCc
Q psy7454          39 KPFTCNMCEF   48 (103)
Q Consensus        39 ~~~~c~~C~~   48 (103)
                      ....|++||.
T Consensus        31 glv~CP~Cgs   40 (148)
T PF06676_consen   31 GLVSCPVCGS   40 (148)
T ss_pred             CCccCCCCCC
Confidence            3445666654


No 259
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=29.82  E-value=22  Score=23.36  Aligned_cols=22  Identities=23%  Similarity=0.315  Sum_probs=18.4

Q ss_pred             ceeeCCCCCcccCchhHHHHHh
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLG   33 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~   33 (103)
                      .+-|+.|++.|.....+..|..
T Consensus       238 ~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         238 KVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             ceeeHhhhhHhhhhHHHHHHHh
Confidence            4679999999999888888863


No 260
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=29.80  E-value=40  Score=14.23  Aligned_cols=10  Identities=20%  Similarity=0.520  Sum_probs=4.9

Q ss_pred             ceeeCCCCCc
Q psy7454          12 KYVCFACKFY   21 (103)
Q Consensus        12 ~~~C~~C~~~   21 (103)
                      +..|..|+..
T Consensus        11 ~~~C~~C~~~   20 (49)
T smart00109       11 PTKCCVCRKS   20 (49)
T ss_pred             CCCccccccc
Confidence            3445555543


No 261
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=29.41  E-value=28  Score=14.67  Aligned_cols=9  Identities=22%  Similarity=0.958  Sum_probs=4.5

Q ss_pred             eecCCCCcc
Q psy7454          41 FTCNMCEFK   49 (103)
Q Consensus        41 ~~c~~C~~~   49 (103)
                      |.|..|+..
T Consensus        29 y~C~~C~~~   37 (39)
T PF01096_consen   29 YVCCNCGHR   37 (39)
T ss_dssp             EEESSSTEE
T ss_pred             EEeCCCCCe
Confidence            455555543


No 262
>KOG2272|consensus
Probab=29.20  E-value=66  Score=20.21  Aligned_cols=19  Identities=16%  Similarity=0.312  Sum_probs=12.2

Q ss_pred             cCCCCCeeCCCCCccccCc
Q psy7454          64 HTGQKPYPCRYCDYKARET   82 (103)
Q Consensus        64 h~~~~~~~c~~C~~~f~~~   82 (103)
                      |..-..|.|..|.+.|.-.
T Consensus       216 hWHveHFvCa~CekPFlGH  234 (332)
T KOG2272|consen  216 HWHVEHFVCAKCEKPFLGH  234 (332)
T ss_pred             ccchhheeehhcCCcccch
Confidence            4444567788888777643


No 263
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=29.09  E-value=20  Score=20.51  Aligned_cols=21  Identities=19%  Similarity=0.204  Sum_probs=16.5

Q ss_pred             CCCCeeCCCCCccccCcHHHH
Q psy7454          66 GQKPYPCRYCDYKARETQALK   86 (103)
Q Consensus        66 ~~~~~~c~~C~~~f~~~~~l~   86 (103)
                      -+.|.-|..||+.|+|.....
T Consensus        65 ~~~PsYC~~CGkpyPWt~~~L   85 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWTENAL   85 (158)
T ss_pred             CCCChhHHhCCCCCchHHHHH
Confidence            356788999999999876543


No 264
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=29.06  E-value=33  Score=15.08  Aligned_cols=13  Identities=23%  Similarity=0.664  Sum_probs=10.2

Q ss_pred             ceeeCCCCCcccC
Q psy7454          12 KYVCFACKFYTYN   24 (103)
Q Consensus        12 ~~~C~~C~~~f~~   24 (103)
                      .+.|+.||..+..
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            6889999976654


No 265
>PHA02942 putative transposase; Provisional
Probab=29.06  E-value=39  Score=22.31  Aligned_cols=16  Identities=19%  Similarity=0.706  Sum_probs=11.3

Q ss_pred             CCCeeCCCCCccccCc
Q psy7454          67 QKPYPCRYCDYKARET   82 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~   82 (103)
                      .+.|.|..||......
T Consensus       340 ~r~f~C~~CG~~~drD  355 (383)
T PHA02942        340 HRYFHCPSCGYENDRD  355 (383)
T ss_pred             CCEEECCCCCCEeCcH
Confidence            4568999999765543


No 266
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=28.55  E-value=39  Score=17.43  Aligned_cols=18  Identities=17%  Similarity=0.370  Sum_probs=12.8

Q ss_pred             ceeeCCCCCcccCchhHH
Q psy7454          12 KYVCFACKFYTYNTGNIK   29 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~   29 (103)
                      ...|+.||..+.....+.
T Consensus        35 a~~C~~CGe~y~~dev~~   52 (89)
T TIGR03829        35 SISCSHCGMEYQDDTTVK   52 (89)
T ss_pred             cccccCCCcEeecHHHHH
Confidence            367899998887755543


No 267
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=27.93  E-value=42  Score=15.00  Aligned_cols=9  Identities=22%  Similarity=0.903  Sum_probs=3.4

Q ss_pred             CeeCCCCCc
Q psy7454          69 PYPCRYCDY   77 (103)
Q Consensus        69 ~~~c~~C~~   77 (103)
                      .|.|+.|++
T Consensus        41 ~W~CPiC~~   49 (50)
T PF02891_consen   41 KWKCPICNK   49 (50)
T ss_dssp             --B-TTT--
T ss_pred             CeECcCCcC
Confidence            388888864


No 268
>PRK11032 hypothetical protein; Provisional
Probab=27.66  E-value=48  Score=19.13  Aligned_cols=8  Identities=25%  Similarity=1.032  Sum_probs=4.3

Q ss_pred             eecCCCCc
Q psy7454          41 FTCNMCEF   48 (103)
Q Consensus        41 ~~c~~C~~   48 (103)
                      ..|..||.
T Consensus       125 LvC~~Cg~  132 (160)
T PRK11032        125 LVCEKCHH  132 (160)
T ss_pred             EEecCCCC
Confidence            45555553


No 269
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=27.65  E-value=30  Score=15.84  Aligned_cols=10  Identities=30%  Similarity=0.870  Sum_probs=6.7

Q ss_pred             eCCCCCcccc
Q psy7454          71 PCRYCDYKAR   80 (103)
Q Consensus        71 ~c~~C~~~f~   80 (103)
                      .|++||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            5777876554


No 270
>PLN02748 tRNA dimethylallyltransferase
Probab=27.30  E-value=48  Score=22.67  Aligned_cols=23  Identities=26%  Similarity=0.387  Sum_probs=14.8

Q ss_pred             ceeeCCCCC-cccCchhHHHHHhh
Q psy7454          12 KYVCFACKF-YTYNTGNIKRHLGM   34 (103)
Q Consensus        12 ~~~C~~C~~-~f~~~~~l~~h~~~   34 (103)
                      .|.|.+|+. .+.-......|.+.
T Consensus       418 ~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        418 QYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             cccccCCCCcccCCHHHHHHHhcc
Confidence            467777776 56666666666543


No 271
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=27.11  E-value=15  Score=19.13  Aligned_cols=37  Identities=24%  Similarity=0.441  Sum_probs=18.9

Q ss_pred             eecCCCCccccCchHHHHHHHHh--cCCCCCeeCCCCCcccc
Q psy7454          41 FTCNMCEFKCRDNRTLKAHHINI--HTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~l~~h~~~~--h~~~~~~~c~~C~~~f~   80 (103)
                      ..|+.||..-..-..++   .++  -....-|.|..|+..+.
T Consensus        63 ~~Cp~Cg~~~a~f~~~Q---~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        63 VECPKCGHKEAYYWLLQ---TRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             CCCCCCCCCeeEEEEec---cCCCCCCcEEEEEeCCCCCeeE
Confidence            57888885432222221   111  11223588988987543


No 272
>PRK01343 zinc-binding protein; Provisional
Probab=26.40  E-value=62  Score=15.18  Aligned_cols=11  Identities=18%  Similarity=0.295  Sum_probs=7.7

Q ss_pred             ceeeCCCCCcc
Q psy7454          12 KYVCFACKFYT   22 (103)
Q Consensus        12 ~~~C~~C~~~f   22 (103)
                      ...|+.|++.+
T Consensus         9 ~~~CP~C~k~~   19 (57)
T PRK01343          9 TRPCPECGKPS   19 (57)
T ss_pred             CCcCCCCCCcC
Confidence            45688888765


No 273
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=26.24  E-value=31  Score=19.57  Aligned_cols=13  Identities=15%  Similarity=0.294  Sum_probs=10.1

Q ss_pred             eeCCCCCccccCc
Q psy7454          70 YPCRYCDYKARET   82 (103)
Q Consensus        70 ~~c~~C~~~f~~~   82 (103)
                      -.|..||+.|++-
T Consensus        29 ReC~~C~~RFTTy   41 (147)
T TIGR00244        29 RECLECHERFTTF   41 (147)
T ss_pred             ccCCccCCcccee
Confidence            4788899888754


No 274
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=25.50  E-value=36  Score=14.56  Aligned_cols=8  Identities=25%  Similarity=0.484  Sum_probs=4.6

Q ss_pred             ceeeCCCC
Q psy7454          12 KYVCFACK   19 (103)
Q Consensus        12 ~~~C~~C~   19 (103)
                      +..|+.||
T Consensus         2 ~~~Cp~Cg    9 (47)
T PF14690_consen    2 PPRCPHCG    9 (47)
T ss_pred             CccCCCcC
Confidence            34566666


No 275
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=25.34  E-value=27  Score=22.25  Aligned_cols=13  Identities=15%  Similarity=0.595  Sum_probs=7.5

Q ss_pred             eecCCCCccccCc
Q psy7454          41 FTCNMCEFKCRDN   53 (103)
Q Consensus        41 ~~c~~C~~~~~~~   53 (103)
                      ++|+.|+.-+...
T Consensus        58 ~vcp~c~~h~rlt   70 (296)
T CHL00174         58 NICEQCGYHLKMS   70 (296)
T ss_pred             CCCCCCCCCcCCC
Confidence            4666666655443


No 276
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=24.90  E-value=37  Score=15.57  Aligned_cols=10  Identities=20%  Similarity=0.162  Sum_probs=5.3

Q ss_pred             ceeeCCCCCc
Q psy7454          12 KYVCFACKFY   21 (103)
Q Consensus        12 ~~~C~~C~~~   21 (103)
                      ..+||.||..
T Consensus         3 LkPCPFCG~~   12 (61)
T PF14354_consen    3 LKPCPFCGSA   12 (61)
T ss_pred             CcCCCCCCCc
Confidence            3456666533


No 277
>KOG3214|consensus
Probab=24.82  E-value=22  Score=18.73  Aligned_cols=12  Identities=25%  Similarity=0.708  Sum_probs=6.3

Q ss_pred             eecCCCCccccC
Q psy7454          41 FTCNMCEFKCRD   52 (103)
Q Consensus        41 ~~c~~C~~~~~~   52 (103)
                      ..|.+|+..|..
T Consensus        48 ~sC~iC~esFqt   59 (109)
T KOG3214|consen   48 ASCRICEESFQT   59 (109)
T ss_pred             eeeeehhhhhcc
Confidence            345555555544


No 278
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=24.82  E-value=1.3e+02  Score=17.20  Aligned_cols=11  Identities=18%  Similarity=0.624  Sum_probs=5.4

Q ss_pred             eecCCCCcccc
Q psy7454          41 FTCNMCEFKCR   51 (103)
Q Consensus        41 ~~c~~C~~~~~   51 (103)
                      ..|..|+..+.
T Consensus       106 ~~C~~C~~~~~  116 (178)
T PF02146_consen  106 LRCSKCGKEYD  116 (178)
T ss_dssp             EEETTTSBEEE
T ss_pred             eeecCCCcccc
Confidence            34555555444


No 279
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=24.59  E-value=36  Score=18.19  Aligned_cols=24  Identities=17%  Similarity=0.292  Sum_probs=18.6

Q ss_pred             CCceeeCCCCCcccCchhHHHHHh
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLG   33 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~   33 (103)
                      -..+-|-.|.+.|.+...|..|.+
T Consensus        53 lGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          53 LGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CceeeeehhHHHHHHHHHHHHHhc
Confidence            335778889999988888888864


No 280
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=24.42  E-value=42  Score=19.47  Aligned_cols=45  Identities=11%  Similarity=0.208  Sum_probs=23.8

Q ss_pred             eecCCCCccccCchHHHHHHHHh-----cCCCCCeeCCCCCccccCcHHHH
Q psy7454          41 FTCNMCEFKCRDNRTLKAHHINI-----HTGQKPYPCRYCDYKARETQALK   86 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~l~~h~~~~-----h~~~~~~~c~~C~~~f~~~~~l~   86 (103)
                      -.|+.|+......+.=.-- .+.     -..+.-+.|..||+.|=--+...
T Consensus        98 ~RCp~CN~~L~~vs~eev~-~~Vp~~~~~~~~~f~~C~~CgkiYW~GsHw~  147 (165)
T COG1656          98 SRCPECNGELEKVSREEVK-EKVPEKVYRNYEEFYRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             ccCcccCCEeccCcHHHHh-hccchhhhhcccceeECCCCcccccCchHHH
Confidence            4699998655443321100 000     11234578999999875444443


No 281
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=24.36  E-value=38  Score=15.88  Aligned_cols=12  Identities=17%  Similarity=0.052  Sum_probs=5.4

Q ss_pred             eeeCCCCCcccC
Q psy7454          13 YVCFACKFYTYN   24 (103)
Q Consensus        13 ~~C~~C~~~f~~   24 (103)
                      ..|+.|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            468888876543


No 282
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=24.18  E-value=41  Score=15.53  Aligned_cols=23  Identities=17%  Similarity=0.364  Sum_probs=14.5

Q ss_pred             CCCCCeeCCCCCccccCcHHHHH
Q psy7454          65 TGQKPYPCRYCDYKARETQALKV   87 (103)
Q Consensus        65 ~~~~~~~c~~C~~~f~~~~~l~~   87 (103)
                      .+.+.+-|-+||-.|.....|..
T Consensus        23 LR~~~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   23 LREEHNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             HHhhCceeeeeCCccCCHHHHHh
Confidence            34445567777777777666643


No 283
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=24.15  E-value=30  Score=21.87  Aligned_cols=13  Identities=23%  Similarity=0.590  Sum_probs=7.7

Q ss_pred             eecCCCCccccCc
Q psy7454          41 FTCNMCEFKCRDN   53 (103)
Q Consensus        41 ~~c~~C~~~~~~~   53 (103)
                      ++|+.|+.-+...
T Consensus        46 ~vc~~c~~h~rl~   58 (285)
T TIGR00515        46 EVCPKCDHHMRMD   58 (285)
T ss_pred             CCCCCCCCcCcCC
Confidence            4677777655543


No 284
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=23.85  E-value=27  Score=22.30  Aligned_cols=10  Identities=20%  Similarity=0.584  Sum_probs=6.5

Q ss_pred             eeCCCCCccc
Q psy7454          70 YPCRYCDYKA   79 (103)
Q Consensus        70 ~~c~~C~~~f   79 (103)
                      |.|..||..+
T Consensus       287 ~~C~~Cg~~w  296 (299)
T TIGR01385       287 VTCEECGNRW  296 (299)
T ss_pred             EEcCCCCCee
Confidence            5777777544


No 285
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=23.52  E-value=48  Score=16.18  Aligned_cols=26  Identities=31%  Similarity=0.757  Sum_probs=12.6

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccc
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKC   50 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~   50 (103)
                      |.| .||+....          ..+.+.-.| .||+..
T Consensus         4 frC-~Cgr~lya----------~e~~kTkkC-~CG~~l   29 (68)
T PF09082_consen    4 FRC-DCGRYLYA----------KEGAKTKKC-VCGKTL   29 (68)
T ss_dssp             EEE-TTS--EEE----------ETT-SEEEE-TTTEEE
T ss_pred             EEe-cCCCEEEe----------cCCcceeEe-cCCCee
Confidence            567 47755432          233444567 777654


No 286
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=23.35  E-value=75  Score=21.70  Aligned_cols=25  Identities=28%  Similarity=0.574  Sum_probs=21.5

Q ss_pred             CCCeeCCCCCccccCcHHHHHHHHh
Q psy7454          67 QKPYPCRYCDYKARETQALKVHTKR   91 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~~~l~~H~~~   91 (103)
                      ...|.|..|-+-|.....|.+|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            4568999999999999999999874


No 287
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=22.98  E-value=32  Score=21.84  Aligned_cols=32  Identities=19%  Similarity=0.404  Sum_probs=16.9

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCc
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDN   53 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~   53 (103)
                      .+|+.|+.....+. |.        +..++|+.|+.-+...
T Consensus        28 ~~c~~c~~~~~~~~-l~--------~~~~vc~~c~~h~rl~   59 (292)
T PRK05654         28 TKCPSCGQVLYRKE-LE--------ANLNVCPKCGHHMRIS   59 (292)
T ss_pred             eECCCccchhhHHH-HH--------hcCCCCCCCCCCeeCC
Confidence            45777765442211 11        1234677887766544


No 288
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=22.73  E-value=52  Score=21.19  Aligned_cols=11  Identities=18%  Similarity=0.443  Sum_probs=8.0

Q ss_pred             CceeeCCCCCc
Q psy7454          11 YKYVCFACKFY   21 (103)
Q Consensus        11 ~~~~C~~C~~~   21 (103)
                      ....|++||..
T Consensus       186 ~~~~CPvCGs~  196 (309)
T PRK03564        186 QRQFCPVCGSM  196 (309)
T ss_pred             CCCCCCCCCCc
Confidence            34679999854


No 289
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=22.41  E-value=36  Score=16.34  Aligned_cols=9  Identities=33%  Similarity=0.667  Sum_probs=5.9

Q ss_pred             eeeCCCCCc
Q psy7454          13 YVCFACKFY   21 (103)
Q Consensus        13 ~~C~~C~~~   21 (103)
                      |.|+.||..
T Consensus         1 y~C~KCg~~    9 (64)
T PF09855_consen    1 YKCPKCGNE    9 (64)
T ss_pred             CCCCCCCCc
Confidence            567777753


No 290
>KOG3277|consensus
Probab=22.28  E-value=56  Score=18.81  Aligned_cols=33  Identities=21%  Similarity=0.477  Sum_probs=14.7

Q ss_pred             ceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCC
Q psy7454          12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCE   47 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~   47 (103)
                      .|+|.+|+..-.  ..+.. +..+.|.--..|+.|.
T Consensus        79 ~yTCkvCntRs~--ktisk-~AY~~GvVivqC~gC~  111 (165)
T KOG3277|consen   79 AYTCKVCNTRST--KTISK-QAYEKGVVIVQCPGCK  111 (165)
T ss_pred             EEEeeccCCccc--cccCh-hhhhCceEEEECCCCc
Confidence            366777763321  11111 1333444445566664


No 291
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=22.25  E-value=49  Score=12.89  Aligned_cols=8  Identities=38%  Similarity=0.737  Sum_probs=4.1

Q ss_pred             eCCCCCcc
Q psy7454          71 PCRYCDYK   78 (103)
Q Consensus        71 ~c~~C~~~   78 (103)
                      .|..|++.
T Consensus         2 ~C~~C~~~    9 (30)
T PF03107_consen    2 WCDVCRRK    9 (30)
T ss_pred             CCCCCCCC
Confidence            45555543


No 292
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=22.03  E-value=61  Score=18.91  Aligned_cols=18  Identities=11%  Similarity=0.104  Sum_probs=12.1

Q ss_pred             ceeeCCCCCcccCchhHH
Q psy7454          12 KYVCFACKFYTYNTGNIK   29 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~   29 (103)
                      ...|..||+.|.....+.
T Consensus       114 ~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        114 LQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             cCcCcccCCccCcHhHHH
Confidence            566888888887654443


No 293
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=21.88  E-value=88  Score=16.59  Aligned_cols=18  Identities=22%  Similarity=0.340  Sum_probs=13.8

Q ss_pred             ceeeCCCCCcccCchhHH
Q psy7454          12 KYVCFACKFYTYNTGNIK   29 (103)
Q Consensus        12 ~~~C~~C~~~f~~~~~l~   29 (103)
                      .+.|+.||..+.......
T Consensus        31 ~~~C~~CGe~~~~~e~~~   48 (127)
T TIGR03830        31 GWYCPACGEELLDPEESK   48 (127)
T ss_pred             eeECCCCCCEEEcHHHHH
Confidence            478999999888765544


No 294
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=21.81  E-value=25  Score=16.27  Aligned_cols=26  Identities=19%  Similarity=0.408  Sum_probs=17.5

Q ss_pred             eeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccc
Q psy7454          13 YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKC   50 (103)
Q Consensus        13 ~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~   50 (103)
                      -.|+.||..|..            +.-...|+.|+..+
T Consensus         6 ~~C~~Cg~~~~~------------~dDiVvCp~Cgapy   31 (54)
T PF14446_consen    6 CKCPVCGKKFKD------------GDDIVVCPECGAPY   31 (54)
T ss_pred             ccChhhCCcccC------------CCCEEECCCCCCcc
Confidence            478889877743            23445788888654


No 295
>KOG3352|consensus
Probab=21.70  E-value=48  Score=18.92  Aligned_cols=13  Identities=15%  Similarity=0.368  Sum_probs=10.2

Q ss_pred             CCeeCCCCCcccc
Q psy7454          68 KPYPCRYCDYKAR   80 (103)
Q Consensus        68 ~~~~c~~C~~~f~   80 (103)
                      +...|.+||..|.
T Consensus       132 e~~rc~eCG~~fk  144 (153)
T KOG3352|consen  132 ETQRCPECGHYFK  144 (153)
T ss_pred             CcccCCcccceEE
Confidence            4567999998876


No 296
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=21.70  E-value=86  Score=13.15  Aligned_cols=10  Identities=20%  Similarity=0.750  Sum_probs=2.3

Q ss_pred             eecCCCCccc
Q psy7454          41 FTCNMCEFKC   50 (103)
Q Consensus        41 ~~c~~C~~~~   50 (103)
                      |-|+.|...+
T Consensus         4 yyCdyC~~~~   13 (38)
T PF06220_consen    4 YYCDYCKKYL   13 (38)
T ss_dssp             -B-TTT--B-
T ss_pred             eeccccccee
Confidence            3445554433


No 297
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=21.67  E-value=49  Score=14.35  Aligned_cols=10  Identities=20%  Similarity=0.597  Sum_probs=4.4

Q ss_pred             eeCCCCCccc
Q psy7454          70 YPCRYCDYKA   79 (103)
Q Consensus        70 ~~c~~C~~~f   79 (103)
                      |.|..|+.++
T Consensus        12 ~~CL~C~~~~   21 (50)
T smart00290       12 WLCLTCGQVG   21 (50)
T ss_pred             EEecCCCCcc
Confidence            4444444433


No 298
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=21.56  E-value=31  Score=20.60  Aligned_cols=23  Identities=22%  Similarity=0.560  Sum_probs=0.0

Q ss_pred             CceeeCCCCCccc-CchhHHHHHh
Q psy7454          11 YKYVCFACKFYTY-NTGNIKRHLG   33 (103)
Q Consensus        11 ~~~~C~~C~~~f~-~~~~l~~h~~   33 (103)
                      ..|.|.+||.... -+..+..|..
T Consensus       100 ~ey~CEICGN~~Y~GrkaFekHF~  123 (196)
T PF11931_consen  100 VEYKCEICGNQSYKGRKAFEKHFQ  123 (196)
T ss_dssp             ------------------------
T ss_pred             CeeeeEeCCCcceecHHHHHHhcC
Confidence            3599999996544 4677777754


No 299
>COG5539 Predicted cysteine protease (OTU family) [Posttranslational modification, protein turnover, chaperones]
Probab=21.52  E-value=92  Score=19.98  Aligned_cols=24  Identities=13%  Similarity=0.076  Sum_probs=17.0

Q ss_pred             CCCCceeeCCCCCcccCchhHHHH
Q psy7454           8 AYRYKYVCFACKFYTYNTGNIKRH   31 (103)
Q Consensus         8 ~~~~~~~C~~C~~~f~~~~~l~~h   31 (103)
                      ++....+|..||..|.-...+.+|
T Consensus       271 T~~~~ik~n~c~~~~~~e~~~~~H  294 (306)
T COG5539         271 TASPSIKCNICGTGFVGEKDYYAH  294 (306)
T ss_pred             cCCceEEeeccccccchhhHHHHH
Confidence            344457788888888776666666


No 300
>PF05280 FlhC:  Flagellar transcriptional activator (FlhC);  InterPro: IPR007944 This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in Escherichia coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator [].; GO: 0003677 DNA binding, 0030092 regulation of flagellum assembly, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2AVU_E.
Probab=21.43  E-value=42  Score=19.63  Aligned_cols=12  Identities=17%  Similarity=0.312  Sum_probs=4.9

Q ss_pred             eecCCCCccccC
Q psy7454          41 FTCNMCEFKCRD   52 (103)
Q Consensus        41 ~~c~~C~~~~~~   52 (103)
                      -.|..|+..|..
T Consensus       135 ~~C~~C~~~fv~  146 (175)
T PF05280_consen  135 APCRRCGGHFVT  146 (175)
T ss_dssp             EE-TTT--EEEE
T ss_pred             cCCCCCCCCeEC
Confidence            356666655543


No 301
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=21.35  E-value=43  Score=19.18  Aligned_cols=13  Identities=15%  Similarity=0.286  Sum_probs=9.9

Q ss_pred             eeCCCCCccccCc
Q psy7454          70 YPCRYCDYKARET   82 (103)
Q Consensus        70 ~~c~~C~~~f~~~   82 (103)
                      -.|..||..|++-
T Consensus        29 ReC~~C~~RFTTf   41 (156)
T COG1327          29 RECLECGERFTTF   41 (156)
T ss_pred             hcccccccccchh
Confidence            4788899888753


No 302
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=21.10  E-value=49  Score=14.76  Aligned_cols=9  Identities=22%  Similarity=0.268  Sum_probs=4.4

Q ss_pred             eCCCCCccc
Q psy7454          15 CFACKFYTY   23 (103)
Q Consensus        15 C~~C~~~f~   23 (103)
                      |+.||..|.
T Consensus         1 CP~Cg~~f~    9 (50)
T PF14375_consen    1 CPRCGAPFE    9 (50)
T ss_pred             CCCCCCcCC
Confidence            445555443


No 303
>KOG3014|consensus
Probab=21.09  E-value=84  Score=19.66  Aligned_cols=23  Identities=22%  Similarity=0.229  Sum_probs=13.0

Q ss_pred             eeCCCCCcccCc--hhHHHHHhhcC
Q psy7454          14 VCFACKFYTYNT--GNIKRHLGMHL   36 (103)
Q Consensus        14 ~C~~C~~~f~~~--~~l~~h~~~h~   36 (103)
                      .|..||..+...  ..-..|.+.|.
T Consensus        39 ~C~~Cgm~Yt~~s~EDe~~H~~fH~   63 (257)
T KOG3014|consen   39 KCKECGMKYTVTSPEDEALHEKFHN   63 (257)
T ss_pred             ehhhcCceecCCCHHHHHHHHHHHH
Confidence            577777665542  33455666554


No 304
>PTZ00064 histone acetyltransferase; Provisional
Probab=20.92  E-value=1e+02  Score=21.54  Aligned_cols=25  Identities=24%  Similarity=0.210  Sum_probs=21.7

Q ss_pred             CCCeeCCCCCccccCcHHHHHHHHh
Q psy7454          67 QKPYPCRYCDYKARETQALKVHTKR   91 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~~~l~~H~~~   91 (103)
                      ...|.|..|-+-|.....|.+|+..
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhc
Confidence            4568999999999999999999874


No 305
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=20.81  E-value=85  Score=20.48  Aligned_cols=45  Identities=18%  Similarity=0.353  Sum_probs=27.5

Q ss_pred             CCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHH
Q psy7454          36 LGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQA   84 (103)
Q Consensus        36 ~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~   84 (103)
                      +.+.|-.-..||-.....+ |.   +.+..|...|+|++|.......+.
T Consensus       347 t~ENpP~ml~CgHVIskea-l~---~LS~nG~~~FKCPYCP~~~~~~~~  391 (396)
T COG5109         347 TDENPPVMLECGHVISKEA-LS---VLSQNGVLSFKCPYCPEMSKYENI  391 (396)
T ss_pred             cccCCCeeeeccceeeHHH-HH---HHhhcCcEEeeCCCCCcchhhhhh
Confidence            3455545566886654443 32   345667778999999865544433


No 306
>PRK06260 threonine synthase; Validated
Probab=20.68  E-value=1.1e+02  Score=20.22  Aligned_cols=10  Identities=20%  Similarity=0.444  Sum_probs=5.6

Q ss_pred             eeeCCCCCcc
Q psy7454          13 YVCFACKFYT   22 (103)
Q Consensus        13 ~~C~~C~~~f   22 (103)
                      +.|..||..|
T Consensus         4 ~~C~~cg~~~   13 (397)
T PRK06260          4 LKCIECGKEY   13 (397)
T ss_pred             EEECCCCCCC
Confidence            4566666554


No 307
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.59  E-value=49  Score=17.62  Aligned_cols=13  Identities=15%  Similarity=0.102  Sum_probs=9.1

Q ss_pred             ceeeCCCCCcccC
Q psy7454          12 KYVCFACKFYTYN   24 (103)
Q Consensus        12 ~~~C~~C~~~f~~   24 (103)
                      ...||.||..|..
T Consensus        49 ~t~CP~Cg~~~e~   61 (115)
T COG1885          49 STSCPKCGEPFES   61 (115)
T ss_pred             cccCCCCCCccce
Confidence            4678888876643


No 308
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=20.58  E-value=1.1e+02  Score=19.02  Aligned_cols=35  Identities=17%  Similarity=0.346  Sum_probs=19.5

Q ss_pred             eecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCcccc
Q psy7454          41 FTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKAR   80 (103)
Q Consensus        41 ~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~   80 (103)
                      -.|..|......  ....- ++.  +...-.|+.||+.-.
T Consensus       198 ~~C~GC~m~l~~--~~~~~-V~~--~d~iv~CP~CgRILy  232 (239)
T COG1579         198 RVCGGCHMKLPS--QTLSK-VRK--KDEIVFCPYCGRILY  232 (239)
T ss_pred             CcccCCeeeecH--HHHHH-Hhc--CCCCccCCccchHHH
Confidence            357777654433  33332 333  444557999997543


No 309
>PLN03239 histone acetyltransferase; Provisional
Probab=20.24  E-value=79  Score=20.82  Aligned_cols=25  Identities=12%  Similarity=0.110  Sum_probs=21.8

Q ss_pred             CCCeeCCCCCccccCcHHHHHHHHh
Q psy7454          67 QKPYPCRYCDYKARETQALKVHTKR   91 (103)
Q Consensus        67 ~~~~~c~~C~~~f~~~~~l~~H~~~   91 (103)
                      ...|.|..|-+-|.....|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4679999999999999999999764


No 310
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=20.15  E-value=48  Score=23.13  Aligned_cols=12  Identities=17%  Similarity=0.105  Sum_probs=7.2

Q ss_pred             eeeCCCCCcccC
Q psy7454          13 YVCFACKFYTYN   24 (103)
Q Consensus        13 ~~C~~C~~~f~~   24 (103)
                      .+|+.||..+..
T Consensus       201 vpCPhCg~~~~l  212 (557)
T PF05876_consen  201 VPCPHCGEEQVL  212 (557)
T ss_pred             ccCCCCCCCccc
Confidence            457777765543


Done!