Query         psy7569
Match_columns 71
No_of_seqs    102 out of 139
Neff          3.7 
Searched_HMMs 46136
Date          Fri Aug 16 21:45:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7569.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7569hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0650|consensus               99.9 1.4E-28 3.1E-33  200.5   3.9   62    9-70    110-171 (733)
  2 PF08145 BOP1NT:  BOP1NT (NUC16  99.8 3.6E-20 7.9E-25  138.2   3.7   42   30-71      1-42  (260)
  3 PF01788 PsbJ:  PsbJ;  InterPro  42.7       8 0.00017   22.2  -0.0   10   19-28      2-11  (40)
  4 PF15407 Spo7_2_N:  Sporulation  39.6      10 0.00022   23.3   0.0   14   21-34     31-44  (67)
  5 PF10711 DUF2513:  Hypothetical  34.7     9.6 0.00021   24.2  -0.6   16   55-70     74-89  (102)
  6 cd08871 START_STARD10-like Lip  33.5      35 0.00076   23.7   2.0   25   46-70      4-28  (222)
  7 PF07872 DUF1659:  Protein of u  32.9      21 0.00045   20.2   0.7   15   35-49     13-27  (47)
  8 cd02850 Cellulase_N_term Cellu  32.6      24 0.00051   21.6   0.9   14   33-46      4-17  (86)
  9 KOG1317|consensus               31.8      18 0.00038   29.7   0.3   16   33-49    437-452 (487)
 10 PF10415 FumaraseC_C:  Fumarase  28.9     7.8 0.00017   22.7  -1.6   14   34-48      7-20  (55)
 11 PF05706 CDKN3:  Cyclin-depende  28.9      20 0.00044   25.7   0.2   31    1-31      1-33  (168)
 12 PF13462 Thioredoxin_4:  Thiore  27.7      54  0.0012   20.5   2.0   21   40-60    142-162 (162)
 13 cd01093 CRIB_PAK_like PAK (p21  27.1      26 0.00055   19.6   0.4   28   30-60      9-37  (46)
 14 smart00285 PBD P21-Rho-binding  26.7      25 0.00055   18.8   0.3   13   33-45     10-22  (36)
 15 COG3981 Predicted acetyltransf  26.3      24 0.00052   25.6   0.2   20   21-40     80-105 (174)
 16 CHL00108 psbJ photosystem II p  25.9      29 0.00062   19.9   0.4   10   19-28      2-11  (40)
 17 COG5217 BIM1 Microtubule-bindi  25.1      30 0.00065   27.5   0.5   38   28-65    105-143 (342)
 18 PF04674 Phi_1:  Phosphate-indu  25.0      25 0.00054   27.0   0.1   31   27-70     17-56  (273)
 19 cd04896 ACT_ACR-like_3 ACT dom  22.9      36 0.00078   21.0   0.5   26   39-64     49-75  (75)
 20 PF00786 PBD:  P21-Rho-binding   22.5      72  0.0016   18.4   1.7   14   32-45     10-23  (59)
 21 PF15540 Toxin_62:  Putative to  22.0      46 0.00099   22.8   0.9   14   32-45     82-95  (113)
 22 smart00818 Amelogenin Amelogen  21.6      25 0.00054   25.5  -0.5   17   26-42     11-32  (165)
 23 PRK09798 antitoxin MazE; Provi  21.5      77  0.0017   19.8   1.8   25   41-65     39-66  (82)
 24 cd00132 CRIB PAK (p21 activate  20.5      47   0.001   18.2   0.6   29   30-60      9-37  (42)
 25 PF02927 CelD_N:  N-terminal ig  20.5      49  0.0011   20.3   0.8   15   33-47     13-27  (91)

No 1  
>KOG0650|consensus
Probab=99.95  E-value=1.4e-28  Score=200.55  Aligned_cols=62  Identities=53%  Similarity=1.057  Sum_probs=59.6

Q ss_pred             CCCCcccccccCcccccccccccCCCcccccCCCCeeccCCCccHHHHHHHhCCCCCCCeeC
Q psy7569           9 SGQLVKSEDIRNTVGNIPMNWYDDLPHLGYDWSGKKIMKPEQSDQLDDFLSKMENPNFWIQA   70 (71)
Q Consensus         9 ~~DssdeE~~~NtiGnVPl~WYdd~~HIGYDidGkkI~K~~~~d~lD~fL~~~ddp~~WrtV   70 (71)
                      ++||||||+++||||||||+|||+++|||||++||||+||+++++||+||++||+|++||+|
T Consensus       110 ~~~sSde~d~rntvgnipl~wYdd~~hIgYD~~gkkI~kp~k~~~ld~fl~~iedp~~Wr~v  171 (733)
T KOG0650|consen  110 EEDSSDEEDTRNTVGNIPLKWYDDEKHIGYDIDGKKITKPAKGDELDSFLAKIEDPDYWRKV  171 (733)
T ss_pred             cccCcchhhhhcccCCcccccccccccccccccccEecCCCccchHHHHHHhhcCcchhccc
Confidence            35788899999999999999999999999999999999999999999999999999999997


No 2  
>PF08145 BOP1NT:  BOP1NT (NUC169) domain;  InterPro: IPR012953 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events. This N-terminal domain is found in BOP1-like WD40 proteins. Bop1 is a nucleolar protein involved in rRNA processing, thereby controlling the cell cycle []. It is required for the maturation of the 25S and 5.8S ribosomal RNAs. It may serve as an essential factor in ribosome formation that coordinates processing of the spacer regions in pre-rRNA. The Pes1-Bop1 complex has several components: BOP1, GRWD1, PES1, ORC6L, and RPL3 and is involved in ribosome biogenesis and altered chromosome segregation. The overexpression of BOP1 increases the percentage of multipolar spindles in human cells. Deregulation of the BOP1 pathway may contribute to colorectal tumourigenesis in humans []. Elevated levels of Bop1 induces Bop1/WDR12 and Bop1/Pes1 subcomplexes and the assembly and integrity of the PeBoW complex is highly sensitive to changes in Bop1 protein levels []. Nop7p-Erb1p-Ytm1p, found in yeast, is potentially the homologous complex of Pes1-Bop1-WDR12 as it is involved in the control of ribosome biogenesis and S phase entry. The integrity of the PeBoW complex is required for ribosome biogenesis and cell proliferation in mammalian cells []. In Giardia, the species specific cytoskeleton protein, beta-giardin, interacts with Bop1 []. ; GO: 0006364 rRNA processing, 0005634 nucleus
Probab=99.79  E-value=3.6e-20  Score=138.24  Aligned_cols=42  Identities=57%  Similarity=1.151  Sum_probs=40.9

Q ss_pred             ccCCCcccccCCCCeeccCCCccHHHHHHHhCCCCCCCeeCC
Q psy7569          30 YDDLPHLGYDWSGKKIMKPEQSDQLDDFLSKMENPNFWIQAP   71 (71)
Q Consensus        30 Ydd~~HIGYDidGkkI~K~~~~d~lD~fL~~~ddp~~WrtV~   71 (71)
                      |++|+|||||++||||+|++++|+||+||+++|||++||||.
T Consensus         1 Ydd~~HIGYDi~GkkI~K~~~~d~LD~fL~~~ddp~~Wrtv~   42 (260)
T PF08145_consen    1 YDDYPHIGYDIDGKKIMKPAKGDALDKFLDSMDDPNYWRTVY   42 (260)
T ss_pred             CCCCCccCcCCCCCEecCCCchhHHHHHHHhccCccCCceeE
Confidence            899999999999999999999999999999999999999983


No 3  
>PF01788 PsbJ:  PsbJ;  InterPro: IPR002682 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbJ found in PSII. PsbJ is one of the most hydrophobic proteins in the thylakoid membrane, and is located in a gene cluster with PsbE, PsbF and PsbL (PsbEFJL). Both PsbJ and PsbL (IPR003372 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbJ cause the light-harvesting antenna to remain detached from the PSII dimers []. In addition, both PsbJ and PsbL are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_J 3ARC_J 3A0B_J 3KZI_J 2AXT_J 3PRQ_J 4FBY_b 3BZ2_J 1S5L_j 3PRR_J ....
Probab=42.70  E-value=8  Score=22.20  Aligned_cols=10  Identities=50%  Similarity=0.780  Sum_probs=5.1

Q ss_pred             cCcccccccc
Q psy7569          19 RNTVGNIPMN   28 (71)
Q Consensus        19 ~NtiGnVPl~   28 (71)
                      .||.|+|||.
T Consensus         2 ~~ttGRIPLW   11 (40)
T PF01788_consen    2 ANTTGRIPLW   11 (40)
T ss_dssp             ---TTSS-HH
T ss_pred             CCCCCcccch
Confidence            4789999984


No 4  
>PF15407 Spo7_2_N:  Sporulation protein family 7
Probab=39.60  E-value=10  Score=23.35  Aligned_cols=14  Identities=36%  Similarity=0.693  Sum_probs=12.1

Q ss_pred             cccccccccccCCC
Q psy7569          21 TVGNIPMNWYDDLP   34 (71)
Q Consensus        21 tiGnVPl~WYdd~~   34 (71)
                      =||-||--||.+..
T Consensus        31 flG~IP~~W~~~~~   44 (67)
T PF15407_consen   31 FLGPIPEIWLQDHR   44 (67)
T ss_pred             EECCCChHHHHcCc
Confidence            48999999999865


No 5  
>PF10711 DUF2513:  Hypothetical protein (DUF2513);  InterPro: IPR019650  The function of this family is not known. 
Probab=34.69  E-value=9.6  Score=24.16  Aligned_cols=16  Identities=25%  Similarity=0.723  Sum_probs=13.7

Q ss_pred             HHHHHhCCCCCCCeeC
Q psy7569          55 DDFLSKMENPNFWIQA   70 (71)
Q Consensus        55 D~fL~~~ddp~~WrtV   70 (71)
                      -+||+++.++.-|+++
T Consensus        74 HdFLd~IRd~~vW~k~   89 (102)
T PF10711_consen   74 HDFLDAIRDDTVWNKT   89 (102)
T ss_pred             HHHHHHhcCchHHHHH
Confidence            3799999999999864


No 6  
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins. This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD10 (also known as CGI-52, PTCP-like, and SDCCAG28). The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD10 binds phophatidylcholine and phosphatidylethanolamine. This protein is widely expressed and is synthesized constitutively in many organs. It may function in the liver in the export of phospholipids into bile. It is concentrated in the sperm flagellum, and may play a role in energy metabolism. In the mammary gland it may participate in the enrichment of lipids in milk, and be a potential marker of differentiation. Its expression is induced in this gland during gestation and lactation. It is overe
Probab=33.51  E-value=35  Score=23.67  Aligned_cols=25  Identities=8%  Similarity=0.305  Sum_probs=21.3

Q ss_pred             ccCCCccHHHHHHHhCCCCCCCeeC
Q psy7569          46 MKPEQSDQLDDFLSKMENPNFWIQA   70 (71)
Q Consensus        46 ~K~~~~d~lD~fL~~~ddp~~WrtV   70 (71)
                      .+|.+..+++.|++-+++++.|..+
T Consensus         4 ~~~~~~~~~~~~~~~~~~~~~W~~~   28 (222)
T cd08871           4 VRLPTDADFEEFKKLCDSTDGWKLK   28 (222)
T ss_pred             ecCCCHHHHHHHHHHhcCCCCcEEE
Confidence            3567889999999999999999864


No 7  
>PF07872 DUF1659:  Protein of unknown function (DUF1659);  InterPro: IPR012454 This family consists of hypothetical bacterial proteins of unknown function
Probab=32.92  E-value=21  Score=20.16  Aligned_cols=15  Identities=40%  Similarity=0.579  Sum_probs=12.8

Q ss_pred             cccccCCCCeeccCC
Q psy7569          35 HLGYDWSGKKIMKPE   49 (71)
Q Consensus        35 HIGYDidGkkI~K~~   49 (71)
                      ..|.|.+|+.|.|..
T Consensus        13 ~~G~d~~Gkpi~k~k   27 (47)
T PF07872_consen   13 QTGVDENGKPIFKTK   27 (47)
T ss_pred             EcccCCCCCEEEEee
Confidence            359999999999984


No 8  
>cd02850 Cellulase_N_term Cellulase N-terminus domain.  Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually catagorized into either exoglucanases which sequentially release sugar units from the cellulose chain and endoglucanases which also attack the chain internally. The N-terminus of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies.  These domains are associated with different types of catalytic domains at  either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions.  Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=32.55  E-value=24  Score=21.62  Aligned_cols=14  Identities=29%  Similarity=0.396  Sum_probs=11.8

Q ss_pred             CCcccccCCCCeec
Q psy7569          33 LPHLGYDWSGKKIM   46 (71)
Q Consensus        33 ~~HIGYDidGkkI~   46 (71)
                      ..||||..++.|+.
T Consensus         4 vNQvGY~~~~~K~A   17 (86)
T cd02850           4 VNQVGYLPNGPKKA   17 (86)
T ss_pred             eecccccCCCCEEE
Confidence            46999999999943


No 9  
>KOG1317|consensus
Probab=31.84  E-value=18  Score=29.69  Aligned_cols=16  Identities=50%  Similarity=0.808  Sum_probs=12.3

Q ss_pred             CCcccccCCCCeeccCC
Q psy7569          33 LPHLGYDWSGKKIMKPE   49 (71)
Q Consensus        33 ~~HIGYDidGkkI~K~~   49 (71)
                      .||||||. --||.|.+
T Consensus       437 NPhIGYD~-aAkiAKtA  452 (487)
T KOG1317|consen  437 NPHIGYDN-AAKIAKTA  452 (487)
T ss_pred             CCccCchh-HHHHHHHH
Confidence            48999997 56777764


No 10 
>PF10415 FumaraseC_C:  Fumarase C C-terminus;  InterPro: IPR018951  Fumarase C catalyses the stereo-specific interconversion of fumarate to L-malate as part of the Krebs cycle. The full-length protein forms a tetramer with visible globular shape. FumaraseC_C is the C-terminal 65 residues referred to as domain 3. The core of the molecule consists of a bundle of 20 alpha-helices from the five-helix bundle of domain 2. The projections from the core of the tetramer are generated from domains 1 and 3 of each subunit []. This entry does not appear to be part of either the active site or the activation site but is helical in structure forming a little bundle. ; GO: 0016829 lyase activity, 0006099 tricarboxylic acid cycle; PDB: 3RRP_A 3OCE_D 3OCF_D 3E04_B 3GTD_A 3R6V_F 3R6Q_F 1J3U_B 1FUR_A 1YFE_A ....
Probab=28.92  E-value=7.8  Score=22.66  Aligned_cols=14  Identities=36%  Similarity=0.693  Sum_probs=9.3

Q ss_pred             CcccccCCCCeeccC
Q psy7569          34 PHLGYDWSGKKIMKP   48 (71)
Q Consensus        34 ~HIGYDidGkkI~K~   48 (71)
                      |||||+. +-+|.|.
T Consensus         7 p~iGYe~-aa~iAk~   20 (55)
T PF10415_consen    7 PYIGYEK-AAEIAKE   20 (55)
T ss_dssp             HHHHHHH-HHHHHHH
T ss_pred             chhccHH-HHHHHHH
Confidence            5889987 5555544


No 11 
>PF05706 CDKN3:  Cyclin-dependent kinase inhibitor 3 (CDKN3);  InterPro: IPR022778  This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species. The cyclin-dependent kinase (Cdk)-associated protein phosphatase (KAP) is a human dual specificity protein phosphatase that dephosphorylates Cdk2 on threonine 160 in a cyclin-dependent manner [], []. This domain is also found in MAP kinase phosphatase and esterases. This entry contains both eukaryotic and bacterial proteins.; GO: 0004721 phosphoprotein phosphatase activity, 0004725 protein tyrosine phosphatase activity; PDB: 1FQ1_A 1FPZ_F.
Probab=28.87  E-value=20  Score=25.67  Aligned_cols=31  Identities=19%  Similarity=0.266  Sum_probs=2.4

Q ss_pred             CceeeeccC--CCCcccccccCccccccccccc
Q psy7569           1 MKLILLMKS--GQLVKSEDIRNTVGNIPMNWYD   31 (71)
Q Consensus         1 ~~~~~~~~~--~DssdeE~~~NtiGnVPl~WYd   31 (71)
                      |||--.|..  .||||||..-.----+.+.|-.
T Consensus         1 ~~~~~~~~~~~~~ss~~~~~~~~~~P~~i~~l~   33 (168)
T PF05706_consen    1 MKPPSAMRTSEFDSSDEEVVEEEQTPIQIDWLP   33 (168)
T ss_dssp             ----------------------BTS----EEEE
T ss_pred             CCCCcccccccCCCCccCcccccCCceeeeeec
Confidence            566655554  5788776543321233344543


No 12 
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=27.72  E-value=54  Score=20.54  Aligned_cols=21  Identities=24%  Similarity=0.534  Sum_probs=17.3

Q ss_pred             CCCCeeccCCCccHHHHHHHh
Q psy7569          40 WSGKKIMKPEQSDQLDDFLSK   60 (71)
Q Consensus        40 idGkkI~K~~~~d~lD~fL~~   60 (71)
                      ++|+++....+.++|.++|++
T Consensus       142 inG~~~~~~~~~~~l~~~Id~  162 (162)
T PF13462_consen  142 INGKYVVGPYTIEELKELIDK  162 (162)
T ss_dssp             ETTCEEETTTSHHHHHHHHHH
T ss_pred             ECCEEeCCCCCHHHHHHHHcC
Confidence            589998888888888888864


No 13 
>cd01093 CRIB_PAK_like PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway. This subgroup of CRIB/PBD-domains is found N-terminal of Serine/Threonine kinase domains in PAK and PAK-like proteins.
Probab=27.08  E-value=26  Score=19.65  Aligned_cols=28  Identities=18%  Similarity=0.458  Sum_probs=17.5

Q ss_pred             ccCCCcccccC-CCCeeccCCCccHHHHHHHh
Q psy7569          30 YDDLPHLGYDW-SGKKIMKPEQSDQLDDFLSK   60 (71)
Q Consensus        30 Ydd~~HIGYDi-dGkkI~K~~~~d~lD~fL~~   60 (71)
                      +.-.-|||||. .|. ..--  ..+..++|.+
T Consensus         9 ~~H~~Hv~~d~~~g~-f~gl--P~eW~~ll~~   37 (46)
T cd01093           9 FKHRVHVGFDPQTGE-FTGL--PEEWQRLLKS   37 (46)
T ss_pred             ceeeeEeeECCCCCc-ccCC--CHHHHHHHHH
Confidence            44567999998 554 3211  3566777765


No 14 
>smart00285 PBD P21-Rho-binding domain. Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB).
Probab=26.72  E-value=25  Score=18.79  Aligned_cols=13  Identities=23%  Similarity=0.603  Sum_probs=8.8

Q ss_pred             CCcccccCCCCee
Q psy7569          33 LPHLGYDWSGKKI   45 (71)
Q Consensus        33 ~~HIGYDidGkkI   45 (71)
                      --|+|||-.+..+
T Consensus        10 ~~HVg~d~~~~~f   22 (36)
T smart00285       10 IAHVGFDGQTGEF   22 (36)
T ss_pred             EEEeeECCCCCcc
Confidence            4599999844443


No 15 
>COG3981 Predicted acetyltransferase [General function prediction only]
Probab=26.25  E-value=24  Score=25.64  Aligned_cols=20  Identities=30%  Similarity=0.390  Sum_probs=15.5

Q ss_pred             cccccccccccC------CCcccccC
Q psy7569          21 TVGNIPMNWYDD------LPHLGYDW   40 (71)
Q Consensus        21 tiGnVPl~WYdd------~~HIGYDi   40 (71)
                      -||-|-+.|.-+      --||||++
T Consensus        80 ivG~i~lRh~Ln~~ll~~gGHIGY~V  105 (174)
T COG3981          80 IVGFINLRHQLNDFLLEEGGHIGYSV  105 (174)
T ss_pred             EEEEEEeeeecchHHHhcCCccccee
Confidence            578888888643      46999998


No 16 
>CHL00108 psbJ photosystem II protein J
Probab=25.94  E-value=29  Score=19.94  Aligned_cols=10  Identities=40%  Similarity=0.727  Sum_probs=7.6

Q ss_pred             cCcccccccc
Q psy7569          19 RNTVGNIPMN   28 (71)
Q Consensus        19 ~NtiGnVPl~   28 (71)
                      .++.|+|||.
T Consensus         2 ~~~tGRiPLW   11 (40)
T CHL00108          2 ADTTGRIPLW   11 (40)
T ss_pred             CCCcccccEE
Confidence            3577999985


No 17 
>COG5217 BIM1 Microtubule-binding protein involved in cell cycle control [Cell division and chromosome partitioning / Cytoskeleton]
Probab=25.06  E-value=30  Score=27.53  Aligned_cols=38  Identities=21%  Similarity=0.637  Sum_probs=29.1

Q ss_pred             ccccCCCcccccCCCCeecc-CCCccHHHHHHHhCCCCC
Q psy7569          28 NWYDDLPHLGYDWSGKKIMK-PEQSDQLDDFLSKMENPN   65 (71)
Q Consensus        28 ~WYdd~~HIGYDidGkkI~K-~~~~d~lD~fL~~~ddp~   65 (71)
                      +|-..++||-||.+-++.-+ |+..-++-+.++....|-
T Consensus       105 hWvr~~~~~~yd~~arr~~r~p~~tr~~~~~~rs~~~p~  143 (342)
T COG5217         105 HWVRNLGHISYDRNARRLGRTPKSTRELIEWIRSLGIPI  143 (342)
T ss_pred             HHHhhCCCCccChhHHhcCCCcchHHHHHhhhhhcCCch
Confidence            79999999999999999888 666555666666555543


No 18 
>PF04674 Phi_1:  Phosphate-induced protein 1 conserved region;  InterPro: IPR006766 This entry represents a family of conserved plant proteins. A conserved region in these proteins was identified in a phosphate-induced protein of unknown function [].
Probab=25.01  E-value=25  Score=27.01  Aligned_cols=31  Identities=26%  Similarity=0.758  Sum_probs=25.6

Q ss_pred             cccccCCCcccccCCCCeeccCCCccHHHHHHHhCCCCC---------CCeeC
Q psy7569          27 MNWYDDLPHLGYDWSGKKIMKPEQSDQLDDFLSKMENPN---------FWIQA   70 (71)
Q Consensus        27 l~WYdd~~HIGYDidGkkI~K~~~~d~lD~fL~~~ddp~---------~WrtV   70 (71)
                      +=||-.+.             |+++..|-.||.++..+.         ||+|+
T Consensus        17 lIWYG~ft-------------p~QkaiI~DFl~SLs~~~~~~~PSVa~WW~t~   56 (273)
T PF04674_consen   17 LIWYGRFT-------------PAQKAIIRDFLRSLSSSAPAPSPSVAQWWKTT   56 (273)
T ss_pred             EEEeeCCC-------------HHHHHHHHHHHHhcCCCCCCCCCChhhhhhhH
Confidence            45887664             667889999999999999         99986


No 19 
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=22.89  E-value=36  Score=21.04  Aligned_cols=26  Identities=35%  Similarity=0.445  Sum_probs=18.2

Q ss_pred             cCCCCeeccCCCccHHHHH-HHhCCCC
Q psy7569          39 DWSGKKIMKPEQSDQLDDF-LSKMENP   64 (71)
Q Consensus        39 DidGkkI~K~~~~d~lD~f-L~~~ddp   64 (71)
                      |.+|+||..+.+..+|.+. ++.++.|
T Consensus        49 ~~~g~kl~d~~~~~~L~~~L~~~l~~~   75 (75)
T cd04896          49 QSDGKKIMDPKKQAALCARLREEMVCP   75 (75)
T ss_pred             eCCCCccCCHHHHHHHHHHHHHHhcCC
Confidence            6889999888777777744 4455544


No 20 
>PF00786 PBD:  P21-Rho-binding domain;  InterPro: IPR000095 The molecular bases of the versatile functions of Rho-like GTPases are still unknown. Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB). The Cdc42/Rac interactive binding (CRIB) region has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway []. In fission yeast pak1+ encodes a protein kinase that interacts with Cdc42p and is involved in the control of cell polarity and mating [].; GO: 0005515 protein binding; PDB: 2OV2_O 1EES_B 2ODB_B 1E0A_B 2QME_I 1F3M_B 3PCS_H 1T84_A 2K42_A 1EJ5_A ....
Probab=22.51  E-value=72  Score=18.43  Aligned_cols=14  Identities=21%  Similarity=0.461  Sum_probs=9.6

Q ss_pred             CCCcccccCCCCee
Q psy7569          32 DLPHLGYDWSGKKI   45 (71)
Q Consensus        32 d~~HIGYDidGkkI   45 (71)
                      ---|||||-+....
T Consensus        10 H~~HVg~d~~~g~~   23 (59)
T PF00786_consen   10 HVAHVGWDPNTGGF   23 (59)
T ss_dssp             EEEEEEEETTTTEE
T ss_pred             ceeeeccCCCcccc
Confidence            34599999965543


No 21 
>PF15540 Toxin_62:  Putative toxin 62
Probab=22.04  E-value=46  Score=22.85  Aligned_cols=14  Identities=50%  Similarity=1.042  Sum_probs=11.6

Q ss_pred             CCCcccccCCCCee
Q psy7569          32 DLPHLGYDWSGKKI   45 (71)
Q Consensus        32 d~~HIGYDidGkkI   45 (71)
                      +-|||||---||+=
T Consensus        82 d~PHiGyQt~GKrg   95 (113)
T PF15540_consen   82 DVPHIGYQTAGKRG   95 (113)
T ss_pred             CCCccccccCCccC
Confidence            67899999988853


No 22 
>smart00818 Amelogenin Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth. They seem to regulate formation of crystallites during the secretory stage of tooth enamel development and are thought to play a major role in the structural organisation and mineralisation of developing enamel. The extracellular matrix of the developing enamel comprises two major classes of protein: the hydrophobic amelogenins and the acidic enamelins. Circular dichroism studies of porcine amelogenin have shown that the protein consists of 3 discrete folding units: the N-terminal region appears to contain beta-strand structures, while the C-terminal region displays characteristics of a random coil conformation. Subsequent studies on the bovine protein have indicated the amelogenin structure to contain a repetitive beta-turn segment and a "beta-spiral" between Gln112 and Leu138, which sequester a (Pro, Leu, Gln) rich region. The beta-spiral offers a probable site for interactions w
Probab=21.55  E-value=25  Score=25.46  Aligned_cols=17  Identities=41%  Similarity=1.161  Sum_probs=13.8

Q ss_pred             ccccccC-----CCcccccCCC
Q psy7569          26 PMNWYDD-----LPHLGYDWSG   42 (71)
Q Consensus        26 Pl~WYdd-----~~HIGYDidG   42 (71)
                      ||+||..     |+--||--=|
T Consensus        11 PlkWyQsm~~~~YpsYGYEPMG   32 (165)
T smart00818       11 PLKWYQSMIRHPYPSYGYEPMG   32 (165)
T ss_pred             hHHHHHHHhcCCCCCcCccccc
Confidence            9999987     8888886544


No 23 
>PRK09798 antitoxin MazE; Provisional
Probab=21.54  E-value=77  Score=19.81  Aligned_cols=25  Identities=24%  Similarity=0.469  Sum_probs=18.2

Q ss_pred             CCCeeccCCCc---cHHHHHHHhCCCCC
Q psy7569          41 SGKKIMKPEQS---DQLDDFLSKMENPN   65 (71)
Q Consensus        41 dGkkI~K~~~~---d~lD~fL~~~ddp~   65 (71)
                      +|+-|.+|.+.   -.|+++|+.++..+
T Consensus        39 ~~~iiI~p~~~~~r~~l~eLla~~~~~~   66 (82)
T PRK09798         39 DGKLIIEPVRKEPVFTLAELVNDITPEN   66 (82)
T ss_pred             CCEEEEEECCCCCCCCHHHHHhcCCCcC
Confidence            57778888643   46999999987543


No 24 
>cd00132 CRIB PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway. CRIB-containing effector proteins are functionally diverse and include serine/threonine kinases, tyrosine kinases, actin-binding proteins, and adapter molecules.
Probab=20.55  E-value=47  Score=18.22  Aligned_cols=29  Identities=17%  Similarity=0.401  Sum_probs=17.4

Q ss_pred             ccCCCcccccCCCCeeccCCCccHHHHHHHh
Q psy7569          30 YDDLPHLGYDWSGKKIMKPEQSDQLDDFLSK   60 (71)
Q Consensus        30 Ydd~~HIGYDidGkkI~K~~~~d~lD~fL~~   60 (71)
                      +.--.|||+|-.|.-...-  ..++..+|..
T Consensus         9 f~H~~HvG~d~~g~~~~~~--p~~w~~l~~~   37 (42)
T cd00132           9 FKHISHVGWDGVGFDGANL--PPDLQSLFQT   37 (42)
T ss_pred             cCcccccCCCCCCccccCC--CHHHHHHHHH
Confidence            4556799999876544111  1256666654


No 25 
>PF02927 CelD_N:  N-terminal ig-like domain of cellulase;  InterPro: IPR004197 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Cellulases (Endoglucanases) 3.2.1.4 from EC catalyse the endohydrolysis of 1,4-beta-D-glucosidic linkages in cellulose. This is the N-terminal ig-like domain of cellulase, enzymes containing this domain belong to family 9 of the glycoside hydrolases (GH9 from CAZY).; GO: 0008810 cellulase activity, 0005975 carbohydrate metabolic process; PDB: 1CLC_A 1WMX_B 2C24_B 1RQ5_A 3K4Z_A 3H7L_B 3RX5_A 3RX8_A 3H2W_A 3RX7_A ....
Probab=20.50  E-value=49  Score=20.33  Aligned_cols=15  Identities=27%  Similarity=0.439  Sum_probs=10.6

Q ss_pred             CCcccccCCCCeecc
Q psy7569          33 LPHLGYDWSGKKIMK   47 (71)
Q Consensus        33 ~~HIGYDidGkkI~K   47 (71)
                      ..||||-.++.|+.-
T Consensus        13 vNQvGY~~~~~K~Av   27 (91)
T PF02927_consen   13 VNQVGYLPDGPKVAV   27 (91)
T ss_dssp             CTSSEEETTS--EEE
T ss_pred             EECCCCCCCCCEEEE
Confidence            579999999998753


Done!