RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy7530
         (60 letters)



>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein
          Musashi homologs Musashi-1, Musashi-2 and similar
          proteins.  This subfamily corresponds to the RRM2.in
          Musashi-1 (also termed Msi1), a neural RNA-binding
          protein putatively expressed in central nervous system
          (CNS) stem cells and neural progenitor cells, and
          associated with asymmetric divisions in neural
          progenitor cells. It is evolutionarily conserved from
          invertebrates to vertebrates. Musashi-1 is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1). It has been
          implicated in the maintenance of the stem-cell state,
          differentiation, and tumorigenesis. It translationally
          regulates the expression of a mammalian numb gene by
          binding to the 3'-untranslated region of mRNA of Numb,
          encoding a membrane-associated inhibitor of Notch
          signaling, and further influences neural development.
          Moreover, Musashi-1 represses translation by
          interacting with the poly(A)-binding protein and
          competes for binding of the eukaryotic initiation
          factor-4G (eIF-4G). Musashi-2 (also termed Msi2) has
          been identified as a regulator of the hematopoietic
          stem cell (HSC) compartment and of leukemic stem cells
          after transplantation of cells with loss and gain of
          function of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Both, Musashi-1 and
          Musashi-2, contain two conserved N-terminal tandem RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          along with other domains of unknown function. .
          Length = 74

 Score = 52.8 bits (127), Expect = 2e-11
 Identities = 20/26 (76%), Positives = 21/26 (80%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KIFVGGLSA TT +DVK YF QFG V
Sbjct: 1  KIFVGGLSANTTEDDVKKYFSQFGKV 26


>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding
          protein Musashi homolog 2 (Musashi-2) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-2 (also termed Msi2) which has been identified
          as a regulator of the hematopoietic stem cell (HSC)
          compartment and of leukemic stem cells after
          transplantation of cells with loss and gain of function
          of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Musashi-2 contains two
          conserved N-terminal tandem RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 79

 Score = 50.8 bits (121), Expect = 2e-10
 Identities = 25/30 (83%), Positives = 26/30 (86%)

Query: 12 TRTKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          TRTKKIFVGGLSA T +EDVK YFEQFG V
Sbjct: 1  TRTKKIFVGGLSANTVVEDVKQYFEQFGKV 30


>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding
          protein Musashi homolog 1 (Musashi-1) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-1. The mammalian MSI1 gene encoding Musashi-1
          (also termed Msi1) is a neural RNA-binding protein
          putatively expressed in central nervous system (CNS)
          stem cells and neural progenitor cells, and associated
          with asymmetric divisions in neural progenitor cells.
          Musashi-1 is evolutionarily conserved from
          invertebrates to vertebrates. It is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1) and has been
          implicated in the maintenance of the stem-cell state,
          differentiation, and tumorigenesis. It translationally
          regulates the expression of a mammalian numb gene by
          binding to the 3'-untranslated region of mRNA of Numb,
          encoding a membrane-associated inhibitor of Notch
          signaling, and further influences neural development.
          It represses translation by interacting with the
          poly(A)-binding protein and competes for binding of the
          eukaryotic initiation factor-4G (eIF-4G). Musashi-1
          contains two conserved N-terminal tandem RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          along with other domains of unknown function. .
          Length = 74

 Score = 44.2 bits (104), Expect = 5e-08
 Identities = 21/26 (80%), Positives = 22/26 (84%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KIFVGGLS  TT+EDVK YFEQFG V
Sbjct: 1  KIFVGGLSVNTTVEDVKQYFEQFGKV 26


>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in
          RRM-containing coactivator activator/modulator (CoAA)
          and similar proteins.  This subfamily corresponds to
          the RRM in CoAA (also known as RBM14 or PSP2) and
          RNA-binding protein 4 (RBM4). CoAA is a heterogeneous
          nuclear ribonucleoprotein (hnRNP)-like protein
          identified as a nuclear receptor coactivator. It
          mediates transcriptional coactivation and RNA splicing
          effects in a promoter-preferential manner, and is
          enhanced by thyroid hormone receptor-binding protein
          (TRBP). CoAA contains two N-terminal RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a
          TRBP-interacting domain. RBM4 is a ubiquitously
          expressed splicing factor with two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may also function as a translational
          regulator of stress-associated mRNAs as well as play a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RRMs, a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. This family also includes Drosophila
          RNA-binding protein lark (Dlark), a homolog of human
          RBM4. It plays an important role in embryonic
          development and in the circadian regulation of adult
          eclosion. Dlark shares high sequence similarity with
          RBM4 at the N-terminal region. However, Dlark has three
          proline-rich segments instead of three alanine-rich
          segments within the C-terminal region. .
          Length = 66

 Score = 41.1 bits (97), Expect = 5e-07
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 9/45 (20%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG 60
          K+FVG L   TT E+++  FE++G V  T CD        VKN+G
Sbjct: 1  KLFVGNLPDATTSEELRALFEKYGTV--TECDV-------VKNYG 36


>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in
          azoospermia-associated protein 1 (DAZAP1) and similar
          proteins.  This subfamily corresponds to the RRM2 of
          DAZAP1 or DAZ-associated protein 1, also termed
          proline-rich RNA binding protein (Prrp), a
          multi-functional ubiquitous RNA-binding protein
          expressed most abundantly in the testis and essential
          for normal cell growth, development, and
          spermatogenesis. DAZAP1 is a shuttling protein whose
          acetylated is predominantly nuclear and the
          nonacetylated form is in cytoplasm. DAZAP1 also
          functions as a translational regulator that activates
          translation in an mRNA-specific manner. DAZAP1 was
          initially identified as a binding partner of Deleted in
          Azoospermia (DAZ). It also interacts with numerous
          hnRNPs, including hnRNP U, hnRNP U like-1, hnRNPA1,
          hnRNPA/B, and hnRNP D, suggesting DAZAP1 might
          associate and cooperate with hnRNP particles to
          regulate adenylate-uridylate-rich elements (AU-rich
          element or ARE)-containing mRNAs. DAZAP1 contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal proline-rich domain. .
          Length = 80

 Score = 40.4 bits (95), Expect = 2e-06
 Identities = 18/29 (62%), Positives = 20/29 (68%)

Query: 13 RTKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          RTKKIFVGGL    T  D++ YF QFG V
Sbjct: 1  RTKKIFVGGLPPNVTETDLRKYFSQFGTV 29


>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein A subfamily.
          This subfamily corresponds to the RRM1 in hnRNP A0,
          hnRNP A1, hnRNP A2/B1, hnRNP A3 and similar proteins.
          hnRNP A0 is a low abundance hnRNP protein that has been
          implicated in mRNA stability in mammalian cells. It has
          been identified as the substrate for MAPKAP-K2 and may
          be involved in the lipopolysaccharide (LPS)-induced
          post-transcriptional regulation of tumor necrosis
          factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
          macrophage inflammatory protein 2 (MIP-2). hnRNP A1 is
          an abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A3 is also a RNA trafficking response
          element-binding protein that participates in the
          trafficking of A2RE-containing RNA. The hnRNP A
          subfamily is characterized by two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 78

 Score = 39.7 bits (93), Expect = 3e-06
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+F+GGLS  TT + +KNYF Q+G +
Sbjct: 1  KLFIGGLSYETTDDSLKNYFSQWGEI 26


>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in
          eukaryotic RNA-binding protein RBM24, RBM38 and similar
          proteins.  This subfamily corresponds to the RRM of
          RBM24 and RBM38 from vertebrate, SUPpressor family
          member SUP-12 from Caenorhabditis elegans and similar
          proteins. Both, RBM24 and RBM38, are preferentially
          expressed in cardiac and skeletal muscle tissues. They
          regulate myogenic differentiation by controlling the
          cell cycle in a p21-dependent or -independent manner.
          RBM24, also termed RNA-binding region-containing
          protein 6, interacts with the 3'-untranslated region
          (UTR) of myogenin mRNA and regulates its stability in
          C2C12 cells. RBM38, also termed CLL-associated antigen
          KW-5, or HSRNASEB, or RNA-binding region-containing
          protein 1(RNPC1), or ssDNA-binding protein SEB4, is a
          direct target of the p53 family. It is required for
          maintaining the stability of the basal and
          stress-induced p21 mRNA by binding to their 3'-UTRs. It
          also binds the AU-/U-rich elements in p63 3'-UTR and
          regulates p63 mRNA stability and activity. SUP-12 is a
          novel tissue-specific splicing factor that controls
          muscle-specific splicing of the ADF/cofilin pre-mRNA in
          C. elegans. All family members contain a conserved RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). .
          Length = 76

 Score = 39.5 bits (93), Expect = 3e-06
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
           KIFVGGL   TT + ++ YF QFG +
Sbjct: 1  TKIFVGGLPYHTTDDSLRKYFSQFGEI 27


>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP
          A/B, hnRNP DL and similar proteins.  This subfamily
          corresponds to the RRM2 of hnRNP D0, hnRNP A/B, hnRNP
          DL and similar proteins. hnRNP D0, a UUAG-specific
          nuclear RNA binding protein that may be involved in
          pre-mRNA splicing and telomere elongation. hnRNP A/B is
          an RNA unwinding protein with a high affinity for G-
          followed by U-rich regions. It has also been identified
          as an APOBEC1-binding protein that interacts with
          apolipoprotein B (apoB) mRNA transcripts around the
          editing site and thus plays an important role in apoB
          mRNA editing. hnRNP DL (or hnRNP D-like) is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          All memembers in this family contain two putative RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 75

 Score = 39.7 bits (93), Expect = 3e-06
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KIFVGGLS  TT E ++ YF +FG +
Sbjct: 1  KIFVGGLSPETTEEKIREYFGKFGNI 26


>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in
          heterogeneous nuclear ribonucleoprotein A subfamily.
          This subfamily corresponds to the RRM2 of hnRNP A0,
          hnRNP A1, hnRNP A2/B1, hnRNP A3 and similar proteins.
          hnRNP A0 is a low abundance hnRNP protein that has been
          implicated in mRNA stability in mammalian cells. It has
          been identified as the substrate for MAPKAP-K2 and may
          be involved in the lipopolysaccharide (LPS)-induced
          post-transcriptional regulation of tumor necrosis
          factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
          macrophage inflammatory protein 2 (MIP-2). hnRNP A1 is
          an abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A3 is also a RNA trafficking response
          element-binding protein that participates in the
          trafficking of A2RE-containing RNA. The hnRNP A
          subfamily is characterized by two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 73

 Score = 38.8 bits (91), Expect = 5e-06
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+FVGGL    T ED++ YF Q+G V
Sbjct: 1  KLFVGGLKEDVTEEDLREYFSQYGNV 26


>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate
          RNA-binding protein 4 (RBM4).  This subgroup
          corresponds to the RRM1 of RBM4, a ubiquitously
          expressed splicing factor that has two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may function as a translational
          regulator of stress-associated mRNAs and also plays a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. The C-terminal region may be crucial for
          nuclear localization and protein-protein interaction.
          The RRMs, in combination with the C-terminal region,
          are responsible for the splicing function of RBM4. .
          Length = 67

 Score = 38.3 bits (89), Expect = 8e-06
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 9/45 (20%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNFG 60
          K+FVG L    T +++++ FEQ+G V    CD        +KN+G
Sbjct: 2  KLFVGNLPPEATEQEIRSLFEQYGKV--LECD-------IIKNYG 37


>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein hnRNP A and
          hnRNP D subfamilies and similar proteins.  This
          subfamily corresponds to the RRM1 in the hnRNP A
          subfamily which includes hnRNP A0, hnRNP A1, hnRNP
          A2/B1, hnRNP A3 and similar proteins. hnRNP A0 is a low
          abundance hnRNP protein that has been implicated in
          mRNA stability in mammalian cells. hnRNP A1 is an
          abundant eukaryotic nuclear RNA-binding protein that
          may modulate splice site selection in pre-mRNA
          splicing. hnRNP A2/B1 is an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). hnRNP A3 is also a RNA
          trafficking response element-binding protein that
          participates in the trafficking of A2RE-containing RNA.
          The hnRNP A subfamily is characterized by two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. The hnRNP D subfamily includes hnRNP D0,
          hnRNP A/B, hnRNP DL and similar proteins. hnRNP D0 is a
          UUAG-specific nuclear RNA binding protein that may be
          involved in pre-mRNA splicing and telomere elongation.
          hnRNP A/B is an RNA unwinding protein with a high
          affinity for G- followed by U-rich regions. hnRNP A/B
          has also been identified as an APOBEC1-binding protein
          that interacts with apolipoprotein B (apoB) mRNA
          transcripts around the editing site and thus, plays an
          important role in apoB mRNA editing. hnRNP DL (or hnRNP
          D-like) is a dual functional protein that possesses
          DNA- and RNA-binding properties. It has been implicated
          in mRNA biogenesis at the transcriptional and
          post-transcriptional levels. All members in this
          subfamily contain two putative RRMs and a glycine- and
          tyrosine-rich C-terminus. The family also contains
          DAZAP1 (Deleted in azoospermia-associated protein 1),
          RNA-binding protein Musashi homolog Musashi-1,
          Musashi-2 and similar proteins. They all harbor two
          RRMs. .
          Length = 72

 Score = 38.3 bits (90), Expect = 8e-06
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +F+GGLS  TT E ++ YF ++G V
Sbjct: 1  LFIGGLSWDTTEESLREYFSKYGEV 25


>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in
          azoospermia-associated protein 1 (DAZAP1) and similar
          proteins.  This subfamily corresponds to the RRM1 of
          DAZAP1 or DAZ-associated protein 1, also termed
          proline-rich RNA binding protein (Prrp), a
          multi-functional ubiquitous RNA-binding protein
          expressed most abundantly in the testis and essential
          for normal cell growth, development, and
          spermatogenesis. DAZAP1 is a shuttling protein whose
          acetylated form is predominantly nuclear and the
          nonacetylated form is in cytoplasm. It also functions
          as a translational regulator that activates translation
          in an mRNA-specific manner. DAZAP1 was initially
          identified as a binding partner of Deleted in
          Azoospermia (DAZ). It also interacts with numerous
          hnRNPs, including hnRNP U, hnRNP U like-1, hnRNPA1,
          hnRNPA/B, and hnRNP D, suggesting DAZAP1 might
          associate and cooperate with hnRNP particles to
          regulate adenylate-uridylate-rich elements (AU-rich
          element or ARE)-containing mRNAs. DAZAP1 contains two
          N-terminal RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a C-terminal proline-rich domain. .
          Length = 82

 Score = 37.9 bits (88), Expect = 2e-05
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+FVGGLS  TT E ++ YF Q+G V
Sbjct: 1  KLFVGGLSWETTQETLRRYFSQYGEV 26


>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear
          polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of Hrp1p and similar proteins. Hrp1p or Nab4p,
          also termed cleavage factor IB (CFIB), is a
          sequence-specific trans-acting factor that is essential
          for mRNA 3'-end formation in yeast Saccharomyces
          cerevisiae. It can be UV cross-linked to RNA and
          specifically recognizes the (UA)6 RNA element required
          for both, the cleavage and poly(A) addition steps.
          Moreover, Hrp1p can shuttle between the nucleus and the
          cytoplasm, and play an additional role in the export of
          mRNAs to the cytoplasm. Hrp1p also interacts with
          Rna15p and Rna14p, two components of CF1A. In addition,
          Hrp1p functions as a factor directly involved in
          modulating the activity of the nonsense-mediated mRNA
          decay (NMD) pathway; it binds specifically to a
          downstream sequence element (DSE)-containing RNA and
          interacts with Upf1p, a component of the surveillance
          complex, further triggering the NMD pathway. Hrp1p
          contains two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an
          arginine-glycine-rich region harboring repeats of the
          sequence RGGF/Y. .
          Length = 75

 Score = 37.3 bits (87), Expect = 2e-05
 Identities = 16/26 (61%), Positives = 17/26 (65%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KIFVGGL    T E+ K YF QFG V
Sbjct: 1  KIFVGGLPPDVTEEEFKEYFSQFGKV 26


>gnl|CDD|214636 smart00360, RRM, RNA recognition motif. 
          Length = 73

 Score = 37.2 bits (87), Expect = 2e-05
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
           +FVG L   TT E+++  F +FG V
Sbjct: 1  TLFVGNLPPDTTEEELRELFSKFGKV 26


>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast
          negative growth regulatory protein NGR1 (RBP1), yeast
          protein NAM8 and similar proteins.  This subfamily
          corresponds to the RRM3 of NGR1 and NAM8. NGR1, also
          termed RNA-binding protein RBP1, is a putative
          glucose-repressible protein that binds both RNA and
          single-stranded DNA (ssDNA) in yeast. It may function
          in regulating cell growth in early log phase, possibly
          through its participation in RNA metabolism. NGR1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a glutamine-rich stretch that may
          be involved in transcriptional activity. In addition,
          NGR1 has an asparagine-rich region near the carboxyl
          terminus which also harbors a methionine-rich region.
          The family also includes protein NAM8, which is a
          putative RNA-binding protein that acts as a suppressor
          of mitochondrial splicing deficiencies when
          overexpressed in yeast. It may be a non-essential
          component of the mitochondrial splicing machinery. Like
          NGR1, NAM8 contains two RRMs. .
          Length = 72

 Score = 36.5 bits (85), Expect = 4e-05
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYYT 44
          +FVGGL    T +++++ F  FG + Y 
Sbjct: 4  VFVGGLDPAVTEDELRSLFGPFGEIVYV 31


>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily.  RRM,
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), is a highly abundant domain
          in eukaryotes found in proteins involved in
          post-transcriptional gene expression processes
          including mRNA and rRNA processing, RNA export, and RNA
          stability. This domain is 90 amino acids in length and
          consists of a four-stranded beta-sheet packed against
          two alpha-helices. RRM usually interacts with ssRNA,
          but is also known to interact with ssDNA as well as
          proteins. RRM binds a variable number of nucleotides,
          ranging from two to eight. The active site includes
          three aromatic side-chains located within the conserved
          RNP1 and RNP2 motifs of the domain. The RRM domain is
          found in a variety heterogeneous nuclear
          ribonucleoproteins (hnRNPs), proteins implicated in
          regulation of alternative splicing, and protein
          components of small nuclear ribonucleoproteins
          (snRNPs).
          Length = 72

 Score = 36.5 bits (85), Expect = 5e-05
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVG L   TT ED++  F +FG +
Sbjct: 1  LFVGNLPPDTTEEDLRELFSKFGEI 25


>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in
          heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP
          A/B, hnRNP DL and similar proteins.  This subfamily
          corresponds to the RRM1 in hnRNP D0, hnRNP A/B, hnRNP
          DL and similar proteins. hnRNP D0 is a UUAG-specific
          nuclear RNA binding protein that may be involved in
          pre-mRNA splicing and telomere elongation. hnRNP A/B is
          an RNA unwinding protein with a high affinity for G-
          followed by U-rich regions. hnRNP A/B has also been
          identified as an APOBEC1-binding protein that interacts
          with apolipoprotein B (apoB) mRNA transcripts around
          the editing site and thus plays an important role in
          apoB mRNA editing. hnRNP DL (or hnRNP D-like) is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          All members in this family contain two putative RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 74

 Score = 36.4 bits (84), Expect = 5e-05
 Identities = 15/25 (60%), Positives = 19/25 (76%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVGGLS  TT +D+K YF +FG V
Sbjct: 1  MFVGGLSWDTTKKDLKEYFSKFGEV 25


>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and
          similar proteins.  This subgroup corresponds to the
          RRM1 of hnRNP A2/B1 which is an RNA trafficking
          response element-binding protein that interacts with
          the hnRNP A2 response element (A2RE). Many mRNAs, such
          as myelin basic protein (MBP), myelin-associated
          oligodendrocytic basic protein (MOBP), carboxyanhydrase
          II (CAII), microtubule-associated protein tau, and
          amyloid precursor protein (APP) are trafficked by hnRNP
          A2/B1. hnRNP A2/B1 also functions as a splicing factor
          that regulates alternative splicing of the tumor
          suppressors, such as BIN1, WWOX, the antiapoptotic
          proteins c-FLIP and caspase-9B, the insulin receptor
          (IR), and the RON proto-oncogene among others.
          Moreover, the overexpression of hnRNP A2/B1 has been
          described in many cancers. It functions as a nuclear
          matrix protein involving in RNA synthesis and the
          regulation of cellular migration through alternatively
          splicing pre-mRNA. It may play a role in tumor cell
          differentiation. hnRNP A2/B1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 81

 Score = 36.2 bits (83), Expect = 8e-05
 Identities = 14/25 (56%), Positives = 21/25 (84%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFG 39
          +K+F+GGLS  TT E ++NY+EQ+G
Sbjct: 3  RKLFIGGLSFETTEESLRNYYEQWG 27


>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in
          heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of hnRNP A0 which is a low abundance hnRNP
          protein that has been implicated in mRNA stability in
          mammalian cells. It has been identified as the
          substrate for MAPKAP-K2 and may be involved in the
          lipopolysaccharide (LPS)-induced post-transcriptional
          regulation of tumor necrosis factor-alpha (TNF-alpha),
          cyclooxygenase 2 (COX-2) and macrophage inflammatory
          protein 2 (MIP-2). hnRNP A0 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 79

 Score = 35.5 bits (82), Expect = 1e-04
 Identities = 9/29 (31%), Positives = 19/29 (65%)

Query: 13 RTKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +  K+FVGGL+  T+   ++ +F ++G +
Sbjct: 1  QLCKLFVGGLNLKTSDSGLRRHFTRYGKL 29


>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A/B (hnRNP A/B) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A/B, also termed APOBEC1-binding protein 1
          (ABBP-1), which is an RNA unwinding protein with a high
          affinity for G- followed by U-rich regions. hnRNP A/B
          has also been identified as an APOBEC1-binding protein
          that interacts with apolipoprotein B (apoB) mRNA
          transcripts around the editing site and thus plays an
          important role in apoB mRNA editing. hnRNP A/B contains
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a long C-terminal glycine-rich
          domain that contains a potential ATP/GTP binding loop.
          .
          Length = 75

 Score = 35.7 bits (82), Expect = 1e-04
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+FVGGLS  T+ +D+K+YF +FG V
Sbjct: 1  KMFVGGLSWDTSKKDLKDYFTKFGEV 26


>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding
          protein 43 (TDP-43) and similar proteins.  This
          subfamily corresponds to the RRM2 of TDP-43 (also
          termed TARDBP), a ubiquitously expressed pathogenic
          protein whose normal function and abnormal aggregation
          are directly linked to the genetic disease cystic
          fibrosis, and two neurodegenerative disorders:
          frontotemporal lobar degeneration (FTLD) and
          amyotrophic lateral sclerosis (ALS). TDP-43 binds both
          DNA and RNA, and has been implicated in transcriptional
          repression, pre-mRNA splicing and translational
          regulation. TDP-43 is a dimeric protein with two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a C-terminal glycine-rich domain. The RRMs are
          responsible for DNA and RNA binding; they bind to TAR
          DNA and RNA sequences with UG-repeats. The glycine-rich
          domain can interact with the hnRNP family proteins to
          form the hnRNP-rich complex involved in splicing
          inhibition. It is also essential for the cystic
          fibrosis transmembrane conductance regulator (CFTR)
          exon 9-skipping activity. .
          Length = 71

 Score = 35.3 bits (82), Expect = 1e-04
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 4/36 (11%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFI 50
          +K+FVG L+   T ED++ YF QFG V     D +I
Sbjct: 1  RKVFVGRLTEDMTEEDLRQYFSQFGEV----TDVYI 32


>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A/B (hnRNP A/B) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A/B, also termed APOBEC1-binding protein 1
          (ABBP-1), an RNA unwinding protein with a high affinity
          for G- followed by U-rich regions. hnRNP A/B has also
          been identified as an APOBEC1-binding protein that
          interacts with apolipoprotein B (apoB) mRNA transcripts
          around the editing site and thus plays an important
          role in apoB mRNA editing. hnRNP A/B contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long C-terminal glycine-rich domain that
          contains a potential ATP/GTP binding loop. .
          Length = 80

 Score = 35.3 bits (81), Expect = 2e-04
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KKIFVGGL+   T E ++ YF +FG +
Sbjct: 5  KKIFVGGLNPEATEEKIREYFGEFGEI 31


>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia
          (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE.
          This subfamily corresponds to the RRM domain of two
          Deleted in AZoospermia (DAZ) autosomal homologs, DAZL
          (DAZ-like) and BOULE. BOULE is the founder member of
          the family and DAZL arose from BOULE in an ancestor of
          vertebrates. The DAZ gene subsequently originated from
          a duplication transposition of the DAZL gene.
          Invertebrates contain a single DAZ homolog, BOULE,
          while vertebrates, other than catarrhine primates,
          possess both BOULE and DAZL genes. The catarrhine
          primates possess BOULE, DAZL, and DAZ genes. The family
          members encode closely related RNA-binding proteins
          that are required for fertility in numerous organisms.
          These proteins contain an RNA recognition motif (RRM),
          also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a varying number of
          copies of a DAZ motif, believed to mediate
          protein-protein interactions. DAZL and BOULE contain a
          single copy of the DAZ motif, while DAZ proteins can
          contain 8-24 copies of this repeat. Although their
          specific biochemical functions remain to be
          investigated, DAZL proteins may interact with
          poly(A)-binding proteins (PABPs), and act as
          translational activators of specific mRNAs during
          gametogenesis.  .
          Length = 80

 Score = 35.3 bits (82), Expect = 2e-04
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +IFVGG+   TT E+++++F +FG V
Sbjct: 4  RIFVGGIPPDTTEEELRDFFSRFGSV 29


>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM2 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 68

 Score = 34.5 bits (79), Expect = 3e-04
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVYYTACD 47
          KIFVG +SA  T ++++  FE+FG V    CD
Sbjct: 2  KIFVGNVSATCTSDELRGLFEEFGRV--VECD 31


>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter
          pylori HP0827 protein and similar proteins.  This
          subfamily corresponds to the RRM of H. pylori HP0827, a
          putative ssDNA-binding protein 12rnp2 precursor,
          containing one RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). The ssDNA binding may be important in
          activation of HP0827. .
          Length = 78

 Score = 34.1 bits (79), Expect = 4e-04
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVY 42
           ++VG L    T ED+K+ F QFG V 
Sbjct: 1  NLYVGNLPYNVTEEDLKDLFGQFGEVT 27


>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein D0 (hnRNP D0) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP D0, also termed AU-rich element RNA-binding
          protein 1, which is a UUAG-specific nuclear RNA binding
          protein that may be involved in pre-mRNA splicing and
          telomere elongation. hnRNP D0 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          in the middle and an RGG box rich in glycine and
          arginine residues in the C-terminal part. Each of RRMs
          can bind solely to the UUAG sequence specifically. .
          Length = 74

 Score = 34.2 bits (78), Expect = 4e-04
 Identities = 14/25 (56%), Positives = 20/25 (80%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +F+GGLS  TT +D+K+YF +FG V
Sbjct: 1  MFIGGLSWDTTKKDLKDYFSKFGEV 25


>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif. (a.k.a. RRM, RBD, or RNP
          domain).  The RRM motif is probably diagnostic of an
          RNA binding protein. RRMs are found in a variety of RNA
          binding proteins, including various hnRNP proteins,
          proteins implicated in regulation of alternative
          splicing, and protein components of snRNPs. The motif
          also appears in a few single stranded DNA binding
          proteins. The RRM structure consists of four strands
          and two helices arranged in an alpha/beta sandwich,
          with a third helix present during RNA binding in some
          cases The C-terminal beta strand (4th strand) and final
          helix are hard to align and have been omitted in the
          SEED alignment The LA proteins have an N terminal rrm
          which is included in the seed. There is a second region
          towards the C terminus that has some features
          characteristic of a rrm but does not appear to have the
          important structural core of a rrm. The LA proteins are
          one of the main autoantigens in Systemic lupus
          erythematosus (SLE), an autoimmune disease.
          Length = 70

 Score = 33.7 bits (78), Expect = 6e-04
 Identities = 13/25 (52%), Positives = 18/25 (72%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVG L   TT ED+K+ F +FGP+
Sbjct: 1  LFVGNLPPDTTEEDLKDLFSKFGPI 25


>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM3 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 82

 Score = 33.7 bits (78), Expect = 6e-04
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPVYY 43
          + +F+  L    T E++K  F QFG V Y
Sbjct: 1  RTVFIRNLPFDATEEELKELFSQFGEVKY 29


>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A1 (hnRNP A1) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A1, also termed helix-destabilizing protein, or
          single-strand RNA-binding protein, or hnRNP core
          protein A1, and is an abundant eukaryotic nuclear
          RNA-binding protein that may modulate splice site
          selection in pre-mRNA splicing. hnRNP A1 has been
          characterized as a splicing silencer, often acting in
          opposition to an activating hnRNP H. It silences exons
          when bound to exonic elements in the alternatively
          spliced transcripts of c-src, HIV, GRIN1, and
          beta-tropomyosin. hnRNP A1 can shuttle between the
          nucleus and the cytoplasm. Thus, it may be involved in
          transport of cellular RNAs, including the packaging of
          pre-mRNA into hnRNP particles and transport of poly A+
          mRNA from the nucleus to the cytoplasm. The cytoplasmic
          hnRNP A1 has high affinity with AU-rich elements,
          whereas the nuclear hnRNP A1 has high affinity with a
          polypyrimidine stretch bordered by AG at the 3' ends of
          introns. hnRNP A1 is also involved in the replication
          of an RNA virus, such as mouse hepatitis virus (MHV),
          through an interaction with the
          transcription-regulatory region of viral RNA. hnRNP A1,
          together with the scaffold protein septin 6, serves as
          host protein to form a complex with NS5b and viral RNA,
          and further plays important roles in the replication of
          Hepatitis C virus (HCV). hnRNP A1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. The RRMs of hnRNP A1 play an important role
          in silencing the exon and the glycine-rich domain is
          responsible for protein-protein interactions. .
          Length = 81

 Score = 33.9 bits (77), Expect = 7e-04
 Identities = 13/25 (52%), Positives = 21/25 (84%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFG 39
          +K+F+GGLS  TT E ++++FEQ+G
Sbjct: 3  RKLFIGGLSFETTDESLRSHFEQWG 27


>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear
          polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of Hrp1p and similar proteins. Hrp1p or Nab4p,
          also termed cleavage factor IB (CFIB), is a
          sequence-specific trans-acting factor that is essential
          for mRNA 3'-end formation in yeast Saccharomyces
          cerevisiae. It can be UV cross-linked to RNA and
          specifically recognizes the (UA)6 RNA element required
          for both, the cleavage and poly(A) addition, steps.
          Moreover, Hrp1p can shuttle between the nucleus and the
          cytoplasm, and play an additional role in the export of
          mRNAs to the cytoplasm. Hrp1p also interacts with
          Rna15p and Rna14p, two components of CF1A. In addition,
          Hrp1p functions as a factor directly involved in
          modulating the activity of the nonsense-mediated mRNA
          decay (NMD) pathway. It binds specifically to a
          downstream sequence element (DSE)-containing RNA and
          interacts with Upf1p, a component of the surveillance
          complex, further triggering the NMD pathway. Hrp1p
          contains two central RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an
          arginine-glycine-rich region harboring repeats of the
          sequence RGGF/Y. .
          Length = 76

 Score = 33.3 bits (76), Expect = 8e-04
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +F+GGL+  TT + ++ YF QFG V
Sbjct: 1  MFIGGLNWETTDDSLREYFGQFGEV 25


>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding
          protein Musashi homolog 1 (Musashi-1) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          Musashi-1. The mammalian MSI1 gene encoding Musashi-1
          (also termed Msi1) is a neural RNA-binding protein
          putatively expressed in central nervous system (CNS)
          stem cells and neural progenitor cells and associated
          with asymmetric divisions in neural progenitor cells.
          Musashi-1 is evolutionarily conserved from
          invertebrates to vertebrates. It is a homolog of
          Drosophila Musashi and Xenopus laevis nervous
          system-specific RNP protein-1 (Nrp-1). Musashi-1 has
          been implicated in the maintenance of the stem-cell
          state, differentiation, and tumorigenesis. It
          translationally regulates the expression of a mammalian
          numb gene by binding to the 3'-untranslated region of
          mRNA of Numb, encoding a membrane-associated inhibitor
          of Notch signaling, and further influences neural
          development. Moreover, it represses translation by
          interacting with the poly(A)-binding protein and
          competes for binding of the eukaryotic initiation
          factor-4G (eIF-4G). Musashi-1 contains two conserved
          N-terminal tandem RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 77

 Score = 33.4 bits (76), Expect = 0.001
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+F+GGLS  TT E ++ YF QFG V
Sbjct: 2  KMFIGGLSWQTTQEGLREYFGQFGEV 27


>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A1 (hnRNP A1) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A1, also termed helix-destabilizing protein, or
          single-strand RNA-binding protein, or hnRNP core
          protein A1, an abundant eukaryotic nuclear RNA-binding
          protein that may modulate splice site selection in
          pre-mRNA splicing. hnRNP A1 has been characterized as a
          splicing silencer, often acting in opposition to an
          activating hnRNP H. It silences exons when bound to
          exonic elements in the alternatively spliced
          transcripts of c-src, HIV, GRIN1, and beta-tropomyosin.
          hnRNP A1 can shuttle between the nucleus and the
          cytoplasm. Thus, it may be involved in transport of
          cellular RNAs, including the packaging of pre-mRNA into
          hnRNP particles and transport of poly A+ mRNA from the
          nucleus to the cytoplasm. The cytoplasmic hnRNP A1 has
          high affinity with AU-rich elements, whereas the
          nuclear hnRNP A1 has high affinity with a
          polypyrimidine stretch bordered by AG at the 3' ends of
          introns. hnRNP A1 is also involved in the replication
          of an RNA virus, such as mouse hepatitis virus (MHV),
          through an interaction with the
          transcription-regulatory region of viral RNA. Moreover,
          hnRNP A1, together with the scaffold protein septin 6,
          serves as host proteins to form a complex with NS5b and
          viral RNA, and further play important roles in the
          replication of Hepatitis C virus (HCV). hnRNP A1
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a long glycine-rich region at the
          C-terminus. The RRMs of hnRNP A1 play an important role
          in silencing the exon and the glycine-rich domain is
          responsible for protein-protein interactions. .
          Length = 77

 Score = 33.4 bits (76), Expect = 0.001
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KKIFVGG+   T    +++YFEQ+G +
Sbjct: 1  KKIFVGGIKEDTEEHHLRDYFEQYGKI 27


>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein D-like (hnRNP DL) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP DL (or hnRNP D-like), also termed AU-rich element
          RNA-binding factor, or JKT41-binding protein (protein
          laAUF1 or JKTBP), is a dual functional protein that
          possesses DNA- and RNA-binding properties. It has been
          implicated in mRNA biogenesis at the transcriptional
          and post-transcriptional levels. hnRNP DL binds
          single-stranded DNA (ssDNA) or double-stranded DNA
          (dsDNA) in a non-sequencespecific manner, and interacts
          with poly(G) and poly(A) tenaciously. It contains two
          putative two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a glycine- and tyrosine-rich C-terminus.
          .
          Length = 75

 Score = 33.1 bits (75), Expect = 0.001
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+FVGGLS  TT E +K YF  FG +
Sbjct: 1  KVFVGGLSPDTTEEQIKEYFGAFGEI 26


>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in
          CELF/Bruno-like family of RNA binding proteins and
          plant flowering time control protein FCA.  This
          subfamily corresponds to the RRM1 and RRM2 domains of
          the CUGBP1 and ETR-3-like factors (CELF) as well as
          plant flowering time control protein FCA. CELF, also
          termed BRUNOL (Bruno-like) proteins, is a family of
          structurally related RNA-binding proteins involved in
          regulation of pre-mRNA splicing in the nucleus, and
          control of mRNA translation and deadenylation in the
          cytoplasm. The family contains six members: CELF-1
          (also known as BRUNOL-2, CUG-BP1, NAPOR, EDEN-BP),
          CELF-2 (also known as BRUNOL-3, ETR-3, CUG-BP2,
          NAPOR-2), CELF-3 (also known as BRUNOL-1, TNRC4, ETR-1,
          CAGH4, ER DA4), CELF-4 (BRUNOL-4), CELF-5 (BRUNOL-5)
          and CELF-6 (BRUNOL-6). They all contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The low sequence conservation of the linker
          region is highly suggestive of a large variety in the
          co-factors that associate with the various CELF family
          members. Based on both, sequence similarity and
          function, the CELF family can be divided into two
          subfamilies, the first containing CELFs 1 and 2, and
          the second containing CELFs 3, 4, 5, and 6. The
          different CELF proteins may act through different sites
          on at least some substrates. Furthermore, CELF proteins
          may interact with each other in varying combinations to
          influence alternative splicing in different contexts.
          This subfamily also includes plant flowering time
          control protein FCA that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RRMs, and a
          WW protein interaction domain.  .
          Length = 77

 Score = 32.9 bits (76), Expect = 0.001
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVY 42
          K+FVG L    T EDV+  FE++G + 
Sbjct: 1  KLFVGQLPKTATEEDVRALFEEYGNIE 27


>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein
          Musashi homolog Musashi-1, Musashi-2 and similar
          proteins.  This subfamily corresponds to the RRM1 in
          Musashi-1 and Musashi-2. Musashi-1 (also termed Msi1)
          is a neural RNA-binding protein putatively expressed in
          central nervous system (CNS) stem cells and neural
          progenitor cells, and associated with asymmetric
          divisions in neural progenitor cells. It is
          evolutionarily conserved from invertebrates to
          vertebrates. Musashi-1 is a homolog of Drosophila
          Musashi and Xenopus laevis nervous system-specific RNP
          protein-1 (Nrp-1). It has been implicated in the
          maintenance of the stem-cell state, differentiation,
          and tumorigenesis. It translationally regulates the
          expression of a mammalian numb gene by binding to the
          3'-untranslated region of mRNA of Numb, encoding a
          membrane-associated inhibitor of Notch signaling, and
          further influences neural development. Moreover,
          Musashi-1 represses translation by interacting with the
          poly(A)-binding protein and competes for binding of the
          eukaryotic initiation factor-4G (eIF-4G). Musashi-2
          (also termed Msi2) has been identified as a regulator
          of the hematopoietic stem cell (HSC) compartment and of
          leukemic stem cells after transplantation of cells with
          loss and gain of function of the gene. It influences
          proliferation and differentiation of HSCs and myeloid
          progenitors, and further modulates normal hematopoiesis
          and promotes aggressive myeloid leukemia. Both,
          Musashi-1 and Musashi-2, contain two conserved
          N-terminal tandem RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 75

 Score = 32.8 bits (75), Expect = 0.002
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +F+GGLS  TT E ++ YF +FG +
Sbjct: 1  MFIGGLSWQTTAEGLREYFSKFGEI 25


>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein D0 (hnRNP D0) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP D0, also termed AU-rich element RNA-binding
          protein 1, a UUAG-specific nuclear RNA binding protein
          that may be involved in pre-mRNA splicing and telomere
          elongation. hnRNP D0 contains two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), in the middle and
          an RGG box rich in glycine and arginine residues in the
          C-terminal part. Each of RRMs can bind solely to the
          UUAG sequence specifically. .
          Length = 75

 Score = 31.9 bits (72), Expect = 0.003
 Identities = 15/26 (57%), Positives = 17/26 (65%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KIFVGGLS  T  E ++ YF  FG V
Sbjct: 1  KIFVGGLSPDTPEEKIREYFGAFGEV 26


>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subfamily corresponds to
          the RRM1 of CELF-3, CELF-4, CELF-5, CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein.The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          highly expressed throughout the brain and in glandular
          tissues, moderately expressed in heart, skeletal
          muscle, and liver, is also known as bruno-like protein
          4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor 4. Like
          CELF-3, CELF-4 also contain three highly conserved
          RRMs. The splicing activation or repression activity of
          CELF-4 on some specific substrates is mediated by its
          RRM1/RRM2. On the other hand, both RRM1 and RRM2 of
          CELF-4 can activate cardiac troponin T (cTNT) exon 5
          inclusion. CELF-5, expressed in brain, is also known as
          bruno-like protein 5 (BRUNOL-5), or CUG-BP- and
          ETR-3-like factor 5. Although its biological role
          remains unclear, CELF-5 shares same domain architecture
          with CELF-3. CELF-6, strongly expressed in kidney,
          brain, and testis, is also known as bruno-like protein
          6 (BRUNOL-6), or CUG-BP- and ETR-3-like factor 6. It
          activates exon inclusion of a cardiac troponin T
          minigene in transient transfection assays in an
          muscle-specific splicing enhancer (MSE)-dependent
          manner and can activate inclusion via multiple copies
          of a single element, MSE2. CELF-6 also promotes
          skipping of exon 11 of insulin receptor, a known target
          of CELF activity that is expressed in kidney. In
          additiona to three highly conserved RRMs, CELF-6 also
          possesses numerous potential phosphorylation sites, a
          potential nuclear localization signal (NLS) at the C
          terminus, and an alanine-rich region within the
          divergent linker region. .
          Length = 87

 Score = 32.0 bits (73), Expect = 0.003
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVY 42
          K+FVG +      +D++  FEQFG +Y
Sbjct: 7  KLFVGQIPRNLEEKDLRPLFEQFGKIY 33


>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous
          nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA
          recognition motif 1 (hRBMY), testis-specific
          heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T)
          and similar proteins.  This subfamily corresponds to
          the RRM domain of hnRNP G, also termed glycoprotein p43
          or RBMX, an RNA-binding motif protein located on the X
          chromosome. It is expressed ubiquitously and has been
          implicated in the splicing control of several
          pre-mRNAs. Moreover, hnRNP G may function as a
          regulator of transcription for SREBP-1c and GnRH1.
          Research has shown that hnRNP G may also act as a
          tumor-suppressor since it upregulates the Txnip gene
          and promotes the fidelity of DNA end-joining activity.
          In addition, hnRNP G appears to play a critical role in
          proper neural development of zebrafish and frog
          embryos. The family also includes several paralogs of
          hnRNP G, such as hRBMY and hnRNP G-T (also termed
          RNA-binding motif protein, X-linked-like-2). Both,
          hRBMY and hnRNP G-T, are exclusively expressed in
          testis and critical for male fertility. Like hnRNP G,
          hRBMY and hnRNP G-T interact with factors implicated in
          the regulation of pre-mRNA splicing, such as
          hTra2-beta1 and T-STAR. Although members in this family
          share a high conserved N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), they appear to recognize
          different RNA targets. For instance, hRBMY interacts
          specifically with a stem-loop structure in which the
          loop is formed by the sequence CA/UCAA. In contrast,
          hnRNP G associates with single stranded RNA sequences
          containing a CCA/C motif. In addition to the RRM, hnRNP
          G contains a nascent transcripts targeting domain (NTD)
          in the middle region and a novel auxiliary RNA-binding
          domain (RBD) in its C-terminal region. The C-terminal
          RBD exhibits distinct RNA binding specificity, and
          would play a critical role in the regulation of
          alternative splicing by hnRNP G. .
          Length = 80

 Score = 31.8 bits (73), Expect = 0.003
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+FV GLS  TT ++++  F +FG V
Sbjct: 3  KLFVSGLSTRTTEKELEALFSKFGRV 28


>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear
          ribonucleoprotein 70 kDa (U1-70K) and similar proteins.
           This subfamily corresponds to the RRM of U1-70K, also
          termed snRNP70, a key component of the U1 snRNP
          complex, which is one of the key factors facilitating
          the splicing of pre-mRNA via interaction at the 5'
          splice site, and is involved in regulation of
          polyadenylation of some viral and cellular genes,
          enhancing or inhibiting efficient poly(A) site usage.
          U1-70K plays an essential role in targeting the U1
          snRNP to the 5' splice site through protein-protein
          interactions with regulatory RNA-binding splicing
          factors, such as the RS protein ASF/SF2. Moreover,
          U1-70K protein can specifically bind to stem-loop I of
          the U1 small nuclear RNA (U1 snRNA) contained in the U1
          snRNP complex. It also mediates the binding of U1C,
          another U1-specific protein, to the U1 snRNP complex.
          U1-70K contains a conserved RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by an adjacent
          glycine-rich region at the N-terminal half, and two
          serine/arginine-rich (SR) domains at the C-terminal
          half. The RRM is responsible for the binding of
          stem-loop I of U1 snRNA molecule. Additionally, the
          most prominent immunodominant region that can be
          recognized by auto-antibodies from autoimmune patients
          may be located within the RRM. The SR domains are
          involved in protein-protein interaction with SR
          proteins that mediate 5' splice site recognition. For
          instance, the first SR domain is necessary and
          sufficient for ASF/SF2 Binding. The family also
          includes Drosophila U1-70K that is an essential
          splicing factor required for viability in flies, but
          its SR domain is dispensable. The yeast U1-70k doesn't
          contain easily recognizable SR domains and shows low
          sequence similarity in the RRM region with other U1-70k
          proteins and therefore not included in this family. The
          RRM domain is dispensable for yeast U1-70K function.
          Length = 91

 Score = 32.2 bits (74), Expect = 0.003
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K +FV  L+  TT   ++  FE++GP+
Sbjct: 2  KTLFVARLNYDTTESKLRREFEEYGPI 28


>gnl|CDD|240890 cd12444, RRM1_CPEBs, RNA recognition motif 1 in cytoplasmic
          polyadenylation element-binding protein CPEB-1, CPEB-2,
          CPEB-3, CPEB-4 and similar protiens.  This subfamily
          corresponds to the RRM1 of the CPEB family of proteins
          that bind to defined groups of mRNAs and act as either
          translational repressors or activators to regulate
          their translation. CPEB proteins are well conserved in
          both, vertebrates and invertebrates. Based on sequence
          similarity, RNA-binding specificity, and functional
          regulation of translation, the CPEB proteins have been
          classified into two subfamilies. The first subfamily
          includes CPEB-1 and related proteins. CPEB-1 is an
          RNA-binding protein that interacts with the cytoplasmic
          polyadenylation element (CPE), a short U-rich motif in
          the 3' untranslated regions (UTRs) of certain mRNAs. It
          functions as a translational regulator that plays a
          major role in the control of maternal CPE-containing
          mRNA in oocytes, as well as of subsynaptic
          CPE-containing mRNA in neurons. Once phosphorylated and
          recruiting the polyadenylation complex, CPEB-1 may
          function as a translational activator stimulating
          polyadenylation and translation. Otherwise, it may
          function as a translational inhibitor when
          dephosphorylated and bind to a protein such as maskin
          or neuroguidin, which blocks translation initiation
          through interfering with the assembly of eIF-4E and
          eIF-4G. Although CPEB-1 is mainly located in cytoplasm,
          it can shuttle between nucleus and cytoplasm. The
          second subfamily includes CPEB-2, CPEB-3, CPEB-4, and
          related protiens. Due to high sequence similarity,
          members in this subfamily may share similar expression
          patterns and functions. CPEB-2 is an RNA-binding
          protein that is abundantly expressed in testis and
          localized in cytoplasm in transfected HeLa cells. It
          preferentially binds to poly(U) RNA oligomers and may
          regulate the translation of stored mRNAs during
          spermiogenesis. CPEB-2 impedes target RNA translation
          at elongation; it directly interacts with the
          elongation factor, eEF2, to reduce
          eEF2/ribosome-activated GTP hydrolysis in vitro and
          inhibit peptide elongation of CPEB2-bound RNA in vivo.
          CPEB-3 is a sequence-specific translational regulatory
          protein that regulates translation in a
          polyadenylation-independent manner. It functions as a
          translational repressor that governs the synthesis of
          the AMPA receptor GluR2 through binding GluR2 mRNA. It
          also represses translation of a reporter RNA in
          transfected neurons and stimulates translation in
          response to NMDA. CPEB-4 is an RNA-binding protein that
          mediates meiotic mRNA cytoplasmic polyadenylation and
          translation. It is essential for neuron survival and
          present on the endoplasmic reticulum (ER). It is
          accumulated in the nucleus upon ischemia or the
          depletion of ER calcium. CPEB-4 is overexpressed in a
          large variety of tumors and is associated with many
          mRNAs in cancer cells. All CPEB proteins are
          nucleus-cytoplasm shuttling proteins. They contain an
          N-terminal unstructured region, followed by two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a Zn-finger motif. CPEB-2, -3, and -4 have
          conserved nuclear export signals that are not present
          in CPEB-1. .
          Length = 112

 Score = 31.5 bits (71), Expect = 0.008
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGP 40
          +K+FVGGL    T  D+ N F +FG 
Sbjct: 1  RKVFVGGLPWDITEADILNSFRRFGS 26


>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in
          nucleolin-like proteins mainly from plants.  This
          subfamily corresponds to the RRM1 of a group of plant
          nucleolin-like proteins, including nucleolin 1 (also
          termed protein nucleolin like 1) and nucleolin 2 (also
          termed protein nucleolin like 2, or protein parallel
          like 1). They play roles in the regulation of ribosome
          synthesis and in the growth and development of plants.
          Like yeast nucleolin, nucleolin-like proteins possess
          two RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains).  .
          Length = 77

 Score = 30.7 bits (70), Expect = 0.009
 Identities = 9/25 (36%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVG LS     +D++ +F++ G V
Sbjct: 2  LFVGNLSWSAEQDDLEEFFKECGEV 26


>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated
          protein SR140 and similar proteins.  This subgroup
          corresponds to the RRM of SR140 (also termed U2
          snRNP-associated SURP motif-containing protein
          orU2SURP, or 140 kDa Ser/Arg-rich domain protein) which
          is a putative splicing factor mainly found in higher
          eukaryotes. Although it is initially identified as one
          of the 17S U2 snRNP-associated proteins, the molecular
          and physiological function of SR140 remains unclear.
          SR140 contains an N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), a SWAP/SURP domain that is
          found in a number of pre-mRNA splicing factors in the
          middle region, and a C-terminal arginine/serine-rich
          domain (RS domain).
          Length = 84

 Score = 30.7 bits (70), Expect = 0.009
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPVY 42
          T  ++VG L+   T E +   F +FGP+ 
Sbjct: 1  TTNLYVGNLNPKVTEEVLCQEFGRFGPLA 29


>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in
          SMART/HDAC1-associated repressor protein (SHARP) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of SHARP, also termed Msx2-interacting protein
          (MINT), or SPEN homolog, an estrogen-inducible
          transcriptional repressor that interacts directly with
          the nuclear receptor corepressor SMRT, histone
          deacetylases (HDACs) and components of the NuRD
          complex. SHARP recruits HDAC activity and binds to the
          steroid receptor RNA coactivator SRA through four
          conserved N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), further suppressing
          SRA-potentiated steroid receptor transcription
          activity. Thus, SHARP has the capacity to modulate both
          liganded and nonliganded nuclear receptors. SHARP also
          has been identified as a component of transcriptional
          repression complexes in Notch/RBP-Jkappa signaling
          pathways. In addition to the N-terminal RRMs, SHARP
          possesses a C-terminal SPOC domain (Spen paralog and
          ortholog C-terminal domain), which is highly conserved
          among Spen proteins.  .
          Length = 74

 Score = 30.8 bits (70), Expect = 0.009
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          T+ +F+G L   TT  D++  FE+FG +
Sbjct: 2  TRTLFIGNLEKTTTYSDLREAFERFGEI 29


>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and
          CTD-associated factor 4 (SCAF4), SR-related and
          CTD-associated factor 8 (SCAF8) and similar proteins.
          This subfamily corresponds to the RRM in a new class of
          SCAFs (SR-like CTD-associated factors), including
          SCAF4, SCAF8 and similar proteins. The biological role
          of SCAF4 remains unclear, but it shows high sequence
          similarity to SCAF8 (also termed CDC5L
          complex-associated protein 7, or RNA-binding motif
          protein 16, or CTD-binding SR-like protein RA8). SCAF8
          is a nuclear matrix protein that interacts specifically
          with a highly serine-phosphorylated form of the
          carboxy-terminal domain (CTD) of the largest subunit of
          RNA polymerase II (pol II). The pol II CTD plays a role
          in coupling transcription and pre-mRNA processing. In
          addition, SCAF8 co-localizes primarily with
          transcription sites that are enriched in nuclear matrix
          fraction, which is known to contain proteins involved
          in pre-mRNA processing. Thus, SCAF8 may play a direct
          role in coupling with both, transcription and pre-mRNA
          processing, processes. SCAF8 and SCAF4 both contain a
          conserved N-terminal CTD-interacting domain (CID), an
          atypical RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNPs (ribonucleoprotein
          domain), and serine/arginine-rich motifs.
          Length = 77

 Score = 30.8 bits (70), Expect = 0.009
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +  +++G LS   T ED+KN FE++G +
Sbjct: 2  STTLWIGHLSKKVTEEDLKNLFEEYGEI 29


>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A3 (hnRNP A3) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A3, a novel RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE) independently of hnRNP A2
          and participates in the trafficking of A2RE-containing
          RNA. hnRNP A3 can shuttle between the nucleus and the
          cytoplasm. It contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 80

 Score = 30.7 bits (69), Expect = 0.010
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KKIFVGG+   T    +++YFE++G +
Sbjct: 1  KKIFVGGIKEDTEEYHLRDYFEKYGKI 27


>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein A3 (hnRNP A3) and similar
          proteins.  This subgroup corresponds to the RRM1 of
          hnRNP A3 which is a novel RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE) independently of hnRNP A2
          and participates in the trafficking of A2RE-containing
          RNA. hnRNP A3 can shuttle between the nucleus and the
          cytoplasm. It contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), followed by a long
          glycine-rich region at the C-terminus. .
          Length = 81

 Score = 30.5 bits (68), Expect = 0.012
 Identities = 11/25 (44%), Positives = 20/25 (80%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFG 39
          +K+F+GGLS  TT + ++ +FE++G
Sbjct: 3  RKLFIGGLSFETTDDSLREHFEKWG 27


>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A0 (hnRNP A0) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          hnRNP A0, a low abundance hnRNP protein that has been
          implicated in mRNA stability in mammalian cells. It has
          been identified as the substrate for MAPKAP-K2 and may
          be involved in the lipopolysaccharide (LPS)-induced
          post-transcriptional regulation of tumor necrosis
          factor-alpha (TNF-alpha), cyclooxygenase 2 (COX-2) and
          macrophage inflammatory protein 2 (MIP-2). hnRNP A0
          contains two RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), followed by a long glycine-rich region at the
          C-terminus. .
          Length = 80

 Score = 30.6 bits (69), Expect = 0.012
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+FVGGL       D+  +F QFGPV
Sbjct: 1  KLFVGGLKGDVGEGDLTEHFSQFGPV 26


>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous
          nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP
          DL) and similar proteins.  This subgroup corresponds to
          the RRM1 of hnRNP DL (or hnRNP D-like), also termed
          AU-rich element RNA-binding factor, or JKT41-binding
          protein (protein laAUF1 or JKTBP), which is a dual
          functional protein that possesses DNA- and RNA-binding
          properties. It has been implicated in mRNA biogenesis
          at the transcriptional and post-transcriptional levels.
          hnRNP DL binds single-stranded DNA (ssDNA) or
          double-stranded DNA (dsDNA) in a non-sequencespecific
          manner, and interacts with poly(G) and poly(A)
          tenaciously. It contains two putative two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a glycine- and tyrosine-rich C-terminus. .
          Length = 76

 Score = 30.4 bits (68), Expect = 0.013
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+F+GGLS  T+ +D+  Y  +FG V
Sbjct: 1  KMFIGGLSWDTSKKDLTEYLSRFGEV 26


>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous
          nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of hnRNP A2/B1, an RNA trafficking response
          element-binding protein that interacts with the hnRNP
          A2 response element (A2RE). Many mRNAs, such as myelin
          basic protein (MBP), myelin-associated oligodendrocytic
          basic protein (MOBP), carboxyanhydrase II (CAII),
          microtubule-associated protein tau, and amyloid
          precursor protein (APP) are trafficked by hnRNP A2/B1.
          hnRNP A2/B1 also functions as a splicing factor that
          regulates alternative splicing of the tumor
          suppressors, such as BIN1, WWOX, the antiapoptotic
          proteins c-FLIP and caspase-9B, the insulin receptor
          (IR), and the RON proto-oncogene among others.
          Overexpression of hnRNP A2/B1 has been described in
          many cancers. It functions as a nuclear matrix protein
          involving in RNA synthesis and the regulation of
          cellular migration through alternatively splicing
          pre-mRNA. It may play a role in tumor cell
          differentiation. hnRNP A2/B1 contains two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          followed by a long glycine-rich region at the
          C-terminus. .
          Length = 80

 Score = 30.4 bits (68), Expect = 0.013
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KK+FVGG+   T    +++YFE++G +
Sbjct: 1  KKLFVGGIKEDTEEHHLRDYFEEYGKI 27


>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP
          Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6
          and similar proteins.  This subgroup corresponds to the
          RRM2 of CELF-3, CELF-4, CELF-5, and CELF-6, all of
          which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that display dual nuclear and cytoplasmic
          localizations and have been implicated in the
          regulation of pre-mRNA splicing and in the control of
          mRNA translation and deadenylation. CELF-3, expressed
          in brain and testis only, is also known as bruno-like
          protein 1 (BRUNOL-1), or CAG repeat protein 4, or
          CUG-BP- and ETR-3-like factor 3, or embryonic lethal
          abnormal vision (ELAV)-type RNA-binding protein 1
          (ETR-1), or expanded repeat domain protein CAG/CTG 4,
          or trinucleotide repeat-containing gene 4 protein
          (TNRC4). It plays an important role in the pathogenesis
          of tauopathies. CELF-3 contains three highly conserved
          RNA recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains):
          two consecutive RRMs (RRM1 and RRM2) situated in the
          N-terminal region followed by a linker region and the
          third RRM (RRM3) close to the C-terminus of the
          protein. The effect of CELF-3 on tau splicing is
          mediated mainly by the RNA-binding activity of RRM2.
          The divergent linker region might mediate the
          interaction of CELF-3 with other proteins regulating
          its activity or involved in target recognition. CELF-4,
          being highly expressed throughout the brain and in
          glandular tissues, moderately expressed in heart,
          skeletal muscle, and liver, is also known as bruno-like
          protein 4 (BRUNOL-4), or CUG-BP- and ETR-3-like factor
          4. Like CELF-3, CELF-4 also contain three highly
          conserved RRMs. The splicing activation or repression
          activity of CELF-4 on some specific substrates is
          mediated by its RRM1/RRM2. On the other hand, both RRM1
          and RRM2 of CELF-4 can activate cardiac troponin T
          (cTNT) exon 5 inclusion. CELF-5, expressed in brain, is
          also known as bruno-like protein 5 (BRUNOL-5), or
          CUG-BP- and ETR-3-like factor 5. Although its
          biological role remains unclear, CELF-5 shares same
          domain architecture with CELF-3. CELF-6, being strongly
          expressed in kidney, brain, and testis, is also known
          as bruno-like protein 6 (BRUNOL-6), or CUG-BP- and
          ETR-3-like factor 6. It activates exon inclusion of a
          cardiac troponin T minigene in transient transfection
          assays in a muscle-specific splicing enhancer
          (MSE)-dependent manner and can activate inclusion via
          multiple copies of a single element, MSE2. CELF-6 also
          promotes skipping of exon 11 of insulin receptor, a
          known target of CELF activity that is expressed in
          kidney. In addition to three highly conserved RRMs,
          CELF-6 also possesses numerous potential
          phosphorylation sites, a potential nuclear localization
          signal (NLS) at the C terminus, and an alanine-rich
          region within the divergent linker region. .
          Length = 81

 Score = 30.1 bits (68), Expect = 0.015
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFG 39
          +K+FVG LS   T +DV+  FE FG
Sbjct: 2  RKLFVGMLSKQQTEDDVRRLFEPFG 26


>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding
          protein Musashi homolog 2 (Musashi-2 ) and similar
          proteins.  This subgroup corresponds to the RRM2 of
          Musashi-2 (also termed Msi2) which has been identified
          as a regulator of the hematopoietic stem cell (HSC)
          compartment and of leukemic stem cells after
          transplantation of cells with loss and gain of function
          of the gene. It influences proliferation and
          differentiation of HSCs and myeloid progenitors, and
          further modulates normal hematopoiesis and promotes
          aggressive myeloid leukemia. Musashi-2 contains two
          conserved N-terminal tandem RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), along with other domains
          of unknown function. .
          Length = 76

 Score = 30.0 bits (67), Expect = 0.017
 Identities = 11/26 (42%), Positives = 20/26 (76%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+F+GGLS  T+ + +++YF +FG +
Sbjct: 1  KMFIGGLSWQTSPDSLRDYFSKFGEI 26


>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a.k.a. RRM, RBD, or RNP
          domain). 
          Length = 69

 Score = 29.8 bits (68), Expect = 0.018
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++V  L    T ED++ +F  +G V
Sbjct: 1  LYVRNLPPSVTEEDLREFFSPYGKV 25


>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the
          p54nrb/PSF/PSP1 family.  This subfamily corresponds to
          the RRM1 of the p54nrb/PSF/PSP1 family, including 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb or
          NonO or NMT55), polypyrimidine tract-binding protein
          (PTB)-associated-splicing factor (PSF or POMp100),
          paraspeckle protein 1 (PSP1 or PSPC1), which are
          ubiquitously expressed and are conserved in
          vertebrates. p54nrb is a multi-functional protein
          involved in numerous nuclear processes including
          transcriptional regulation, splicing, DNA unwinding,
          nuclear retention of hyperedited double-stranded RNA,
          viral RNA processing, control of cell proliferation,
          and circadian rhythm maintenance. PSF is also a
          multi-functional protein that binds RNA,
          single-stranded DNA (ssDNA), double-stranded DNA
          (dsDNA) and many factors, and mediates diverse
          activities in the cell. PSP1 is a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. The cellular function
          of PSP1 remains unknown currently. This subfamily also
          includes some p54nrb/PSF/PSP1 homologs from
          invertebrate species, such as the Drosophila
          melanogaster gene no-ontransient A (nonA) encoding
          puff-specific protein Bj6 (also termed NONA) and
          Chironomus tentans hrp65 gene encoding protein Hrp65.
          D. melanogaster NONA is involved in eye development and
          behavior, and may play a role in circadian rhythm
          maintenance, similar to vertebrate p54nrb. C. tentans
          Hrp65 is a component of nuclear fibers associated with
          ribonucleoprotein particles in transit from the gene to
          the nuclear pore. All family members contain a DBHS
          domain (for Drosophila behavior, human splicing), which
          comprises two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a charged
          protein-protein interaction module. PSF has an
          additional large N-terminal domain that differentiates
          it from other family members. .
          Length = 71

 Score = 29.6 bits (67), Expect = 0.020
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++FVG L    T E+ K  F ++G V
Sbjct: 3  RLFVGNLPNDITEEEFKELFSKYGEV 28


>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General
           function prediction only].
          Length = 306

 Score = 31.1 bits (69), Expect = 0.020
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 14  TKKIFVGGLSAPTTLEDVKNYFEQFGPVY 42
              +FVG L    T ED++  F++FGPV 
Sbjct: 115 NNTLFVGNLPYDVTEEDLRELFKKFGPVK 143


>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA
          stem-loop-interacting RNA-binding protein (SLIRP) and
          similar proteins.  This subfamily corresponds to the
          RRM of SLIRP, a widely expressed small steroid receptor
          RNA activator (SRA) binding protein, which binds to
          STR7, a functional substructure of SRA. SLIRP is
          localized predominantly to the mitochondria and plays a
          key role in modulating several nuclear receptor (NR)
          pathways. It functions as a co-repressor to repress
          SRA-mediated nuclear receptor coactivation. It
          modulates SHARP- and SKIP-mediated co-regulation of NR
          activity. SLIRP contains an RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), which is required for
          SLIRP's corepression activities. .
          Length = 73

 Score = 29.6 bits (67), Expect = 0.022
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+FVG L      +++K YF QFG V
Sbjct: 1  KLFVGNLPWTVGSKELKEYFSQFGKV 26


>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras
          GTPase-activating protein-binding protein G3BP1, G3BP2
          and similar proteins.  This subfamily corresponds to
          the RRM domain in the G3BP family of RNA-binding and
          SH3 domain-binding proteins. G3BP acts at the level of
          RNA metabolism in response to cell signaling, possibly
          as RNA transcript stabilizing factors or an RNase.
          Members include G3BP1, G3BP2 and similar proteins.
          These proteins associate directly with the SH3 domain
          of GTPase-activating protein (GAP), which functions as
          an inhibitor of Ras. They all contain an N-terminal
          nuclear transfer factor 2 (NTF2)-like domain, an acidic
          domain, a domain containing PXXP motif(s), an RNA
          recognition motif (RRM), and an Arg-Gly-rich region
          (RGG-rich region, or arginine methylation motif).
          Length = 81

 Score = 29.7 bits (67), Expect = 0.025
 Identities = 10/26 (38%), Positives = 18/26 (69%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++FVG L    T +++K +F++FG V
Sbjct: 5  QLFVGNLPHDITEDELKEFFKEFGNV 30


>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible
          RNA binding protein (CIRBP), RNA binding motif protein
          3 (RBM3) and similar proteins.  This subfamily
          corresponds to the RRM domain of two structurally
          related heterogenous nuclear ribonucleoproteins, CIRBP
          (also termed CIRP or A18 hnRNP) and RBM3 (also termed
          RNPL), both of which belong to a highly conserved cold
          shock proteins family. The cold shock proteins can be
          induced after exposure to a moderate cold-shock and
          other cellular stresses such as UV radiation and
          hypoxia. CIRBP and RBM3 may function in
          posttranscriptional regulation of gene expression by
          binding to different transcripts, thus allowing the
          cell to response rapidly to environmental signals.
          However, the kinetics and degree of cold induction are
          different between CIRBP and RBM3. Tissue distribution
          of their expression is different. CIRBP and RBM3 may be
          differentially regulated under physiological and stress
          conditions and may play distinct roles in cold
          responses of cells. CIRBP, also termed glycine-rich
          RNA-binding protein CIRP, is localized in the nucleus
          and mediates the cold-induced suppression of cell cycle
          progression. CIRBP also binds DNA and possibly serves
          as a chaperone that assists in the folding/unfolding,
          assembly/disassembly and transport of various proteins.
          RBM3 may enhance global protein synthesis and the
          formation of active polysomes while reducing the levels
          of ribonucleoprotein complexes containing microRNAs.
          RBM3 may also serve to prevent the loss of muscle mass
          by its ability to decrease cell death. Furthermore,
          RBM3 may be essential for cell proliferation and
          mitosis. Both, CIRBP and RBM3, contain an N-terminal
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), that
          is involved in RNA binding, and C-terminal glycine-rich
          domain (RGG motif) that probably enhances RNA-binding
          via protein-protein and/or protein-RNA interactions.
          Like CIRBP, RBM3 can also bind to both RNA and DNA via
          its RRM domain. .
          Length = 80

 Score = 29.0 bits (65), Expect = 0.040
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K+F+GGLS  T  + ++  F ++G +
Sbjct: 2  KLFIGGLSFDTNEQSLEQVFSKYGQI 27


>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate
          RNA-binding protein 4 (RBM4).  This subgroup
          corresponds to the RRM2 of RBM4, a ubiquitously
          expressed splicing factor that has two isoforms, RBM4A
          (also known as Lark homolog) and RBM4B (also known as
          RBM30), which are very similar in structure and
          sequence. RBM4 may function as a translational
          regulator of stress-associated mRNAs and also plays a
          role in micro-RNA-mediated gene regulation. RBM4
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), a CCHC-type zinc finger,
          and three alanine-rich regions within their C-terminal
          regions. The C-terminal region may be crucial for
          nuclear localization and protein-protein interaction.
          The RRMs, in combination with the C-terminal region,
          are responsible for the splicing function of RBM4. .
          Length = 67

 Score = 28.8 bits (64), Expect = 0.044
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVYYTACD 47
          K+ VG +S+  T ++++  FE++GPV    CD
Sbjct: 2  KLHVGNISSSCTNQELRAKFEEYGPV--IECD 31


>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell
          carcinoma antigen recognized by T-cells 3 (SART3) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of SART3, also termed Tat-interacting protein of
          110 kDa (Tip110), is an RNA-binding protein expressed
          in the nucleus of the majority of proliferating cells,
          including normal cells and malignant cells, but not in
          normal tissues except for the testes and fetal liver.
          It is involved in the regulation of mRNA splicing
          probably via its complex formation with RNA-binding
          protein with a serine-rich domain (RNPS1), a
          pre-mRNA-splicing factor. SART3 has also been
          identified as a nuclear Tat-interacting protein that
          regulates Tat transactivation activity through direct
          interaction and functions as an important cellular
          factor for HIV-1 gene expression and viral replication.
          In addition, SART3 is required for U6 snRNP targeting
          to Cajal bodies. It binds specifically and directly to
          the U6 snRNA, interacts transiently with the U6 and
          U4/U6 snRNPs, and promotes the reassembly of U4/U6
          snRNPs after splicing in vitro. SART3 contains an
          N-terminal half-a-tetratricopeptide repeat (HAT)-rich
          domain, a nuclearlocalization signal (NLS) domain, and
          two C-terminal RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). .
          Length = 81

 Score = 28.9 bits (65), Expect = 0.047
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
           K+FV GL    T E+++  F++ G V
Sbjct: 3  HKLFVSGLPFSVTKEELEKLFKKHGVV 29


>gnl|CDD|241168 cd12724, RRM1_CPEB2_like, RNA recognition motif 1 in cytoplasmic
          polyadenylation element-binding protein CPEB-2, CPEB-3,
          CPEB-4 and similar protiens.  This subgroup corresponds
          to the RRM1 of the paralog proteins CPEB-2, CPEB-3 and
          CPEB-4, all well-conserved in both, vertebrates and
          invertebrates. Due to the high sequence similarity,
          members in this family may share similar expression
          patterns and functions. CPEB-2 is an RNA-binding
          protein that is abundantly expressed in testis and
          localized in cytoplasm in transfected HeLa cells. It
          preferentially binds to poly(U) RNA oligomers and may
          regulate the translation of stored mRNAs during
          spermiogenesis. Moreover, CPEB-2 impedes target RNA
          translation at elongation; it directly interacts with
          the elongation factor, eEF2, to reduce
          eEF2/ribosome-activated GTP hydrolysis in vitro and
          inhibit peptide elongation of CPEB2-bound RNA in vivo.
          CPEB-3 is a sequence-specific translational regulatory
          protein that regulates translation in a
          polyadenylation-independent manner. It functions as a
          translational repressor that governs the synthesis of
          the AMPA receptor GluR2 through binding GluR2 mRNA. It
          also represses translation of a reporter RNA in
          transfected neurons and stimulates translation in
          response to NMDA. CPEB-4 is an RNA-binding protein that
          mediates meiotic mRNA cytoplasmic polyadenylation and
          translation. It is essential for neuron survival and
          present on the endoplasmic reticulum (ER). It is
          accumulated in the nucleus upon ischemia or the
          depletion of ER calcium. CPEB-4 is overexpressed in a
          large variety of tumors and is associated with many
          mRNAs in cancer cells. All family members contain an
          N-terminal unstructured region, two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a Zn-finger
          motif. In addition, they do have conserved nuclear
          export signals that are not present in CPEB-1. .
          Length = 92

 Score = 29.0 bits (65), Expect = 0.049
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +K+FVGGL      +++   F +FGP+
Sbjct: 1  RKVFVGGLPPDIDEDEITASFRRFGPL 27


>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12
          small nuclear ribonucleoprotein 35 kDa protein
          (U11/U12-35K) and similar proteins.  This subfamily
          corresponds to the RRM of U11/U12-35K, also termed
          protein HM-1, or U1 snRNP-binding protein homolog, and
          is one of the components of the U11/U12 snRNP, which is
          a subunit of the minor (U12-dependent) spliceosome
          required for splicing U12-type nuclear pre-mRNA
          introns. U11/U12-35K is highly conserved among
          bilateria and plants, but lacks in some organisms, such
          as Saccharomyces cerevisiae and Caenorhabditis elegans.
          Moreover, U11/U12-35K shows significant sequence
          homology to U1 snRNP-specific 70 kDa protein (U1-70K or
          snRNP70). It contains a conserved RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by an adjacent
          glycine-rich region, and Arg-Asp and Arg-Glu dipeptide
          repeats rich domain, making U11/U12-35K a possible
          functional analog of U1-70K. It may facilitate 5'
          splice site recognition in the minor spliceosome and
          play a role in exon bridging, interacting with
          components of the major spliceosome bound to the
          pyrimidine tract of an upstream U2-type intron. The
          family corresponds to the RRM of U11/U12-35K that may
          directly contact the U11 or U12 snRNA through the RRM
          domain.
          Length = 93

 Score = 28.8 bits (65), Expect = 0.054
 Identities = 10/27 (37%), Positives = 16/27 (59%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
            +FVG LS  TT E ++  F ++G +
Sbjct: 4  LTLFVGRLSLQTTEETLREVFSRYGDI 30


>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM3 domain in the Spen (split end) protein family
          which includes RNA binding motif protein 15 (RBM15),
          putative RNA binding motif protein 15B (RBM15B) and
          similar proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and is a
          novel component of the NXF1 pathway. It binds to NXF1
          and serves as receptor for the RNA export element RTE.
          It also possess mRNA export activity and can facilitate
          the access of DEAD-box protein DBP5 to mRNA at the
          nuclear pore complex (NPC). RNA-binding protein 15B
          (RBM15B), also termed one twenty-two 3 (OTT3), is a
          paralog of RBM15 and therefore has post-transcriptional
          regulatory activity. It is a nuclear protein sharing
          with RBM15 the association with the splicing factor
          compartment and the nuclear envelope as well as the
          binding to mRNA export factors NXF1 and Aly/REF.
          Members in this family belong to the Spen (split end)
          protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 72

 Score = 28.7 bits (65), Expect = 0.055
 Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 7/43 (16%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKNF 59
          ++VGGL   T+L +++  F++FG +      R  +   P +N+
Sbjct: 1  LWVGGLGPWTSLAELEREFDRFGAI-----RRIDY--DPGRNY 36


>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54
          kDa nuclear RNA- and DNA-binding protein (p54nrb).
          This subgroup corresponds to the RRM1 of p54nrb, also
          termed non-POU domain-containing octamer-binding
          protein (NonO), or 55 kDa nuclear protein (NMT55), or
          DNA-binding p52/p100 complex 52 kDa subunit. p54nrb is
          a multifunctional protein involved in numerous nuclear
          processes including transcriptional regulation,
          splicing, DNA unwinding, nuclear retention of
          hyperedited double-stranded RNA, viral RNA processing,
          control of cell proliferation, and circadian rhythm
          maintenance. It is ubiquitously expressed and highly
          conserved in vertebrates. p54nrb binds both, single-
          and double-stranded RNA and DNA, and also possesses
          inherent carbonic anhydrase activity. It forms a
          heterodimer with paraspeckle component 1 (PSPC1 or
          PSP1), localizing to paraspeckles in an RNA-dependent
          manneras well as with polypyrimidine tract-binding
          protein-associated-splicing factor (PSF). p54nrb
          contains two conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 28.7 bits (64), Expect = 0.056
 Identities = 9/24 (37%), Positives = 16/24 (66%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFG 39
          ++FVG L    T E+++  FE++G
Sbjct: 3  RLFVGNLPPDITEEEMRKLFEKYG 26


>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins p40-TIA-1 and
          TIAR.  This subfamily corresponds to the RRM2 of
          nucleolysin TIA-1 isoform p40 (p40-TIA-1 or TIA-1) and
          nucleolysin TIA-1-related protein (TIAR), both of which
          are granule-associated RNA binding proteins involved in
          inducing apoptosis in cytotoxic lymphocyte (CTL) target
          cells. TIA-1 and TIAR share high sequence similarity.
          They are expressed in a wide variety of cell types.
          TIA-1 can be phosphorylated by a serine/threonine
          kinase that is activated during Fas-mediated apoptosis.
          TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both,
          TIA-1 and TIAR, bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains.
          Length = 75

 Score = 28.5 bits (64), Expect = 0.062
 Identities = 10/23 (43%), Positives = 12/23 (52%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFG 39
          IFVG LS     E ++  F  FG
Sbjct: 2  IFVGDLSPEIDTETLRAAFAPFG 24


>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the
          peroxisome proliferator-activated receptor gamma
          coactivator 1A (PGC-1alpha) family of regulated
          coactivators.  This subfamily corresponds to the RRM of
          PGC-1alpha, PGC-1beta, and PGC-1-related coactivator
          (PRC), which serve as mediators between environmental
          or endogenous signals and the transcriptional machinery
          governing mitochondrial biogenesis. They play an
          important integrative role in the control of
          respiratory gene expression through interacting with a
          number of transcription factors, such as NRF-1, NRF-2,
          ERR, CREB and YY1. All family members are multi-domain
          proteins containing the N-terminal activation domain,
          an LXXLL coactivator signature, a tetrapeptide motif
          (DHDY) responsible for HCF binding, and an RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). In contrast
          to PGC-1alpha and PRC, PGC-1beta possesses two
          glutamic/aspartic acid-rich acidic domains, but lacks
          most of the arginine/serine (SR)-rich domain that is
          responsible for the regulation of RNA processing. .
          Length = 89

 Score = 28.4 bits (64), Expect = 0.072
 Identities = 8/25 (32%), Positives = 15/25 (60%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          I+VG +   TT  +++  F+ FG +
Sbjct: 5  IYVGKIPIDTTRSELRQRFQPFGEI 29


>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP
          Elav-like family member CELF-1, CELF-2, Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM1 of CELF-1, CELF-2 and
          Bruno protein. CELF-1 (also termed BRUNOL-2, or
          CUG-BP1, or EDEN-BP) and CELF-2 (also termed BRUNOL-3,
          or ETR-3, or CUG-BP2, or NAPOR) belong to the CUGBP1
          and ETR-3-like factors (CELF) or BRUNOL (Bruno-like)
          family of RNA-binding proteins that have been
          implicated in regulation of pre-mRNA splicing, and
          control of mRNA translation and deadenylation. CELF-1
          is strongly expressed in all adult and fetal tissues
          tested. The human CELF-1 is a nuclear and cytoplasmic
          RNA-binding protein that regulates multiple aspects of
          nuclear and cytoplasmic mRNA processing, with
          implications for onset of type 1 myotonic dystrophy
          (DM1), a neuromuscular disease associated with an
          unstable CUG triplet expansion in the 3'-UTR
          (3'-untranslated region) of the DMPK (myotonic
          dystrophy protein kinase) gene; it preferentially
          targets UGU-rich mRNA elements. It has been shown to
          bind to a Bruno response element, a cis-element
          involved in translational control of oskar mRNA in
          Drosophila, and share sequence similarity to Bruno, the
          Drosophila protein that mediates this process. The
          Xenopus homolog embryo deadenylation element-binding
          protein (EDEN-BP) mediates sequence-specific
          deadenylation of Eg5 mRNA. It binds specifically to the
          EDEN motif in the 3'-untranslated regions of maternal
          mRNAs and targets these mRNAs for deadenylation and
          translational repression. CELF-1 contain three highly
          conserved RNA recognition motifs (RRMs), also known as
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains): two consecutive RRMs (RRM1 and RRM2) situated
          in the N-terminal region followed by a linker region
          and the third RRM (RRM3) close to the C-terminus of the
          protein. The two N-terminal RRMs of EDEN-BP are
          necessary for the interaction with EDEN as well as a
          part of the linker region (between RRM2 and RRM3).
          Oligomerization of EDEN-BP is required for specific
          mRNA deadenylation and binding. CELF-2 is expressed in
          all tissues at some level, but highest in brain, heart,
          and thymus. It has been implicated in the regulation of
          nuclear and cytoplasmic RNA processing events,
          including alternative splicing, RNA editing, stability
          and translation. CELF-2 shares high sequence identity
          with CELF-1, but shows different binding specificity;
          it binds preferentially to sequences with UG repeats
          and UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contains
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are also important for
          localization in the cytoplasm. The splicing activation
          or repression activity of CELF-2 on some specific
          substrates is mediated by RRM1/RRM2. Both, RRM1 and
          RRM2 of CELF-2, can activate cardiac troponin T (cTNT)
          exon 5 inclusion. In addition, CELF-2 possesses a
          typical arginine and lysine-rich nuclear localization
          signal (NLS) in the C-terminus, within RRM3. This
          subgroup also includes Drosophila melanogaster Bruno
          protein, which plays a central role in regulation of
          Oskar (Osk) expression in flies. It mediates repression
          by binding to regulatory Bruno response elements (BREs)
          in the Osk mRNA 3' UTR. The full-length Bruno protein
          contains three RRMs, two located in the N-terminal half
          of the protein and the third near the C-terminus,
          separated by a linker region. .
          Length = 84

 Score = 28.6 bits (64), Expect = 0.074
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVY 42
          K+FVG +    + +D++  FEQ+G VY
Sbjct: 3  KMFVGQIPRSWSEKDLRELFEQYGAVY 29


>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate
          RRM-containing coactivator activator/modulator (CoAA). 
          This subgroup corresponds to the RRM1 of CoAA, also
          termed RNA-binding protein 14 (RBM14), or paraspeckle
          protein 2 (PSP2), or synaptotagmin-interacting protein
          (SYT-interacting protein), a heterogeneous nuclear
          ribonucleoprotein (hnRNP)-like protein identified as a
          nuclear receptor coactivator. It mediates
          transcriptional coactivation and RNA splicing effects
          in a promoter-preferential manner and is enhanced by
          thyroid hormone receptor-binding protein (TRBP). CoAA
          contains two N-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a TRBP-interacting
          domain. It stimulates transcription through its
          interactions with coactivators, such as TRBP and
          CREB-binding protein CBP/p300, via the TRBP-interacting
          domain and interaction with an RNA-containing complex,
          such as DNA-dependent protein kinase-poly(ADP-ribose)
          polymerase complexes, via the RRMs. .
          Length = 69

 Score = 28.2 bits (63), Expect = 0.078
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          KIFVG +   T+ E+++  FE +G V
Sbjct: 2  KIFVGNVDEDTSQEELRALFEAYGAV 27


>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing
          regulatory glutamine/lysine-rich protein 1 (SREK1) and
          similar proteins.  This subfamily corresponds to the
          RRM2 of SREK1, also termed
          serine/arginine-rich-splicing regulatory protein 86-kDa
          (SRrp86), or splicing factor arginine/serine-rich 12
          (SFRS12), or splicing regulatory protein 508 amino acid
          (SRrp508). SREK1 belongs to a family of proteins
          containing regions rich in serine-arginine dipeptides
          (SR proteins family), which is involved in
          bridge-complex formation and splicing by mediating
          protein-protein interactions across either introns or
          exons. It is a unique SR family member and it may play
          a crucial role in determining tissue specific patterns
          of alternative splicing. SREK1 can alter splice site
          selection by both positively and negatively modulating
          the activity of other SR proteins. For instance, SREK1
          can activate SRp20 and repress SC35 in a dose-dependent
          manner both in vitro and in vivo. In addition, SREK1
          contains two (some contain only one) RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and two
          serine-arginine (SR)-rich domains (SR domains)
          separated by an unusual glutamic acid-lysine (EK) rich
          region. The RRM and SR domains are highly conserved
          among other members of the SR superfamily. However, the
          EK domain is unique to SREK1. It plays a modulatory
          role controlling SR domain function by involvement in
          the inhibition of both constitutive and alternative
          splicing and in the selection of splice-site. .
          Length = 85

 Score = 28.4 bits (64), Expect = 0.078
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%)

Query: 13 RTKKIFVGGLSAPTTLEDVKNYFEQFGPVYY 43
          RT  I+VG L   TT + +  +F Q G V Y
Sbjct: 5  RT--IYVGNLDPTTTADQLLEFFSQAGEVKY 33


>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold
          attachment factor B1 (SAFB1), scaffold attachment
          factor B2 (SAFB2), and similar proteins.  This subgroup
          corresponds to RRM of SAFB1, also termed scaffold
          attachment factor B (SAF-B), heat-shock protein 27
          estrogen response element ERE and TATA-box-binding
          protein (HET), or heterogeneous nuclear
          ribonucleoprotein hnRNP A1- associated protein (HAP), a
          large multi-domain protein with well-described
          functions in transcriptional repression, RNA splicing
          and metabolism, and a proposed role in chromatin
          organization. Based on the numerous functions, SAFB1
          has been implicated in many diverse cellular processes
          including cell growth and transformation, stress
          response, and apoptosis. SAFB1 specifically binds to
          AT-rich scaffold or matrix attachment region DNA
          elements (S/MAR DNA) by using its N-terminal scaffold
          attachment factor-box (SAF-box, also known as SAP
          domain), a homeodomain-like DNA binding motif. The
          central region of SAFB1 is composed of an RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and a
          nuclear localization signal (NLS). The C-terminus of
          SAFB1 contains Glu/Arg- and Gly-rich regions that might
          be involved in protein-protein interaction. Additional
          studies indicate that the C-terminal region contains a
          potent and transferable transcriptional repression
          domain. Another family member is SAFB2, a homolog of
          SAFB1. Both SAFB1 and SAFB2 are ubiquitously
          coexpressed and share very high sequence similarity,
          suggesting that they might function in a similar
          manner. However, unlike SAFB1, exclusively existing in
          the nucleus, SAFB2 is also present in the cytoplasm.
          The additional cytoplasmic localization of SAFB2
          implies that it could play additional roles in the
          cytoplasmic compartment which are distinct from the
          nuclear functions shared with SAFB1.
          Length = 76

 Score = 28.2 bits (62), Expect = 0.086
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          + ++V GLS+ T   D+KN F ++G V
Sbjct: 2  RNLWVSGLSSTTRATDLKNLFSKYGKV 28


>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8
          (NOL8) and similar proteins.  This model corresponds to
          the RRM of NOL8 (also termed Nop132) encoded by a novel
          NOL8 gene that is up-regulated in the majority of
          diffuse-type, but not intestinal-type, gastric cancers.
          Thus, NOL8 may be a good molecular target for treatment
          of diffuse-type gastric cancer. Also, NOL8 is a
          phosphorylated protein that contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), suggesting
          NOL8 is likely to function as a novel RNA-binding
          protein. It may be involved in regulation of gene
          expression at the post-transcriptional level or in
          ribosome biogenesis in cancer cells.
          Length = 78

 Score = 28.3 bits (64), Expect = 0.087
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVGGLS   T  D++  F +FG V
Sbjct: 2  LFVGGLSPSVTESDLEERFSRFGTV 26


>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM3 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 107

 Score = 28.7 bits (64), Expect = 0.089
 Identities = 10/27 (37%), Positives = 14/27 (51%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYY 43
          +FV  L    T E +  +F +FG V Y
Sbjct: 4  LFVRNLPYDATEESLAPHFSKFGSVRY 30


>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment
          factor (SAF)-like transcription modulator (SLTM) and
          similar proteins.  This subgroup corresponds to the RRM
          domain of SLTM, also termed modulator of
          estrogen-induced transcription, which shares high
          sequence similarity with scaffold attachment factor B1
          (SAFB1). It contains a scaffold attachment factor-box
          (SAF-box, also known as SAP domain) DNA-binding motif,
          an RNA recognition motif (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a region rich in glutamine and arginine residues. To a
          large extent, SLTM co-localizes with SAFB1 in the
          nucleus, which suggests that they share similar
          functions, such as the inhibition of an oestrogen
          reporter gene. However, rather than mediating a
          specific inhibitory effect on oestrogen action, SLTM is
          shown to exert a generalized inhibitory effect on gene
          expression associated with induction of apoptosis in a
          wide range of cell lines. .
          Length = 74

 Score = 28.1 bits (62), Expect = 0.097
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVY 42
          ++V GLS+ T   D+KN F ++G V 
Sbjct: 2  LWVSGLSSNTKAADLKNLFGKYGKVL 27


>gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast
          Saccharomyces cerevisiae SET domain-containing protein
          1 (scSet1p) and similar proteins.  This subfamily
          corresponds to the RRM of scSet1p, also termed H3
          lysine-4 specific histone-lysine N-methyltransferase,
          or COMPASS component SET1, or lysine
          N-methyltransferase 2, which is encoded by SET1 from
          the yeast S. cerevisiae. It is a nuclear protein that
          may play a role in both silencing and activating
          transcription. scSet1p is closely related to the SET
          domain proteins of multicellular organisms, which are
          implicated in diverse aspects of cell morphology,
          growth control, and chromatin-mediated transcriptional
          silencing. scSet1p contains an N-terminal RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), followed by
          a conserved SET domain that may play a role in DNA
          repair and telomere function. .
          Length = 110

 Score = 28.5 bits (64), Expect = 0.10
 Identities = 10/28 (35%), Positives = 15/28 (53%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
            +I V G    T+ + +KNYF  FG +
Sbjct: 2  PVEIVVWGFQPSTSEDIIKNYFSSFGEI 29


>gnl|CDD|240970 cd12526, RRM1_EAR1_like, RNA recognition motif 1 in terminal
          EAR1-like proteins.  This subgroup corresponds to the
          RRM1 of terminal EAR1-like proteins, including terminal
          EAR1-like protein 1 and 2 (TEL1 and TEL2) found in land
          plants. They may play a role in the regulation of leaf
          initiation. The terminal EAR1-like proteins are
          putative RNA-binding proteins carrying three RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and TEL characteristic motifs that allow sequence and
          putative functional discrimination between the terminal
          EAR1-like proteins and Mei2-like proteins. .
          Length = 71

 Score = 28.1 bits (63), Expect = 0.10
 Identities = 8/40 (20%), Positives = 16/40 (40%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGI 53
          ++ + + G+        ++   EQ+G V     D    GI
Sbjct: 1  SRALLLSGVPPHIPETQLRRDLEQWGAVRAVQMDAMAEGI 40


>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family.  This model
           represents a subfamily of RNA splicing factors including
           the Pad-1 protein (N. crassa), CAPER (M. musculus) and
           CC1.3 (H.sapiens). These proteins are characterized by
           an N-terminal arginine-rich, low complexity domain
           followed by three (or in the case of 4 H. sapiens
           paralogs, two) RNA recognition domains (rrm: pfam00706).
           These splicing factors are closely related to the U2AF
           splicing factor family (TIGR01642). A homologous gene
           from Plasmodium falciparum was identified in the course
           of the analysis of that genome at TIGR and was included
           in the seed.
          Length = 457

 Score = 28.7 bits (64), Expect = 0.10
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 16  KIFVGGLSAPTTLEDVKNYFEQFGPV 41
           K++VG L    T ++++  FE FG +
Sbjct: 188 KLYVGNLHFNITEQELRQIFEPFGDI 213


>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering
          time control protein FCA and similar proteins.  This
          subgroup corresponds to the RRM1 of FCA, a gene
          controlling flowering time in Arabidopsis, encoding a
          flowering time control protein that functions in the
          posttranscriptional regulation of transcripts involved
          in the flowering process. FCA contains two RNA
          recognition motifs (RRMs), also known as RBDs (RNA
          binding domains) or RNP (ribonucleoprotein domains),
          and a WW protein interaction domain. .
          Length = 80

 Score = 28.0 bits (62), Expect = 0.11
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPVYYTA 45
          K+FVG +    T ++V+  FE+ G V   A
Sbjct: 1  KLFVGSVPRTITEQEVRPMFEEHGNVLEVA 30


>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted
          PIP5K1A-regulated poly(A) polymerase (Star-PAP) and
          similar proteins.  This subfamily corresponds to the
          RRM of Star-PAP, also termed RNA-binding motif protein
          21 (RBM21), which is a ubiquitously expressed U6
          snRNA-specific terminal uridylyltransferase (U6-TUTase)
          essential for cell proliferation. Although it belongs
          to the well-characterized poly(A) polymerase protein
          superfamily, Star-PAP is highly divergent from both,
          the poly(A) polymerase (PAP) and the terminal uridylyl
          transferase (TUTase), identified within the editing
          complexes of trypanosomes. Star-PAP predominantly
          localizes at nuclear speckles and catalyzes
          RNA-modifying nucleotidyl transferase reactions. It
          functions in mRNA biosynthesis and may be regulated by
          phosphoinositides. It binds to glutathione
          S-transferase (GST)-PIPKIalpha. Star-PAP preferentially
          uses ATP as a nucleotide substrate and possesses PAP
          activity that is stimulated by PtdIns4,5P2. It contains
          an N-terminal C2H2-type zinc finger motif followed by
          an RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), a
          split PAP domain linked by a proline-rich region, a PAP
          catalytic and core domain, a PAP-associated domain, an
          RS repeat, and a nuclear localization signal (NLS). .
          Length = 74

 Score = 27.7 bits (62), Expect = 0.11
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FV G    T+ E + +YF  FGPV
Sbjct: 5  VFVSGFKRGTSEEQLMDYFSAFGPV 29


>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in
          serine/arginine-rich splicing factor 3 (SRSF3) and
          similar proteins.  This subfamily corresponds to the
          RRM of two serine/arginine (SR) proteins,
          serine/arginine-rich splicing factor 3 (SRSF3) and
          serine/arginine-rich splicing factor 7 (SRSF7). SRSF3,
          also termed pre-mRNA-splicing factor SRp20, modulates
          alternative splicing by interacting with RNA
          cis-elements in a concentration- and cell
          differentiation-dependent manner. It is also involved
          in termination of transcription, alternative RNA
          polyadenylation, RNA export, and protein translation.
          SRSF3 is critical for cell proliferation, and tumor
          induction and maintenance. It can shuttle between the
          nucleus and cytoplasm. SRSF7, also termed splicing
          factor 9G8, plays a crucial role in both constitutive
          splicing and alternative splicing of many pre-mRNAs.
          Its localization and functions are tightly regulated by
          phosphorylation. SRSF7 is predominantly present in the
          nuclear and can shuttle between nucleus and cytoplasm.
          It cooperates with the export protein, Tap/NXF1, helps
          mRNA export to the cytoplasm, and enhances the
          expression of unspliced mRNA. Moreover, SRSF7 inhibits
          tau E10 inclusion through directly interacting with the
          proximal downstream intron of E10, a clustering region
          for frontotemporal dementia with Parkinsonism (FTDP)
          mutations. Both SRSF3 and SRSF7 contain a single
          N-terminal RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and a C-terminal RS domain rich in serine-arginine
          dipeptides. The RRM domain is involved in RNA binding,
          and the RS domain has been implicated in protein
          shuttling and protein-protein interactions. .
          Length = 73

 Score = 28.0 bits (63), Expect = 0.11
 Identities = 9/26 (34%), Positives = 18/26 (69%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          K++VG L    T  ++++ FE++GP+
Sbjct: 1  KVYVGNLGPRATKRELEDEFEKYGPL 26


>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding
          protein 19 (RBM19) and similar proteins.  This subgroup
          corresponds to the RRM3 of RBM19, also termed
          RNA-binding domain-1 (RBD-1), which is a nucleolar
          protein conserved in eukaryotes. It is involved in
          ribosome biogenesis by processing rRNA. In addition, it
          is essential for preimplantation development. RBM19 has
          a unique domain organization containing 6 conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains). .
          Length = 79

 Score = 27.8 bits (62), Expect = 0.12
 Identities = 8/28 (28%), Positives = 18/28 (64%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          + ++F+  L+   T ED++  F ++GP+
Sbjct: 2  SGRLFIRNLAYTCTEEDLEKLFSKYGPL 29


>gnl|CDD|220013 pfam08777, RRM_3, RNA binding motif.  This domain is found in
          protein La which functions as an RNA chaperone during
          RNA polymerase III transcription, and can also
          stimulate translation initiation. It contains a five
          stranded beta sheet which forms an atypical RNA
          recognition motif.
          Length = 102

 Score = 28.1 bits (63), Expect = 0.12
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 21 GLSAPTTLEDVKNYFEQFGPVYY 43
          GL+ PT+ ED+K  F Q G V Y
Sbjct: 8  GLNKPTSREDIKEAFSQHGEVKY 30


>gnl|CDD|240907 cd12461, RRM_SCAF4, RNA recognition motif found in SR-related and
          CTD-associated factor 4 (SCAF4) and similar proteins.
          The CD corresponds to the RRM of SCAF4 (also termed
          splicing factor, arginine/serine-rich 15 or SFR15, or
          CTD-binding SR-like protein RA4) that belongs to a new
          class of SCAFs (SR-like CTD-associated factors).
          Although its biological function remains unclear, SCAF4
          shows high sequence similarity to SCAF8 that interacts
          specifically with a highly serine-phosphorylated form
          of the carboxy-terminal domain (CTD) of the largest
          subunit of RNA polymerase II (pol II) and may play a
          direct role in coupling with both, transcription and
          pre-mRNA processing, processes. SCAF4 and SCAF8 both
          contain a conserved N-terminal CTD-interacting domain
          (CID), an atypical RNA recognition motif (RRM), also
          termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and serine/arginine-rich
          motifs.
          Length = 81

 Score = 28.1 bits (62), Expect = 0.12
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +  ++VG L   TT +DV +  E+FGP+
Sbjct: 4  STTLWVGQLDKRTTQQDVTSLLEEFGPI 31


>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE.  This
          subgroup corresponds to the RRM of BOULE, the founder
          member of the human DAZ gene family. Invertebrates
          contain a single BOULE, while vertebrates, other than
          catarrhine primates, possess both BOULE and DAZL genes.
          The catarrhine primates possess BOULE, DAZL, and DAZ
          genes. BOULE encodes an RNA-binding protein containing
          an RNA recognition motif (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), and
          a single copy of the DAZ motif. Although its specific
          biochemical functions remains to be investigated, BOULE
          protein may interact with poly(A)-binding proteins
          (PABPs), and act as translational activators of
          specific mRNAs during gametogenesis. .
          Length = 81

 Score = 27.8 bits (62), Expect = 0.13
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +IFVGG+   T   D++ +F Q+G V
Sbjct: 4  RIFVGGIDFKTNENDLRKFFSQYGTV 29


>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold
          attachment factor (SAFB) family.  This subfamily
          corresponds to the RRM domain of the SAFB family,
          including scaffold attachment factor B1 (SAFB1),
          scaffold attachment factor B2 (SAFB2), SAFB-like
          transcriptional modulator (SLTM), and similar proteins,
          which are ubiquitously expressed. SAFB1, SAFB2 and SLTM
          have been implicated in many diverse cellular processes
          including cell growth and transformation, stress
          response, and apoptosis. They share high sequence
          similarities and all contain a scaffold attachment
          factor-box (SAF-box, also known as SAP domain)
          DNA-binding motif, an RNA recognition motif (RRM), also
          known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a region rich in
          glutamine and arginine residues. SAFB1 is a nuclear
          protein with a distribution similar to that of SLTM,
          but unlike that of SAFB2, which is also found in the
          cytoplasm. To a large extent, SAFB1 and SLTM might
          share similar functions, such as the inhibition of an
          oestrogen reporter gene. The additional cytoplasmic
          localization of SAFB2 implies that it could play
          additional roles in the cytoplasmic compartment which
          are distinct from the nuclear functions shared with
          SAFB1 and SLTM. .
          Length = 74

 Score = 27.7 bits (62), Expect = 0.14
 Identities = 10/25 (40%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++V GLS+ T   D+K  F ++G V
Sbjct: 2  LWVSGLSSTTKAADLKQLFSKYGKV 26


>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1,
          RRM2) in Arabidopsis thaliana CTC-interacting domain
          protein CID8, CID9, CID10, CID11, CID12, CID 13 and
          similar proteins.  This subgroup corresponds to the RRM
          domains found in A. thaliana CID8, CID9, CID10, CID11,
          CID12, CID 13 and mainly their plant homologs. These
          highly related RNA-binding proteins contain an
          N-terminal PAM2 domain (PABP-interacting motif 2), two
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a basic region that resembles a bipartite nuclear
          localization signal. The biological role of this family
          remains unclear.
          Length = 77

 Score = 27.7 bits (62), Expect = 0.14
 Identities = 11/29 (37%), Positives = 16/29 (55%), Gaps = 2/29 (6%)

Query: 13 RTKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          RT  I VGG+    + +D+K +F   G V
Sbjct: 1  RT--IHVGGIDGSLSEDDLKEFFSNCGEV 27


>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate
          putative RNA exonuclease NEF-sp.  This subfamily
          corresponds to the RRM1 of NEF-sp., including
          uncharacterized putative RNA exonuclease NEF-sp found
          in vertebrates. Although its cellular functions remains
          unclear, NEF-sp contains an exonuclease domain and two
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          suggesting it may possess both exonuclease and
          RNA-binding activities. .
          Length = 71

 Score = 27.4 bits (61), Expect = 0.15
 Identities = 10/25 (40%), Positives = 12/25 (48%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++ G       L DVK  FE  GPV
Sbjct: 2  VYAGPFPTSFCLSDVKRLFETCGPV 26


>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 91

 Score = 27.6 bits (62), Expect = 0.18
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 13 RTKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          RT  +FVG L   T  +D+K  F+QFGP+
Sbjct: 1  RT--VFVGNLPLTTKKKDLKKLFKQFGPI 27


>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant
          Mei2-like proteins.  This subgroup corresponds to the
          RRM1 of Mei2-like proteins that represent an ancient
          eukaryotic RNA-binding proteins family. Their
          corresponding Mei2-like genes appear to have arisen
          early in eukaryote evolution, been lost from some
          lineages such as Saccharomyces cerevisiae and
          metazoans, and diversified in the plant lineage. The
          plant Mei2-like genes may function in cell fate
          specification during development, rather than as
          stimulators of meiosis. Members in this family contain
          three RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). The C-terminal RRM (RRM3) is unique to
          Mei2-like proteins and it is highly conserved between
          plants and fungi. Up to date, the intracellular
          localization, RNA target(s), cellular interactions and
          phosphorylation states of Mei2-like proteins in plants
          remain unclear. .
          Length = 77

 Score = 27.2 bits (61), Expect = 0.19
 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 12 TRTKKIFVGGLSAPTTLEDVKNYFEQFGPV--YYTAC 46
          +RT  +FV  +++    E+++  FEQFG +   YTAC
Sbjct: 1  SRT--LFVRNINSNVEDEELRALFEQFGDIRTLYTAC 35


>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in
          Pre-mRNA-splicing factor RBM22 and similar proteins.
          This subgroup corresponds to the RRM of RBM22 (also
          known as RNA-binding motif protein 22, or Zinc finger
          CCCH domain-containing protein 16), a newly discovered
          RNA-binding motif protein which belongs to the SLT11
          gene family. SLT11 gene encoding protein (Slt11p) is a
          splicing factor in yeast, which is required for
          spliceosome assembly. Slt11p has two distinct
          biochemical properties: RNA-annealing and RNA-binding
          activities. RBM22 is the homolog of SLT11 in
          vertebrate. It has been reported to be involved in
          pre-splicesome assembly and to interact with the
          Ca2+-signaling protein ALG-2. It also plays an
          important role in embryogenesis. RBM22 contains a
          conserved RNA recognition motif (RRM), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a zinc finger of the unusual type
          C-x8-C-x5-C-x3-H, and a C-terminus that is unusually
          rich in the amino acids Gly and Pro, including
          sequences of tetraprolines.
          Length = 74

 Score = 27.2 bits (61), Expect = 0.19
 Identities = 10/23 (43%), Positives = 17/23 (73%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFG 39
          ++VGGL    T +D++++F QFG
Sbjct: 4  LYVGGLGERVTEKDLRDHFYQFG 26


>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis
          thaliana phragmoplastin interacting protein 1 (PHIP1)
          and similar proteins.  This subfamily corresponds to
          the RRM1 of PHIP1. A. thaliana PHIP1 and its homologs
          represent a novel class of plant-specific RNA-binding
          proteins that may play a unique role in the polarized
          mRNA transport to the vicinity of the cell plate. The
          family members consist of multiple functional domains,
          including a lysine-rich domain (KRD domain) that
          contains three nuclear localization motifs (KKKR/NK),
          two RNA recognition motifs (RRMs), and three CCHC-type
          zinc fingers. PHIP1 is a peripheral membrane protein
          and is localized at the cell plate during cytokinesis
          in plants. In addition to phragmoplastin, PHIP1
          interacts with two Arabidopsis small GTP-binding
          proteins, Rop1 and Ran2. However, PHIP1 interacted only
          with the GTP-bound form of Rop1 but not the GDP-bound
          form. It also binds specifically to Ran2 mRNA. .
          Length = 72

 Score = 27.3 bits (61), Expect = 0.20
 Identities = 8/33 (24%), Positives = 18/33 (54%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRF 49
          ++VGG+   +T +++++YF   G +       F
Sbjct: 1  VYVGGIPYYSTEDEIRSYFSYCGEIEELDLMTF 33


>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 2 found in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM3 of RBM19 and RRM2 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 74

 Score = 27.3 bits (61), Expect = 0.21
 Identities = 10/26 (38%), Positives = 16/26 (61%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++FV  L   TT E+++  FE FG +
Sbjct: 1  RLFVRNLPFTTTEEELRELFEAFGEI 26


>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large
          nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa
          subunit (U2AF65) and similar proteins.  This subfamily
          corresponds to the RRM2 of U2AF65 and dU2AF50. U2AF65,
          also termed U2AF2, is the large subunit of U2 small
          nuclear ribonucleoprotein (snRNP) auxiliary factor
          (U2AF), which has been implicated in the recruitment of
          U2 snRNP to pre-mRNAs and is a highly conserved
          heterodimer composed of large and small subunits.
          U2AF65 specifically recognizes the intron
          polypyrimidine tract upstream of the 3' splice site and
          promotes binding of U2 snRNP to the pre-mRNA
          branchpoint. U2AF65 also plays an important role in the
          nuclear export of mRNA. It facilitates the formation of
          a messenger ribonucleoprotein export complex,
          containing both the NXF1 receptor and the RNA
          substrate. Moreover, U2AF65 interacts directly and
          specifically with expanded CAG RNA, and serves as an
          adaptor to link expanded CAG RNA to NXF1 for RNA
          export. U2AF65 contains an N-terminal RS domain rich in
          arginine and serine, followed by a proline-rich segment
          and three C-terminal RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The N-terminal RS domain
          stabilizes the interaction of U2 snRNP with the branch
          point (BP) by contacting the branch region, and further
          promotes base pair interactions between U2 snRNA and
          the BP. The proline-rich segment mediates
          protein-protein interactions with the RRM domain of the
          small U2AF subunit (U2AF35 or U2AF1). The RRM1 and RRM2
          are sufficient for specific RNA binding, while RRM3 is
          responsible for protein-protein interactions. The
          family also includes Splicing factor U2AF 50 kDa
          subunit (dU2AF50), the Drosophila ortholog of U2AF65.
          dU2AF50 functions as an essential pre-mRNA splicing
          factor in flies. It associates with intronless mRNAs
          and plays a significant and unexpected role in the
          nuclear export of a large number of intronless mRNAs.
          Length = 77

 Score = 27.2 bits (61), Expect = 0.22
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGP 40
          KIF+GGL    + + VK   E FG 
Sbjct: 2  KIFIGGLPNYLSEDQVKELLESFGK 26


>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding
          protein 28 (RBM28) and similar proteins.  This
          subfamily corresponds to the RRM1 of RBM28 and Nop4p.
          RBM28 is a specific nucleolar component of the
          spliceosomal small nuclear ribonucleoproteins (snRNPs),
          possibly coordinating their transition through the
          nucleolus. It specifically associates with U1, U2, U4,
          U5, and U6 small nuclear RNAs (snRNAs), and may play a
          role in the maturation of both small nuclear and
          ribosomal RNAs. RBM28 has four RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an extremely acidic
          region between RRM2 and RRM3. The family also includes
          nucleolar protein 4 (Nop4p or Nop77p) encoded by
          YPL043W from Saccharomyces cerevisiae. It is an
          essential nucleolar protein involved in processing and
          maturation of 27S pre-rRNA and biogenesis of 60S
          ribosomal subunits. Nop4p also contains four RRMs.  .
          Length = 79

 Score = 26.8 bits (60), Expect = 0.26
 Identities = 9/25 (36%), Positives = 15/25 (60%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FV  L   TT E ++ +F + GP+
Sbjct: 2  LFVRNLPYDTTDEQLEEFFSEVGPI 26


>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La
          or LARP3) and similar proteins.  This subfamily
          corresponds to the RRM1 of La autoantigen, also termed
          Lupus La protein, or La ribonucleoprotein, or Sjoegren
          syndrome type B antigen (SS-B), a highly abundant
          nuclear phosphoprotein and well conserved in
          eukaryotes. It specifically binds the 3'-terminal
          UUU-OH motif of nascent RNA polymerase III transcripts
          and protects them from exonucleolytic degradation by 3'
          exonucleases. In addition, La can directly facilitate
          the translation and/or metabolism of many UUU-3'
          OH-lacking cellular and viral mRNAs, through binding
          internal RNA sequences within the untranslated regions
          of target mRNAs. La contains an N-terminal La motif
          (LAM), followed by two RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). It also possesses a short
          basic motif (SBM) and a nuclear localization signal
          (NLS) at the C-terminus. .
          Length = 72

 Score = 26.8 bits (60), Expect = 0.26
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++V G     TL+D++ +FE+FG V
Sbjct: 2  VYVKGFPKDATLDDIQEFFEKFGKV 26


>gnl|CDD|217890 pfam04097, Nic96, Nup93/Nic96.  Nup93/Nic96 is a component of the
           nuclear pore complex. It is required for the correct
           assembly of the nuclear pore complex. In Saccharomyces
           cerevisiae, Nic96 has been shown to be involved in the
           distribution and cellular concentration of the GTPase
           Gsp1. The structure of Nic96 has revealed a mostly alpha
           helical structure.
          Length = 607

 Score = 27.3 bits (61), Expect = 0.33
 Identities = 6/19 (31%), Positives = 13/19 (68%)

Query: 27  TLEDVKNYFEQFGPVYYTA 45
           TL+D+++   ++G  Y+ A
Sbjct: 233 TLDDLQSLILKYGEKYFNA 251


>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast
          nucleolar protein 13 (Nop13p) and similar proteins.
          This subfamily corresponds to the RRM2 of Nop13p
          encoded by YNL175c from Saccharomyces cerevisiae. It
          shares high sequence similarity with nucleolar protein
          12 (Nop12p). Both Nop12p and Nop13p are not essential
          for growth. However, unlike Nop12p that is localized to
          the nucleolus, Nop13p localizes primarily to the
          nucleolus but is also present in the nucleoplasm to a
          lesser extent. Nop13p contains two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). .
          Length = 73

 Score = 26.6 bits (59), Expect = 0.35
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFG 39
          +FVG LS  TT ++++ +F + G
Sbjct: 1  LFVGNLSFETTEDELRAHFGRVG 23


>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding
          protein 43 (TDP-43) and similar proteins.  This
          subfamily corresponds to the RRM1 of TDP-43 (also
          termed TARDBP), a ubiquitously expressed pathogenic
          protein whose normal function and abnormal aggregation
          are directly linked to the genetic disease cystic
          fibrosis, and two neurodegenerative disorders:
          frontotemporal lobar degeneration (FTLD) and
          amyotrophic lateral sclerosis (ALS). TDP-43 binds both
          DNA and RNA, and has been implicated in transcriptional
          repression, pre-mRNA splicing and translational
          regulation. TDP-43 is a dimeric protein with two RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains),
          and a C-terminal glycine-rich domain. The RRMs are
          responsible for DNA and RNA binding; they bind to TAR
          DNA and RNA sequences with UG-repeats. The glycine-rich
          domain can interact with the hnRNP family proteins to
          form the hnRNP-rich complex involved in splicing
          inhibition. It is also essential for the cystic
          fibrosis transmembrane conductance regulator (CFTR)
          exon 9-skipping activity. .
          Length = 77

 Score = 26.6 bits (59), Expect = 0.37
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
           + V GL   TT +D+K+YF  FG +
Sbjct: 1  DLIVLGLPWKTTEQDLKDYFSTFGEL 26


>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate
          RNA-binding protein RBM23, RBM39 and similar proteins. 
          This subfamily corresponds to the RRM2 of RBM39 (also
          termed HCC1), a nuclear autoantigen that contains an
          N-terminal arginine/serine rich (RS) motif and three
          RNA recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          An octapeptide sequence called the RS-ERK motif is
          repeated six times in the RS region of RBM39. Although
          the cellular function of RBM23 remains unclear, it
          shows high sequence homology to RBM39 and contains two
          RRMs. It may possibly function as a pre-mRNA splicing
          factor. .
          Length = 73

 Score = 26.5 bits (59), Expect = 0.39
 Identities = 9/25 (36%), Positives = 15/25 (60%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++VG L    T +D++  FE FG +
Sbjct: 1  LYVGNLHFNITEDDLRGIFEPFGEI 25


>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein
          homolog TRA2-alpha, TRA2-beta and similar proteins.
          This subfamily corresponds to the RRM of two mammalian
          homologs of Drosophila transformer-2 (Tra2),
          TRA2-alpha, TRA2-beta (also termed SFRS10), and similar
          proteins found in eukaryotes. TRA2-alpha is a 40-kDa
          serine/arginine-rich (SR) protein that specifically
          binds to gonadotropin-releasing hormone (GnRH) exonic
          splicing enhancer on exon 4 (ESE4) and is necessary for
          enhanced GnRH pre-mRNA splicing. It strongly stimulates
          GnRH intron A excision in a dose-dependent manner. In
          addition, TRA2-alpha can interact with either 9G8 or
          SRp30c, which may also be crucial for ESE-dependent
          GnRH pre-mRNA splicing. TRA2-beta is a
          serine/arginine-rich (SR) protein that controls the
          pre-mRNA alternative splicing of the
          calcitonin/calcitonin gene-related peptide (CGRP), the
          survival motor neuron 1 (SMN1) protein and the tau
          protein. Both, TRA2-alpha and TRA2-beta, contains a
          well conserved RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), flanked by the N- and C-terminal
          arginine/serine (RS)-rich regions. .
          Length = 78

 Score = 26.4 bits (59), Expect = 0.43
 Identities = 10/23 (43%), Positives = 15/23 (65%)

Query: 19 VGGLSAPTTLEDVKNYFEQFGPV 41
          V GLS  TT  D++  F ++GP+
Sbjct: 4  VFGLSLYTTERDLREVFSRYGPI 26


>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit,
           splicing factor.  These splicing factors consist of an
           N-terminal arginine-rich low complexity domain followed
           by three tandem RNA recognition motifs (pfam00076). The
           well-characterized members of this family are auxilliary
           components of the U2 small nuclear ribonuclearprotein
           splicing factor (U2AF). These proteins are closely
           related to the CC1-like subfamily of splicing factors
           (TIGR01622). Members of this subfamily are found in
           plants, metazoa and fungi.
          Length = 509

 Score = 26.8 bits (59), Expect = 0.53
 Identities = 7/26 (26%), Positives = 13/26 (50%)

Query: 16  KIFVGGLSAPTTLEDVKNYFEQFGPV 41
           +I++G L      + +K   E FG +
Sbjct: 297 RIYIGNLPLYLGEDQIKELLESFGDL 322


>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in
          RNA-binding protein 19 (RBM19) and RNA recognition
          motif 3 in multiple RNA-binding domain-containing
          protein 1 (MRD1).  This subfamily corresponds to the
          RRM4 of RBM19 and the RRM3 of MRD1. RBM19, also termed
          RNA-binding domain-1 (RBD-1), is a nucleolar protein
          conserved in eukaryotes involved in ribosome biogenesis
          by processing rRNA and is essential for preimplantation
          development. It has a unique domain organization
          containing 6 conserved RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). MRD1 is encoded by a novel
          yeast gene MRD1 (multiple RNA-binding domain). It is
          well conserved in yeast and its homologues exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). MRD1
          is essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RRMs, which may play an important structural
          role in organizing specific rRNA processing events. .
          Length = 72

 Score = 26.0 bits (58), Expect = 0.57
 Identities = 11/35 (31%), Positives = 16/35 (45%), Gaps = 5/35 (14%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIF 51
          I V  L   TT E+++  FE+FG        R + 
Sbjct: 3  ILVKNLPFGTTEEELRELFEKFGS-----LGRLLL 32


>gnl|CDD|240977 cd12533, RRM_EWS, RNA recognition motif in vertebrate Ewing
          Sarcoma Protein (EWS).  This subgroup corresponds to
          the RRM of EWS, also termed Ewing sarcoma breakpoint
          region 1 protein, a member of the FET (previously TET)
          (FUS/TLS, EWS, TAF15) family of RNA- and DNA-binding
          proteins whose expression is altered in cancer. It is a
          multifunctional protein and may play roles in
          transcription and RNA processing. EWS is involved in
          transcriptional regulation by interacting with the
          preinitiation complex TFIID and the RNA polymerase II
          (RNAPII) complexes. It is also associated with splicing
          factors, such as the U1 snRNP protein U1C, suggesting
          its implication in pre-mRNA splicing. Additionally, EWS
          has been shown to regulate DNA damage-induced
          alternative splicing (AS). Like other members in the
          FET family, EWS contains an N-terminal Ser, Gly, Gln
          and Tyr-rich region composed of multiple copies of a
          degenerate hexapeptide repeat motif. The C-terminal
          region consists of a conserved nuclear import and
          retention signal (C-NLS), a C2/C2 zinc-finger motif, a
          conserved RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and at least 1 arginine-glycine-glycine (RGG)-repeat
          region. EWS specifically binds to poly G and poly U
          RNA. It also binds to the proximal-element DNA of the
          macrophage-specific promoter of the CSF-1 receptor
          gene. .
          Length = 84

 Score = 26.0 bits (57), Expect = 0.58
 Identities = 10/25 (40%), Positives = 17/25 (68%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          I+V GL+   TLE++ ++F+  G V
Sbjct: 3  IYVQGLNDNVTLEELADFFKHCGVV 27


>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic
          activator RIM4 and similar proteins.  This subfamily
          corresponds to the RRM2 of RIM4, also termed regulator
          of IME2 protein 4, a putative RNA binding protein that
          is expressed at elevated levels early in meiosis. It
          functions as a meiotic activator required for both the
          IME1- and IME2-dependent pathways of meiotic gene
          expression, as well as early events of meiosis, such as
          meiotic division and recombination, in Saccharomyces
          cerevisiae. RIM4 contains two RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). The family also includes a
          putative RNA-binding protein termed multicopy
          suppressor of sporulation protein Msa1. It is a
          putative RNA-binding protein encoded by a novel gene,
          msa1, from the fission yeast Schizosaccharomyces pombe.
          Msa1 may be involved in the inhibition of sexual
          differentiation by controlling the expression of
          Ste11-regulated genes, possibly through the
          pheromone-signaling pathway. Like RIM4, Msa1 also
          contains two RRMs, both of which are essential for the
          function of Msa1. .
          Length = 80

 Score = 26.1 bits (58), Expect = 0.59
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          IFVG LS   T E++   F + G +
Sbjct: 6  IFVGQLSPDVTKEELNERFSRHGKI 30


>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate
          paraspeckle protein 1 (PSP1).  This subgroup
          corresponds to the RRM1 of PSPC1, also termed
          paraspeckle component 1 (PSPC1), a novel nucleolar
          factor that accumulates within a new nucleoplasmic
          compartment, termed paraspeckles, and diffusely
          distributes in the nucleoplasm. It is ubiquitously
          expressed and highly conserved in vertebrates. Its
          cellular function remains unknown currently, however,
          PSPC1 forms a novel heterodimer with the nuclear
          protein p54nrb, also known as non-POU domain-containing
          octamer-binding protein (NonO), which localizes to
          paraspeckles in an RNA-dependent manner. PSPC1 contains
          two conserved RNA recognition motifs (RRMs), also
          termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), at the N-terminus. .
          Length = 71

 Score = 26.0 bits (57), Expect = 0.61
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFG 39
          ++FVG L    T ED K  FE++G
Sbjct: 3  RLFVGNLPTDITEEDFKKLFEKYG 26


>gnl|CDD|240872 cd12426, RRM4_PTBPH3, RNA recognition motif 4 in plant
          polypyrimidine tract-binding protein homolog 3
          (PTBPH3).  This subfamily corresponds to the RRM4 of
          PTBPH3. Although its biological roles remain unclear,
          PTBPH3 shows significant sequence similarity to
          polypyrimidine tract binding protein (PTB) that is an
          important negative regulator of alternative splicing in
          mammalian cells and also functions at several other
          aspects of mRNA metabolism, including mRNA
          localization, stabilization, polyadenylation, and
          translation. Like PTB, PTBPH3 contains four RNA
          recognition motifs (RRM), also known as RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 79

 Score = 25.9 bits (57), Expect = 0.61
 Identities = 11/28 (39%), Positives = 15/28 (53%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          TK I V  L +  T EDV N+  + G +
Sbjct: 7  TKMIHVSNLPSDVTEEDVINHLAEHGVI 34


>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4;
          Provisional.
          Length = 144

 Score = 26.5 bits (58), Expect = 0.65
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          + K+F+GGLS  T    +++ F  FG V
Sbjct: 34 STKLFIGGLSWGTDDASLRDAFAHFGDV 61


>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split
          end) protein family.  This subfamily corresponds to the
          RRM2 domain in the Spen (split end) protein family
          which includes RNA binding motif protein 15 (RBM15),
          putative RNA binding motif protein 15B (RBM15B), and
          similar proteins found in Metazoa. RBM15, also termed
          one-twenty two protein 1 (OTT1), conserved in
          eukaryotes, is a novel mRNA export factor and component
          of the NXF1 pathway. It binds to NXF1 and serves as
          receptor for the RNA export element RTE. It also
          possess mRNA export activity and can facilitate the
          access of DEAD-box protein DBP5 to mRNA at the nuclear
          pore complex (NPC). RNA-binding protein 15B (RBM15B),
          also termed one twenty-two 3 (OTT3), is a paralog of
          RBM15 and therefore has post-transcriptional regulatory
          activity. It is a nuclear protein sharing with RBM15
          the association with the splicing factor compartment
          and the nuclear envelope as well as the binding to mRNA
          export factors NXF1 and Aly/REF. Members in this family
          belong to the Spen (split end) protein family, which
          share a domain architecture comprising of three
          N-terminal RNA recognition motifs (RRMs), also known as
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), and a C-terminal SPOC (Spen paralog and
          ortholog C-terminal) domain. .
          Length = 79

 Score = 25.8 bits (57), Expect = 0.78
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          T+ +FVG L    T E+++  FE++G V
Sbjct: 2  TRTLFVGNLEITITEEELRRAFERYGVV 29


>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces
          cerevisiae nucleolar protein 6 (Nop6) and similar
          proteins.  This subfamily corresponds to the RRM of
          Nop6, also known as Ydl213c, a component of 90S
          pre-ribosomal particles in yeast S. cerevisiae. It is
          enriched in the nucleolus and is required for 40S
          ribosomal subunit biogenesis. Nop6 is a non-essential
          putative RNA-binding protein with two N-terminal
          putative nuclear localisation sequences (NLS-1 and
          NLS-2) and an RNA recognition motif (RRM), also termed
          RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain). It binds to the pre-rRNA early during
          transcription and plays an essential role in pre-rRNA
          processing. .
          Length = 74

 Score = 25.8 bits (57), Expect = 0.81
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVG L   TT ED+  +F+  G  
Sbjct: 3  LFVGNLPYDTTAEDLLAHFKNAGAP 27


>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding
          protein MRN1 and similar proteins.  This subgroup
          corresponds to the RRM4 of MRN1, also termed multicopy
          suppressor of RSC-NHP6 synthetic lethality protein 1,
          or post-transcriptional regulator of 69 kDa, which is a
          RNA-binding protein found in yeast. Although its
          specific biological role remains unclear, MRN1 might be
          involved in translational regulation. Members in this
          family contain four copies of conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain). .
          Length = 79

 Score = 25.9 bits (57), Expect = 0.83
 Identities = 7/30 (23%), Positives = 17/30 (56%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPVYY 43
          ++ +++G +    T E ++N F Q+G +  
Sbjct: 3  SRNVYIGNIDDSLTEEKLRNDFSQYGEIES 32


>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II
          polyadenylate-binding proteins.  This subfamily
          corresponds to the RRM of type II polyadenylate-binding
          proteins (PABPs), including polyadenylate-binding
          protein 2 (PABP-2 or PABPN1), embryonic
          polyadenylate-binding protein 2 (ePABP-2 or PABPN1L)
          and similar proteins. PABPs are highly conserved
          proteins that bind to the poly(A) tail present at the
          3' ends of most eukaryotic mRNAs. They have been
          implicated in the regulation of poly(A) tail length
          during the polyadenylation reaction, translation
          initiation, mRNA stabilization by influencing the rate
          of deadenylation and inhibition of mRNA decapping.
          ePABP-2 is predominantly located in the cytoplasm and
          PABP-2 is located in the nucleus. In contrast to the
          type I PABPs containing four copies of RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), the type II PABPs
          contains a single highly-conserved RRM. This subfamily
          also includes Saccharomyces cerevisiae RBP29 (SGN1,
          YIR001C) gene encoding cytoplasmic mRNA-binding protein
          Rbp29 that binds preferentially to poly(A). Although
          not essential for cell viability, Rbp29 plays a role in
          modulating the expression of cytoplasmic mRNA. Like
          other type II PABPs, Rbp29 contains one RRM only. .
          Length = 73

 Score = 25.3 bits (56), Expect = 0.93
 Identities = 9/25 (36%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          IFVG +   TT E+++ +F+  G +
Sbjct: 2  IFVGNVDYGTTPEELQEHFKSCGTI 26


>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint
           family.  The proteins represented by this model contain
           three RNA recognition motifs (rrm: pfam00076) and have
           been characterized as poly-pyrimidine tract binding
           proteins associated with RNA splicing factors. In the
           case of PUF60 (GP|6176532), in complex with p54, and in
           the presence of U2AF, facilitates association of U2
           snRNP with pre-mRNA.
          Length = 612

 Score = 26.2 bits (57), Expect = 0.99
 Identities = 8/28 (28%), Positives = 15/28 (53%)

Query: 16  KIFVGGLSAPTTLEDVKNYFEQFGPVYY 43
           +I+V  +    +  D+K+ FE FG +  
Sbjct: 206 RIYVASVHPDLSETDIKSVFEAFGEIVK 233


>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar
          protein 4 (Nop4p) and similar proteins.  This subgroup
          corresponds to the RRM1 of Nop4p (also known as
          Nop77p), encoded by YPL043W from Saccharomyces
          cerevisiae. It is an essential nucleolar protein
          involved in processing and maturation of 27S pre-rRNA
          and biogenesis of 60S ribosomal subunits. Nop4p has
          four RNA recognition motifs (RRMs), also termed RBDs
          (RNA binding domains) or RNPs (ribonucleoprotein
          domains). .
          Length = 79

 Score = 25.6 bits (56), Expect = 1.0
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FV  L+   T ED+ ++F    P+
Sbjct: 2  LFVRNLAFSVTQEDLTDFFSDVAPI 26


>gnl|CDD|240674 cd12228, RRM_ENOX, RNA recognition motif (RRM) in the cell
          surface Ecto-NOX disulfide-thiol exchanger (ECTO-NOX or
          ENOX) proteins.  This subgroup corresponds to the
          conserved RNA recognition motif (RRM) in ECTO-NOX
          proteins (also termed ENOX), comprising a family of
          plant and animal NAD(P)H oxidases exhibiting both,
          oxidative and protein disulfide isomerase-like,
          activities. They are growth-related and drive cell
          enlargement, and may play roles in aging and
          neurodegenerative diseases. ENOX proteins function as
          terminal oxidases of plasma membrane electron transport
          (PMET) through catalyzing electron transport from
          plasma membrane quinones to extracellular oxygen,
          forming water as a product. They are also hydroquinone
          oxidases that oxidize externally supplied NADH, hence
          NOX. ENOX proteins harbor a di-copper center that lack
          flavin. ENOX proteins display protein disulfide
          interchange activity that is also possessed by protein
          disulfide isomerase. In contrast to the classic protein
          disulfide isomerases, ENOX proteins lack the double
          CXXC motif. This family includes two ENOX proteins,
          ENOX1 and ENOX2. ENOX1, also termed candidate
          growth-related and time keeping constitutive
          hydroquinone [NADH] oxidase (cCNOX), or cell
          proliferation-inducing gene 38 protein, or Constitutive
          Ecto-NOX (cNOX), is the constitutively expressed cell
          surface NADH (ubiquinone) oxidase that is ubiquitous
          and refractory to drugs. ENOX2, also termed APK1
          antigen, or cytosolic ovarian carcinoma antigen 1, or
          tumor-associated hydroquinone oxidase (tNOX), is a
          cancer-specific variant of ENOX1 and plays a key role
          in cell proliferation and tumor progression. In
          contrast to ENOX1, ENOX2 is drug-responsive and harbors
          a drug binding site to which the cancer-specific
          S-peptide tagged pan-ENOX2 recombinant (scFv) is
          directed. Moreover, ENOX2 is specifically inhibited by
          a variety of quinone site inhibitors that have
          anticancer activity and is unique to the surface of
          cancer cells. ENOX proteins contain many functional
          motifs.
          Length = 84

 Score = 25.4 bits (56), Expect = 1.1
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFG 39
          K +FVGGL    T E ++  FEQ G
Sbjct: 7  KTVFVGGLPENATEEIIREVFEQCG 31


>gnl|CDD|240979 cd12535, RRM_FUS_TAF15, RNA recognition motif in vertebrate fused
          in Ewing's sarcoma protein (FUS), TATA-binding
          protein-associated factor 15 (TAF15) and similar
          proteins.  This subgroup corresponds to the RRM of FUS
          and TAF15. FUS (TLS or Pigpen or hnRNP P2), also termed
          75 kDa DNA-pairing protein (POMp75), or oncoprotein TLS
          (Translocated in liposarcoma), is a member of the FET
          (previously TET) (FUS/TLS, EWS, TAF15) family of RNA-
          and DNA-binding proteins whose expression is altered in
          cancer. It is a multi-functional protein and has been
          implicated in pre-mRNA splicing, chromosome stability,
          cell spreading, and transcription. FUS was originally
          identified in human myxoid and round cell liposarcomas
          as an oncogenic fusion with the stress-induced
          DNA-binding transcription factor CHOP (CCAAT
          enhancer-binding homologous protein) and later as hnRNP
          P2, a component of hnRNP H complex assembled on
          pre-mRNA. It can form ternary complexes with hnRNP A1
          and hnRNP C1/C2. Additional research indicates that FUS
          binds preferentially to GGUG-containing RNAs. In the
          presence of Mg2+, it can bind both single- and
          double-stranded DNA (ssDNA/dsDNA) and promote
          ATP-independent annealing of complementary ssDNA and
          D-loop formation in superhelical dsDNA. FUS has been
          shown to be recruited by single stranded noncoding RNAs
          to the regulatory regions of target genes such as
          cyclin D1, where it represses transcription by
          disrupting complex formation. TAF15 (TAFII68), also
          termed TATA-binding protein-associated factor 2N
          (TAF2N), or RNA-binding protein 56 (RBP56), originally
          identified as a TAF in the general transcription
          initiation TFIID complex, is a novel RNA/ssDNA-binding
          protein with homology to the proto-oncoproteins FUS and
          EWS (also termed EWSR1), belonging to the FET family as
          well. TAF15 likely functions in RNA polymerase II (RNAP
          II) transcription by interacting with TFIID and
          subunits of RNAP II itself. TAF15 is also associated
          with U1 snRNA, chromatin and RNA, in a complex distinct
          from the Sm-containing U1 snRNP that functions in
          splicing. Like other members in the FET family, both
          FUS and TAF15 contain an N-terminal Ser, Gly, Gln and
          Tyr-rich region composed of multiple copies of a
          degenerate hexapeptide repeat motif. The C-terminal
          region consists of a conserved nuclear import and
          retention signal (C-NLS), a C2/C2 zinc-finger motif, a
          conserved RNA recognition motif (RRM), also termed RBD
          (RNA binding domain) or RNP (ribonucleoprotein domain),
          and at least 1 arginine-glycine-glycine (RGG)-repeat
          region. .
          Length = 86

 Score = 25.3 bits (55), Expect = 1.1
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFG 39
          IFV GL    T+E V +YF+Q G
Sbjct: 5  IFVQGLGEDVTIESVADYFKQIG 27


>gnl|CDD|240908 cd12462, RRM_SCAF8, RNA recognition motif in SR-related and
          CTD-associated factor 8 (SCAF8) and similar proteins.
          This subgroup corresponds to the RRM of SCAF8 (also
          termed CDC5L complex-associated protein 7, or
          RNA-binding motif protein 16, or CTD-binding SR-like
          protein RA8), a nuclear matrix protein that interacts
          specifically with a highly serine-phosphorylated form
          of the carboxy-terminal domain (CTD) of the largest
          subunit of RNA polymerase II (pol II). The pol II CTD
          plays a role in coupling transcription and pre-mRNA
          processing. SCAF8 co-localizes primarily with
          transcription sites that are enriched in nuclear matrix
          fraction, which is known to contain proteins involved
          in pre-mRNA processing. Thus, SCAF8 may play a direct
          role in coupling with both, transcription and pre-mRNA
          processing, processes. SCAF8, together with SCAF4,
          represents a new class of SCAFs (SR-like CTD-associated
          factors). They contain a conserved N-terminal
          CTD-interacting domain (CID), an atypical RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), and
          serine/arginine-rich motifs.
          Length = 79

 Score = 25.0 bits (54), Expect = 1.4
 Identities = 9/25 (36%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++VG +    T +D+ N FE+FG +
Sbjct: 5  LWVGQVDKKATQQDLTNLFEEFGQI 29


>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein
          RBM8A, RBM8B nd similar proteins.  This subfamily
          corresponds to the RRM of RBM8, also termed binder of
          OVCA1-1 (BOV-1), or RNA-binding protein Y14, which is
          one of the components of the exon-exon junction complex
          (EJC). It has two isoforms, RBM8A and RBM8B, both of
          which are identical except that RBM8B is 16 amino acids
          shorter at its N-terminus. RBM8, together with other
          EJC components (such as Magoh, Aly/REF, RNPS1, Srm160,
          and Upf3), plays critical roles in postsplicing
          processing, including nuclear export and cytoplasmic
          localization of the mRNA, and the nonsense-mediated
          mRNA decay (NMD) surveillance process. RBM8 binds to
          mRNA 20-24 nucleotides upstream of a spliced exon-exon
          junction. It is also involved in spliced mRNA nuclear
          export, and the process of nonsense-mediated decay of
          mRNAs with premature stop codons. RBM8 forms a specific
          heterodimer complex with the EJC protein Magoh which
          then associates with Aly/REF, RNPS1, DEK, and SRm160 on
          the spliced mRNA, and inhibits ATP turnover by
          eIF4AIII, thereby trapping the EJC core onto RNA. RBM8
          contains an N-terminal putative bipartite nuclear
          localization signal, one RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), in the central region, and
          a C-terminal serine-arginine rich region (SR domain)
          and glycine-arginine rich region (RG domain). .
          Length = 88

 Score = 25.3 bits (56), Expect = 1.5
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          IFV G+      EDV + F +FG +
Sbjct: 9  IFVTGVHEEAQEEDVHDKFAEFGEI 33


>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related
          protein 7 (LARP7) and similar proteins.  This subfamily
          corresponds to the RRM1 of LARP7, also termed La
          ribonucleoprotein domain family member 7, or
          P-TEFb-interaction protein for 7SK stability (PIP7S),
          an oligopyrimidine-binding protein that binds to the
          highly conserved 3'-terminal U-rich stretch (3'
          -UUU-OH) of 7SK RNA. LARP7 is a stable component of the
          7SK small nuclear ribonucleoprotein (7SK snRNP). It
          intimately associates with all the nuclear 7SK and is
          required for 7SK stability. LARP7 also acts as a
          negative transcriptional regulator of cellular and
          viral polymerase II genes, acting by means of the 7SK
          snRNP system. It plays an essential role in the
          inhibition of positive transcription elongation factor
          b (P-TEFb)-dependent transcription, which has been
          linked to the global control of cell growth and
          tumorigenesis. LARP7 contains a La motif (LAM) and an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain), at
          the N-terminal region, which mediates binding to the
          U-rich 3' terminus of 7SK RNA. LARP7 also carries
          another putative RRM domain at its C-terminus. .
          Length = 80

 Score = 25.0 bits (55), Expect = 1.5
 Identities = 10/33 (30%), Positives = 17/33 (51%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRF 49
          ++V  L    T E +K  F ++G V Y +  R+
Sbjct: 2  VYVECLPKNATHEWLKAVFSKYGTVVYVSLPRY 34


>gnl|CDD|240985 cd12541, RRM2_La, RNA recognition motif 2 in La autoantigen (La
          or LARP3) and similar proteins.  This subgroup
          corresponds to the RRM2 of La autoantigen, also termed
          Lupus La protein, or La ribonucleoprotein, or Sjoegren
          syndrome type B antigen (SS-B), a highly abundant
          nuclear phosphoprotein and well conserved in
          eukaryotes. It specifically binds the 3'-terminal
          UUU-OH motif of nascent RNA polymerase III transcripts
          and protects them from exonucleolytic degradation by 3'
          exonucleases. In addition, La can directly facilitate
          the translation and/or metabolism of many UUU-3'
          OH-lacking cellular and viral mRNAs, through binding
          internal RNA sequences within the untranslated regions
          of target mRNAs. La contains an N-terminal La motif
          (LAM), followed by two RNA recognition motifs (RRMs),
          also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains). In addition, it possesses
          a short basic motif (SBM) and a nuclear localization
          signal (NLS) at the C-terminus. .
          Length = 76

 Score = 24.9 bits (55), Expect = 1.8
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 20 GGLSAPTTLEDVKNYFEQFGPVYY 43
           G+   T+ ED+K  FE+FG V +
Sbjct: 7  SGVGEQTSREDLKEAFEEFGEVAW 30


>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in
          serine/arginine-rich splicing factor SRSF2, SRSF8 and
          similar proteins.  This subfamily corresponds to the
          RRM of SRSF2 and SRSF8. SRSF2, also termed protein
          PR264, or splicing component, 35 kDa (splicing factor
          SC35 or SC-35), is a prototypical SR protein that plays
          important roles in the alternative splicing of
          pre-mRNA. It is also involved in transcription
          elongation by directly or indirectly mediating the
          recruitment of elongation factors to the C-terminal
          domain of polymerase II. SRSF2 is exclusively localized
          in the nucleus and is restricted to nuclear processes.
          It contains a single N-terminal RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a C-terminal RS
          domain rich in serine-arginine dipeptides. The RRM is
          responsible for the specific recognition of 5'-SSNG-3'
          (S=C/G) RNA. In the regulation of alternative splicing
          events, it specifically binds to cis-regulatory
          elements on the pre-mRNA. The RS domain modulates SRSF2
          activity through phosphorylation, directly contacts
          RNA, and promotes protein-protein interactions with the
          spliceosome. SRSF8, also termed SRP46 or SFRS2B, is a
          novel mammalian SR splicing factor encoded by a
          PR264/SC35 functional retropseudogene. SRSF8 is
          localized in the nucleus and does not display the same
          activity as PR264/SC35. It functions as an essential
          splicing factor in complementing a HeLa cell S100
          extract deficient in SR proteins. Like SRSF2, SRSF8
          contains a single N-terminal RRM and a C-terminal RS
          domain. .
          Length = 73

 Score = 24.6 bits (54), Expect = 1.8
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 19 VGGLSAPTTLEDVKNYFEQFGPV--YYTACDRF 49
          V  L+  TT +D++  FE++G V   Y   DR+
Sbjct: 3  VDNLTYRTTPDDLRRVFEKYGEVGDVYIPRDRY 35


>gnl|CDD|183702 PRK12723, PRK12723, flagellar biosynthesis regulator FlhF;
           Provisional.
          Length = 388

 Score = 25.2 bits (55), Expect = 1.8
 Identities = 10/24 (41%), Positives = 12/24 (50%)

Query: 22  LSAPTTLEDVKNYFEQFGPVYYTA 45
           +S+ T   DVK  F QF P  Y  
Sbjct: 293 VSSTTKTSDVKEIFHQFSPFSYKT 316


>gnl|CDD|241002 cd12558, RRM3_RBM15B, RNA recognition motif 3 in putative
          RNA-binding protein 15B (RBM15B) from vertebrate.  This
          subgroup corresponds to the RRM3 of RBM15B, also termed
          one twenty-two 3 (OTT3), a paralog of RNA binding motif
          protein 15 (RBM15), also known as One-twenty two
          protein 1 (OTT1). Like RBM15, RBM15B has
          post-transcriptional regulatory activity. It is a
          nuclear protein sharing with RBM15 the association with
          the splicing factor compartment and the nuclear
          envelope as well as the binding to mRNA export factors
          NXF1 and Aly/REF. RBM15B belongs to the Spen (split
          end) protein family, which shares a domain architecture
          comprising of three N-terminal RNA recognition motifs
          (RRMs), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), and a C-terminal SPOC (Spen
          paralog and ortholog C-terminal) domain. .
          Length = 76

 Score = 24.6 bits (53), Expect = 1.9
 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPVY---YTACDRFIF 51
          T +++VGGL   T+L  +   F++FG +    Y   D F +
Sbjct: 2  TTRLWVGGLGPNTSLAALAREFDRFGSIRTIDYVKGDSFAY 42


>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in
          heterogeneous nuclear ribonucleoprotein M (hnRNP M) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of heterogeneous nuclear ribonucleoprotein M
          (hnRNP M), myelin expression factor 2 (MEF-2 or MyEF-2
          or MST156) and similar proteins. hnRNP M is pre-mRNA
          binding protein that may play an important role in the
          pre-mRNA processing. It also preferentially binds to
          poly(G) and poly(U) RNA homopolymers. hnRNP M is able
          to interact with early spliceosomes, further
          influencing splicing patterns of specific pre-mRNAs.
          hnRNP M functions as the receptor of carcinoembryonic
          antigen (CEA) that contains the penta-peptide sequence
          PELPK signaling motif. In addition, hnRNP M and another
          splicing factor Nova-1 work together as dopamine D2
          receptor (D2R) pre-mRNA-binding proteins. They regulate
          alternative splicing of D2R pre-mRNA in an antagonistic
          manner. hnRNP M contains three RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and an unusual
          hexapeptide-repeat region rich in methionine and
          arginine residues (MR repeat motif). MEF-2 is a
          sequence-specific single-stranded DNA (ssDNA) binding
          protein that binds specifically to ssDNA derived from
          the proximal (MB1) element of the myelin basic protein
          (MBP) promoter and represses transcription of the MBP
          gene. MEF-2 shows high sequence homology with hnRNP M.
          It also contains three RRMs, which may be responsible
          for its ssDNA binding activity. .
          Length = 72

 Score = 24.5 bits (54), Expect = 1.9
 Identities = 10/27 (37%), Positives = 14/27 (51%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYY 43
          IFV  L    T +D+K+ F + G V  
Sbjct: 1  IFVRNLPFSVTWQDLKDLFRECGNVLR 27


>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR
          and similar proteins.  This subgroup corresponds to the
          RRM2 of nucleolysin TIAR, also termed TIA-1-related
          protein, a cytotoxic granule-associated RNA-binding
          protein that shows high sequence similarity with 40-kDa
          isoform of T-cell-restricted intracellular antigen-1
          (p40-TIA-1). TIAR is mainly localized in the nucleus of
          hematopoietic and nonhematopoietic cells. It is
          translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. TIAR
          possesses nucleolytic activity against cytolytic
          lymphocyte (CTL) target cells. It can trigger DNA
          fragmentation in permeabilized thymocytes, and thus may
          function as an effector responsible for inducing
          apoptosis. TIAR is composed of three N-terminal, highly
          homologous RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), and a glutamine-rich C-terminal auxiliary
          domain containing a lysosome-targeting motif. It
          interacts with RNAs containing short stretches of
          uridylates and its RRM2 can mediate the specific
          binding to uridylate-rich RNAs. .
          Length = 80

 Score = 24.7 bits (53), Expect = 2.0
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVG LS   T ED+K+ F  FG +
Sbjct: 4  VFVGDLSPEITTEDIKSAFAPFGKI 28


>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like
          family member CELF-1, CELF-2 and similar proteins.
          This subgroup corresponds to the RRM2 of CELF-1 (also
          termed BRUNOL-2, or CUG-BP1, or EDEN-BP), CELF-2 (also
          termed BRUNOL-3, or ETR-3, or CUG-BP2, or NAPOR), both
          of which belong to the CUGBP1 and ETR-3-like factors
          (CELF) or BRUNOL (Bruno-like) family of RNA-binding
          proteins that have been implicated in the regulation of
          pre-mRNA splicing and in the control of mRNA
          translation and deadenylation. CELF-1 is strongly
          expressed in all adult and fetal tissues tested. Human
          CELF-1 is a nuclear and cytoplasmic RNA-binding protein
          that regulates multiple aspects of nuclear and
          cytoplasmic mRNA processing, with implications for
          onset of type 1 myotonic dystrophy (DM1), a
          neuromuscular disease associated with an unstable CUG
          triplet expansion in the 3'-UTR (3'-untranslated
          region) of the DMPK (myotonic dystrophy protein kinase)
          gene; it preferentially targets UGU-rich mRNA elements.
          It has been shown to bind to a Bruno response element,
          a cis-element involved in translational control of
          oskar mRNA in Drosophila, and share sequence similarity
          to Bruno, the Drosophila protein that mediates this
          process. The Xenopus homolog embryo deadenylation
          element-binding protein (EDEN-BP) mediates
          sequence-specific deadenylation of Eg5 mRNA. It binds
          specifically to the EDEN motif in the 3'-untranslated
          regions of maternal mRNAs and targets these mRNAs for
          deadenylation and translational repression. CELF-1
          contains three highly conserved RNA recognition motifs
          (RRMs), also known as RBDs (RNA binding domains) or
          RNPs (ribonucleoprotein domains): two consecutive RRMs
          (RRM1 and RRM2) situated in the N-terminal region
          followed by a linker region and the third RRM (RRM3)
          close to the C-terminus of the protein. The two
          N-terminal RRMs of EDEN-BP are necessary for the
          interaction with EDEN as well as a part of the linker
          region (between RRM2 and RRM3). Oligomerization of
          EDEN-BP is required for specific mRNA deadenylation and
          binding. CELF-2 is expressed in all tissues at some
          level, but highest in brain, heart, and thymus. It has
          been implicated in the regulation of nuclear and
          cytoplasmic RNA processing events, including
          alternative splicing, RNA editing, stability and
          translation. CELF-2 shares high sequence identity with
          CELF-1, but shows different binding specificity; it
          preferentially binds to sequences with UG repeats and
          UGUU motifs. It has been shown to bind to a Bruno
          response element, a cis-element involved in
          translational control of oskar mRNA in Drosophila, and
          share sequence similarity to Bruno, the Drosophila
          protein that mediates this process. It also binds to
          the 3'-UTR of cyclooxygenase-2 messages, affecting both
          translation and mRNA stability, and binds to apoB mRNA,
          regulating its C to U editing. CELF-2 also contains
          three highly conserved RRMs. It binds to RNA via the
          first two RRMs, which are also important for
          localization in the cytoplasm. The splicing activation
          or repression activity of CELF-2 on some specific
          substrates is mediated by RRM1/RRM2. Both, RRM1 and
          RRM2 of CELF-2, can activate cardiac troponin T (cTNT)
          exon 5 inclusion. In addition, CELF-2 possesses a
          typical arginine and lysine-rich nuclear localization
          signal (NLS) in the C-terminus, within RRM3. .
          Length = 81

 Score = 24.6 bits (53), Expect = 2.2
 Identities = 8/27 (29%), Positives = 15/27 (55%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +K+F+G +S      D++  F  FG +
Sbjct: 2  RKLFIGMVSKKCNENDIRVMFSPFGQI 28


>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in
          (U)-binding-splicing factor PUF60 and similar proteins.
           This subfamily corresponds to the RRM2 of PUF60, also
          termed FUSE-binding protein-interacting repressor
          (FBP-interacting repressor or FIR), or Ro-binding
          protein 1 (RoBP1), or Siah-binding protein 1
          (Siah-BP1). PUF60 is an essential splicing factor that
          functions as a poly-U RNA-binding protein required to
          reconstitute splicing in depleted nuclear extracts. Its
          function is enhanced through interaction with U2
          auxiliary factor U2AF65. PUF60 also controls human
          c-myc gene expression by binding and inhibiting the
          transcription factor far upstream sequence element
          (FUSE)-binding-protein (FBP), an activator of c-myc
          promoters. PUF60 contains two central RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a C-terminal
          U2AF (U2 auxiliary factor) homology motifs (UHM) that
          harbors another RRM and binds to tryptophan-containing
          linear peptide motifs (UHM ligand motifs, ULMs) in
          several nuclear proteins. Research indicates that PUF60
          binds FUSE as a dimer, and only the first two RRM
          domains participate in the single-stranded DNA
          recognition. .
          Length = 77

 Score = 24.5 bits (54), Expect = 2.2
 Identities = 8/26 (30%), Positives = 16/26 (61%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +I+V  +    + +D+K+ FE FG +
Sbjct: 2  RIYVASVHPDLSEDDIKSVFEAFGKI 27


>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of
          RNA-binding proteins.  This subfamily corresponds to
          the RRM of FET (previously TET) (FUS/TLS, EWS, TAF15)
          family of RNA-binding proteins. This ubiquitously
          expressed family of similarly structured proteins
          predominantly localizing to the nuclear, includes FUS
          (also known as TLS or Pigpen or hnRNP P2), EWS (also
          known as EWSR1), TAF15 (also known as hTAFII68 or TAF2N
          or RPB56), and Drosophila Cabeza (also known as SARFH).
          The corresponding coding genes of these proteins are
          involved in deleterious genomic rearrangements with
          transcription factor genes in a variety of human
          sarcomas and acute leukemias. All FET proteins interact
          with each other and are therefore likely to be part of
          the very same protein complexes, which suggests a
          general bridging role for FET proteins coupling RNA
          transcription, processing, transport, and DNA repair.
          The FET proteins contain multiple copies of a
          degenerate hexapeptide repeat motif at the N-terminus.
          The C-terminal region consists of a conserved nuclear
          import and retention signal (C-NLS), a putative
          zinc-finger domain, and a conserved RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), which is flanked by 3
          arginine-glycine-glycine (RGG) boxes. FUS and EWS might
          have similar sequence specificity; both bind
          preferentially to GGUG-containing RNAs. FUS has also
          been shown to bind strongly to human telomeric RNA and
          to small low-copy-number RNAs tethered to the promoter
          of cyclin D1. To date, nothing is known about the RNA
          binding specificity of TAF15. .
          Length = 81

 Score = 24.6 bits (54), Expect = 2.3
 Identities = 6/25 (24%), Positives = 11/25 (44%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          I++ GL    T + +   F   G +
Sbjct: 1  IYISGLPDDVTEDSLAELFGGIGII 25


>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family.
          This subfamily corresponds to the RRM of the ist3
          family that includes fungal U2 small nuclear
          ribonucleoprotein (snRNP) component increased sodium
          tolerance protein 3 (ist3), X-linked 2 RNA-binding
          motif proteins (RBMX2) found in Metazoa and plants, and
          similar proteins. Gene IST3 encoding ist3, also termed
          U2 snRNP protein SNU17 (Snu17p), is a novel yeast
          Saccharomyces cerevisiae protein required for the first
          catalytic step of splicing and for progression of
          spliceosome assembly. It binds specifically to the U2
          snRNP and is an intrinsic component of prespliceosomes
          and spliceosomes. Yeast ist3 contains an atypical RNA
          recognition motif (RRM), also termed RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain). In the yeast
          pre-mRNA retention and splicing complex, the atypical
          RRM of ist3 functions as a scaffold that organizes the
          other two constituents, Bud13p (bud site selection 13)
          and Pml1p (pre-mRNA leakage 1). Fission yeast
          Schizosaccharomyces pombe gene cwf29 encoding ist3,
          also termed cell cycle control protein cwf29, is an
          RNA-binding protein complexed with cdc5 protein 29. It
          also contains one RRM. The biological function of RBMX2
          remains unclear. It shows high sequence similarity to
          yeast ist3 protein and harbors one RRM as well. .
          Length = 89

 Score = 24.5 bits (54), Expect = 2.4
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          I++GGL    T  D+   F Q+G +
Sbjct: 12 IYIGGLPYELTEGDILCVFSQYGEI 36


>gnl|CDD|224337 COG1419, FlhF, Flagellar GTP-binding protein [Cell motility and
           secretion].
          Length = 407

 Score = 25.0 bits (55), Expect = 2.5
 Identities = 9/25 (36%), Positives = 11/25 (44%)

Query: 22  LSAPTTLEDVKNYFEQFGPVYYTAC 46
           LSA T  ED+K   +QF        
Sbjct: 319 LSATTKYEDLKEIIKQFSLFPIDGL 343


>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple
          RNA-binding domain-containing protein 1 (MRD1) and
          similar proteins.  This subgroup corresponds to the
          RRM2 of MRD1 which is encoded by a novel yeast gene
          MRD1 (multiple RNA-binding domain). It is
          well-conserved in yeast and its homologs exist in all
          eukaryotes. MRD1 is present in the nucleolus and the
          nucleoplasm. It interacts with the 35 S precursor rRNA
          (pre-rRNA) and U3 small nucleolar RNAs (snoRNAs). It is
          essential for the initial processing at the A0-A2
          cleavage sites in the 35 S pre-rRNA. MRD1 contains 5
          conserved RNA recognition motifs (RRMs), also termed
          RBDs (RNA binding domains) or RNPs (ribonucleoprotein
          domains), which may play an important structural role
          in organizing specific rRNA processing events. .
          Length = 79

 Score = 24.3 bits (53), Expect = 2.5
 Identities = 8/28 (28%), Positives = 15/28 (53%)

Query: 14 TKKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          T ++FV  L      +D++  F +FG +
Sbjct: 2  TGRLFVRNLPYSCKEDDLEKLFSKFGEL 29


>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila
          melanogaster Bruno protein and similar proteins.  This
          subgroup corresponds to the RRM2 of Bruno, a Drosophila
          RNA recognition motif (RRM)-containing protein that
          plays a central role in regulation of Oskar (Osk)
          expression. It mediates repression by binding to
          regulatory Bruno response elements (BREs) in the Osk
          mRNA 3' UTR. The full-length Bruno protein contains
          three RRMs, two located in the N-terminal half of the
          protein and the third near the C-terminus, separated by
          a linker region. .
          Length = 81

 Score = 24.4 bits (53), Expect = 2.7
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +K+FVG LS      DV+  F  FG +
Sbjct: 2  RKLFVGMLSKKCNENDVRIMFAPFGSI 28


>gnl|CDD|240904 cd12458, RRM_AtC3H46_like, RNA recognition motif in Arabidopsis
          thaliana zinc finger CCCH domain-containing protein 46
          (AtC3H46) and similar proteins.  This subfamily
          corresponds to the RRM domain in AtC3H46, a putative
          RNA-binding protein that contains an RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), and a CCCH class of
          zinc finger, typically C-X8-C-X5-C-X3-H. It may possess
          ribonuclease activity. .
          Length = 70

 Score = 24.3 bits (53), Expect = 2.8
 Identities = 11/15 (73%), Positives = 11/15 (73%)

Query: 27 TLEDVKNYFEQFGPV 41
          T EDV  YF QFGPV
Sbjct: 12 TEEDVSEYFGQFGPV 26


>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in
          azoospermia-like (DAZL) proteins.  This subgroup
          corresponds to the RRM of DAZL, also termed
          SPGY-like-autosomal, encoded by the autosomal homolog
          of DAZ gene, DAZL. It is ancestral to the deleted in
          azoospermia (DAZ) protein. DAZL is germ-cell-specific
          RNA-binding protein that contains a RNA recognition
          motif (RRM), also known as RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), and a DAZ motif, a
          protein-protein interaction domain. Although their
          specific biochemical functions remain to be
          investigated, DAZL proteins may interact with
          poly(A)-binding proteins (PABPs), and act as
          translational activators of specific mRNAs during
          gametogenesis. .
          Length = 82

 Score = 24.0 bits (52), Expect = 3.4
 Identities = 7/25 (28%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVGG+       +++++F ++G V
Sbjct: 8  VFVGGIDIRMDETEIRSFFAKYGSV 32


>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in
          granule-associated RNA binding proteins (p40-TIA-1 and
          TIAR), and yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1.  This subfamily corresponds
          to the RRM3 of TIA-1, TIAR, and PUB1. Nucleolysin TIA-1
          isoform p40 (p40-TIA-1 or TIA-1) and nucleolysin
          TIA-1-related protein (TIAR) are granule-associated RNA
          binding proteins involved in inducing apoptosis in
          cytotoxic lymphocyte (CTL) target cells. They share
          high sequence similarity and are expressed in a wide
          variety of cell types. TIA-1 can be phosphorylated by a
          serine/threonine kinase that is activated during
          Fas-mediated apoptosis.TIAR is mainly localized in the
          nucleus of hematopoietic and nonhematopoietic cells. It
          is translocated from the nucleus to the cytoplasm in
          response to exogenous triggers of apoptosis. Both TIA-1
          and TIAR bind specifically to poly(A) but not to
          poly(C) homopolymers. They are composed of three
          N-terminal highly homologous RNA recognition motifs
          (RRMs), also termed RBDs (RNA binding domains) or RNPs
          (ribonucleoprotein domains), and a glutamine-rich
          C-terminal auxiliary domain containing a
          lysosome-targeting motif. TIA-1 and TIAR interact with
          RNAs containing short stretches of uridylates and their
          RRM2 can mediate the specific binding to uridylate-rich
          RNAs. The C-terminal auxiliary domain may be
          responsible for interacting with other proteins. In
          addition, TIA-1 and TIAR share a potential serine
          protease-cleavage site (Phe-Val-Arg) localized at the
          junction between their RNA binding domains and their
          C-terminal auxiliary domains. This subfamily also
          includes a yeast nuclear and cytoplasmic polyadenylated
          RNA-binding protein PUB1, termed ARS consensus-binding
          protein ACBP-60, or poly uridylate-binding protein, or
          poly(U)-binding protein, which has been identified as
          both a heterogeneous nuclear RNA-binding protein
          (hnRNP) and a cytoplasmic mRNA-binding protein (mRNP).
          It may be stably bound to a translationally inactive
          subpopulation of mRNAs within the cytoplasm. PUB1 is
          distributed in both, the nucleus and the cytoplasm, and
          binds to poly(A)+ RNA (mRNA or pre-mRNA). Although it
          is one of the major cellular proteins cross-linked by
          UV light to polyadenylated RNAs in vivo, PUB1 is
          nonessential for cell growth in yeast. PUB1 also binds
          to T-rich single stranded DNA (ssDNA); however, there
          is no strong evidence implicating PUB1 in the mechanism
          of DNA replication. PUB1 contains three RRMs, and a GAR
          motif (glycine and arginine rich stretch) that is
          located between RRM2 and RRM3. .
          Length = 73

 Score = 24.1 bits (53), Expect = 3.5
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          ++VG L    T E+++  F  FG +
Sbjct: 3  VYVGNLPHGLTEEELQRTFSPFGAI 27


>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl
          cis-trans isomerase-like 4 (PPIase) and similar
          proteins.  This subfamily corresponds to the RRM of
          PPIase, also termed cyclophilin-like protein PPIL4, or
          rotamase PPIL4, a novel nuclear RNA-binding protein
          encoded by cyclophilin-like PPIL4 gene. The precise
          role of PPIase remains unclear. PPIase contains a
          conserved N-terminal peptidyl-prolyl cistrans isomerase
          (PPIase) motif, a central RNA recognition motif (RRM),
          also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain), followed by a lysine rich
          domain, and a pair of bipartite nuclear targeting
          sequences (NLS) at the C-terminus.
          Length = 83

 Score = 24.1 bits (53), Expect = 3.5
 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYYTACD 47
          +FV  L+  TT ED++  F +FG +   +C+
Sbjct: 6  LFVCKLNPVTTDEDLEIIFSRFGKI--KSCE 34


>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila
          melanogaster RNA-binding protein cabeza and similar
          proteins.  This subgroup corresponds to the RRM in
          cabeza, also termed P19, or sarcoma-associated
          RNA-binding fly homolog (SARFH). It is a putative
          homolog of human RNA-binding proteins FUS (also termed
          TLS or Pigpen or hnRNP P2), EWS (also termed EWSR1),
          TAF15 (also termed hTAFII68 or TAF2N or RPB56), and
          belongs to the of the FET (previously TET) (FUS/TLS,
          EWS, TAF15) family of RNA- and DNA-binding proteins
          whose expression is altered in cancer. It is a nuclear
          RNA binding protein that may play an important role in
          the regulation of RNA metabolism during fly
          development. Cabeza contains one RNA recognition motif
          (RRM), also termed RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). .
          Length = 83

 Score = 23.9 bits (52), Expect = 4.0
 Identities = 8/23 (34%), Positives = 12/23 (52%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFG 39
          +FV  L   TT +D+  +F   G
Sbjct: 1  VFVSNLPPNTTEQDLAEHFGSIG 23


>gnl|CDD|241067 cd12623, RRM_PPARGC1A, RNA recognition motif in peroxisome
          proliferator-activated receptor gamma coactivator
          1-alpha (PGC-1alpha, or PPARGC-1-alpha) and similar
          proteins.  This subgroup corresponds to the RRM of
          PGC-1alpha, also termed PPARGC-1-alpha, or ligand
          effect modulator 6, a member of a family of
          transcription coactivators that plays a central role in
          the regulation of cellular energy metabolism. As an
          inducible transcription coactivator, PGC-1alpha can
          interact with a broad range of transcription factors
          involved in a wide variety of biological responses,
          such as adaptive thermogenesis, skeletal muscle fiber
          type switching, glucose/fatty acid metabolism, and
          heart development. PGC-1alpha stimulates mitochondrial
          biogenesis and promotes oxidative metabolism. It
          participates in the regulation of both carbohydrate and
          lipid metabolism and plays a role in disorders such as
          obesity, diabetes, and cardiomyopathy. PGC-1alpha is a
          multi-domain protein containing an N-terminal
          activation domain region, a central region involved in
          the interaction with at least a nuclear receptor, and a
          C-terminal domain region. The N-terminal domain region
          consists of three leucine-rich motifs (L1, NR box 2 and
          3), among which the two last are required for
          interaction with nuclear receptors, potential nuclear
          localization signals (NLS), and a proline-rich region
          overlapping a putative repression domain. The
          C-terminus of PGC-1alpha is composed of two
          arginine/serine-rich regions (SR domains), a putative
          dimerization domain, and an RNA recognition motif
          (RRM), also known as RBD (RNA binding domain) or RNP
          (ribonucleoprotein domain). PGC-1alpha could interact
          favorably with single-stranded RNA. .
          Length = 91

 Score = 24.1 bits (52), Expect = 4.1
 Identities = 9/25 (36%), Positives = 16/25 (64%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          I+VG +   TT  ++++ FE FG +
Sbjct: 5  IYVGKIRPDTTRTELRDRFEVFGEI 29


>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage
          stimulation factor subunit 2 (CSTF2), cleavage
          stimulation factor subunit 2 tau variant (CSTF2T) and
          similar proteins.  This subgroup corresponds to the RRM
          domain of CSTF2, its tau variant and eukaryotic
          homologs. CSTF2, also termed cleavage stimulation
          factor 64 kDa subunit (CstF64), is the vertebrate
          conterpart of yeast mRNA 3'-end-processing protein
          RNA15. It is expressed in all somatic tissues and is
          one of three cleavage stimulatory factor (CstF)
          subunits required for polyadenylation. CstF64 contains
          an N-terminal RNA recognition motif (RRM), also known
          as RBD (RNA binding domain) or RNP (ribonucleoprotein
          domain), a CstF77-binding domain, a repeated MEARA
          helical region and a conserved C-terminal domain
          reported to bind the transcription factor PC-4. During
          polyadenylation, CstF interacts with the pre-mRNA
          through the RRM of CstF64 at U- or GU-rich sequences
          within 10 to 30 nucleotides downstream of the cleavage
          site. CSTF2T, also termed tauCstF64, is a paralog of
          the X-linked cleavage stimulation factor CstF64 protein
          that supports polyadenylation in most somatic cells. It
          is expressed during meiosis and subsequent haploid
          differentiation in a more limited set of tissues and
          cell types, largely in meiotic and postmeiotic male
          germ cells, and to a lesser extent in brain. The loss
          of CSTF2T will cause male infertility, as it is
          necessary for spermatogenesis and fertilization.
          Moreover, CSTF2T is required for expression of genes
          involved in morphological differentiation of
          spermatids, as well as for genes having products that
          function during interaction of motile spermatozoa with
          eggs. It promotes germ cell-specific patterns of
          polyadenylation by using its RRM to bind to different
          sequence elements downstream of polyadenylation sites
          than does CstF64. .
          Length = 75

 Score = 23.6 bits (51), Expect = 4.3
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVG +    T E +K+ F + GPV
Sbjct: 1  VFVGNIPYEATEEQLKDIFSEVGPV 25


>gnl|CDD|223353 COG0276, HemH, Protoheme ferro-lyase (ferrochelatase) [Coenzyme
          metabolism].
          Length = 320

 Score = 24.1 bits (53), Expect = 4.5
 Identities = 8/14 (57%), Positives = 10/14 (71%)

Query: 25 PTTLEDVKNYFEQF 38
          P TLEDV+ Y + F
Sbjct: 16 PETLEDVRPYLKNF 29


>gnl|CDD|178174 PLN02560, PLN02560, enoyl-CoA reductase.
          Length = 308

 Score = 24.3 bits (53), Expect = 4.6
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 3/50 (6%)

Query: 9  QMVTRT-KKIFVGGLSAP--TTLEDVKNYFEQFGPVYYTACDRFIFGISP 55
           +V+R+ ++I  GGL  P   T+ D+K    +    YY +  R    + P
Sbjct: 4  TVVSRSGREIIKGGLEVPDSATVADLKKAIHKRKKKYYPSRQRLTLPLPP 53


>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal
          pre-messenger RNA splicing protein 24 (Prp24) and
          similar proteins.  This subfamily corresponds to the
          RRM3 of Prp24, also termed U4/U6
          snRNA-associated-splicing factor PRP24 (U4/U6 snRNP),
          an RNA-binding protein with four well conserved RNA
          recognition motifs (RRMs), also termed RBDs (RNA
          binding domains) or RNPs (ribonucleoprotein domains).
          It facilitates U6 RNA base-pairing with U4 RNA during
          spliceosome assembly. Prp24 specifically binds free U6
          RNA primarily with RRMs 1 and 2 and facilitates pairing
          of U6 RNA bases with U4 RNA bases. Additionally, it may
          also be involved in dissociation of the U4/U6 complex
          during spliceosome activation. .
          Length = 78

 Score = 23.8 bits (52), Expect = 5.1
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 16 KIFVGGLSAPTTLEDVKNYFEQFGPV 41
          +I+V  L      +D++  F +FG V
Sbjct: 2  EIYVRNLDFKLDEDDLRGIFSKFGEV 27


>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar
          protein interacting with the FHA domain of pKI-67
          (NIFK) and similar proteins.  This subgroup corresponds
          to the RRM of NIFK and Nop15p. NIFK, also termed MKI67
          FHA domain-interacting nucleolar phosphoprotein, or
          nucleolar phosphoprotein Nopp34, is a putative
          RNA-binding protein interacting with the forkhead
          associated (FHA) domain of pKi-67 antigen in a
          mitosis-specific and phosphorylation-dependent manner.
          It is nucleolar in interphase but associates with
          condensed mitotic chromosomes. This family also
          includes Saccharomyces cerevisiae YNL110C gene encoding
          ribosome biogenesis protein 15 (Nop15p), also termed
          nucleolar protein 15. Both, NIFK and Nop15p, contain an
          RNA recognition motif (RRM), also termed RBD (RNA
          binding domain) or RNP (ribonucleoprotein domain). .
          Length = 74

 Score = 23.3 bits (51), Expect = 5.2
 Identities = 6/13 (46%), Positives = 9/13 (69%)

Query: 29 EDVKNYFEQFGPV 41
           +++ YF QFG V
Sbjct: 14 PELRKYFSQFGTV 26


>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage
          stimulation factor subunit 2 (CSTF2), yeast ortholog
          mRNA 3'-end-processing protein RNA15 and similar
          proteins.  This subfamily corresponds to the RRM domain
          of CSTF2, its tau variant and eukaryotic homologs.
          CSTF2, also termed cleavage stimulation factor 64 kDa
          subunit (CstF64), is the vertebrate conterpart of yeast
          mRNA 3'-end-processing protein RNA15. It is expressed
          in all somatic tissues and is one of three cleavage
          stimulatory factor (CstF) subunits required for
          polyadenylation. CstF64 contains an N-terminal RNA
          recognition motif (RRM), also known as RBD (RNA binding
          domain) or RNP (ribonucleoprotein domain), a
          CstF77-binding domain, a repeated MEARA helical region
          and a conserved C-terminal domain reported to bind the
          transcription factor PC-4. During polyadenylation, CstF
          interacts with the pre-mRNA through the RRM of CstF64
          at U- or GU-rich sequences within 10 to 30 nucleotides
          downstream of the cleavage site. CSTF2T, also termed
          tauCstF64, is a paralog of the X-linked cleavage
          stimulation factor CstF64 protein that supports
          polyadenylation in most somatic cells. It is expressed
          during meiosis and subsequent haploid differentiation
          in a more limited set of tissues and cell types,
          largely in meiotic and postmeiotic male germ cells, and
          to a lesser extent in brain. The loss of CSTF2T will
          cause male infertility, as it is necessary for
          spermatogenesis and fertilization. Moreover, CSTF2T is
          required for expression of genes involved in
          morphological differentiation of spermatids, as well as
          for genes having products that function during
          interaction of motile spermatozoa with eggs. It
          promotes germ cell-specific patterns of polyadenylation
          by using its RRM to bind to different sequence elements
          downstream of polyadenylation sites than does CstF64.
          The family also includes yeast ortholog mRNA
          3'-end-processing protein RNA15 and similar proteins.
          RNA15 is a core subunit of cleavage factor IA (CFIA),
          an essential transcriptional 3'-end processing factor
          from Saccharomyces cerevisiae. RNA recognition by CFIA
          is mediated by an N-terminal RRM, which is contained in
          the RNA15 subunit of the complex. The RRM of RNA15 has
          a strong preference for GU-rich RNAs, mediated by a
          binding pocket that is entirely conserved in both yeast
          and vertebrate RNA15 orthologs.
          Length = 75

 Score = 23.4 bits (51), Expect = 5.3
 Identities = 9/25 (36%), Positives = 13/25 (52%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVG +    T E +   F + GPV
Sbjct: 1  VFVGNIPYDATEEQLIEIFSEVGPV 25


>gnl|CDD|221277 pfam11863, DUF3383, Protein of unknown function (DUF3383).  This
          family of proteins are functionally uncharacterized.
          This protein is found in bacteria and viruses. Proteins
          in this family are typically between 356 to 501 amino
          acids in length.
          Length = 478

 Score = 24.0 bits (52), Expect = 6.0
 Identities = 10/44 (22%), Positives = 13/44 (29%)

Query: 12 TRTKKIFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISP 55
          T         +   ++ EDV   F    P Y  A   F     P
Sbjct: 29 TSNVIDPKERVREYSSAEDVGADFGTTSPEYKAAAAYFSQSPRP 72


>gnl|CDD|241170 cd12726, RRM2_CPEB2_like, RNA recognition motif 2 found in
          cytoplasmic polyadenylation element-binding protein
          CPEB-2, CPEB-3, CPEB-4 and similar protiens.  This
          subgroup corresponds to the RRM2 of the paralog
          proteins CPEB-2, CPEB-3 and CPEB-4, all well conserved
          in both, vertebrates and invertebrates. Due to the high
          sequence similarity, members in this family may share
          similar expression patterns and functions. CPEB-2 is an
          RNA-binding protein that is abundantly expressed in
          testis and localized in cytoplasm in transfected HeLa
          cells. It preferentially binds to poly(U) RNA oligomers
          and may regulate the translation of stored mRNAs during
          spermiogenesis. Moreover, CPEB-2 impedes target RNA
          translation at elongation; it directly interacts with
          the elongation factor, eEF2, to reduce
          eEF2/ribosome-activated GTP hydrolysis in vitro and
          inhibit peptide elongation of CPEB2-bound RNA in vivo.
          CPEB-3 is a sequence-specific translational regulatory
          protein that regulates translation in a
          polyadenylation-independent manner. It functions as a
          translational repressor that governs the synthesis of
          the AMPA receptor GluR2 through binding GluR2 mRNA. It
          also represses translation of a reporter RNA in
          transfected neurons and stimulates translation in
          response to NMDA. CPEB-4 is an RNA-binding protein that
          mediates meiotic mRNA cytoplasmic polyadenylation and
          translation. It is essential for neuron survival and
          present on the endoplasmic reticulum (ER). It is
          accumulated in the nucleus upon ischemia or the
          depletion of ER calcium. CPEB-4 is overexpressed in a
          large variety of tumors and is associated with many
          mRNAs in cancer cells. All family members contain an
          N-terminal unstructured region, two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains), and a Zn-finger
          motif. In addition, they do have conserved nuclear
          export signals that are not present in CPEB-1. .
          Length = 81

 Score = 23.2 bits (50), Expect = 6.4
 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%)

Query: 15 KKIFVGGLSAPTTLEDVKNYFEQ-FGPVYYTACD 47
          K IFVGG+  P    ++    ++ +G V Y   D
Sbjct: 1  KTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGID 34


>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding
          protein 34 (RBM34) and similar proteins.  This
          subfamily corresponds to the RRM2 of RBM34, a putative
          RNA-binding protein containing two RNA recognition
          motifs (RRMs), also termed RBDs (RNA binding domains)
          or RNPs (ribonucleoprotein domains). Although the
          function of RBM34 remains unclear currently, its RRM
          domains may participate in mRNA processing. RBM34 may
          act as an mRNA processing-related protein. .
          Length = 73

 Score = 23.3 bits (51), Expect = 7.2
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPV 41
          +FVG L      E+++ +FE  G V
Sbjct: 2  VFVGNLPFDIEEEELRKHFEDCGDV 26


>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear
          cap-binding protein subunit 2 (CBP20) and similar
          proteins.  This subfamily corresponds to the RRM of
          CBP20, also termed nuclear cap-binding protein subunit
          2 (NCBP2), or cell proliferation-inducing gene 55
          protein, or NCBP-interacting protein 1 (NIP1). CBP20 is
          the small subunit of the nuclear cap binding complex
          (CBC), which is a conserved eukaryotic heterodimeric
          protein complex binding to 5'-capped polymerase II
          transcripts and plays a central role in the maturation
          of pre-mRNA and uracil-rich small nuclear RNA (U
          snRNA). CBP20 is most likely responsible for the
          binding of capped RNA. It contains an RNA recognition
          motif (RRM), also termed RBD (RNA binding domain) or
          RNP (ribonucleoprotein domain), and interacts with the
          second and third domains of CBP80, the large subunit of
          CBC. .
          Length = 78

 Score = 22.9 bits (50), Expect = 9.4
 Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 5/42 (11%)

Query: 17 IFVGGLSAPTTLEDVKNYFEQFGPVYYTACDRFIFGISPVKN 58
          ++VG LS  TT E +   F + G +      R I G+     
Sbjct: 1  LYVGNLSFYTTEEQIYELFSRCGDI-----KRIIMGLDRFTK 37


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.327    0.142    0.427 

Gapped
Lambda     K      H
   0.267   0.0783    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,115,253
Number of extensions: 215617
Number of successful extensions: 524
Number of sequences better than 10.0: 1
Number of HSP's gapped: 524
Number of HSP's successfully gapped: 147
Length of query: 60
Length of database: 10,937,602
Length adjustment: 31
Effective length of query: 29
Effective length of database: 9,562,628
Effective search space: 277316212
Effective search space used: 277316212
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (24.1 bits)