Query psy7569
Match_columns 71
No_of_seqs 102 out of 139
Neff 3.7
Searched_HMMs 46136
Date Fri Aug 16 21:45:54 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy7569.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7569hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG0650|consensus 99.9 1.4E-28 3.1E-33 200.5 3.9 62 9-70 110-171 (733)
2 PF08145 BOP1NT: BOP1NT (NUC16 99.8 3.6E-20 7.9E-25 138.2 3.7 42 30-71 1-42 (260)
3 PF01788 PsbJ: PsbJ; InterPro 42.7 8 0.00017 22.2 -0.0 10 19-28 2-11 (40)
4 PF15407 Spo7_2_N: Sporulation 39.6 10 0.00022 23.3 0.0 14 21-34 31-44 (67)
5 PF10711 DUF2513: Hypothetical 34.7 9.6 0.00021 24.2 -0.6 16 55-70 74-89 (102)
6 cd08871 START_STARD10-like Lip 33.5 35 0.00076 23.7 2.0 25 46-70 4-28 (222)
7 PF07872 DUF1659: Protein of u 32.9 21 0.00045 20.2 0.7 15 35-49 13-27 (47)
8 cd02850 Cellulase_N_term Cellu 32.6 24 0.00051 21.6 0.9 14 33-46 4-17 (86)
9 KOG1317|consensus 31.8 18 0.00038 29.7 0.3 16 33-49 437-452 (487)
10 PF10415 FumaraseC_C: Fumarase 28.9 7.8 0.00017 22.7 -1.6 14 34-48 7-20 (55)
11 PF05706 CDKN3: Cyclin-depende 28.9 20 0.00044 25.7 0.2 31 1-31 1-33 (168)
12 PF13462 Thioredoxin_4: Thiore 27.7 54 0.0012 20.5 2.0 21 40-60 142-162 (162)
13 cd01093 CRIB_PAK_like PAK (p21 27.1 26 0.00055 19.6 0.4 28 30-60 9-37 (46)
14 smart00285 PBD P21-Rho-binding 26.7 25 0.00055 18.8 0.3 13 33-45 10-22 (36)
15 COG3981 Predicted acetyltransf 26.3 24 0.00052 25.6 0.2 20 21-40 80-105 (174)
16 CHL00108 psbJ photosystem II p 25.9 29 0.00062 19.9 0.4 10 19-28 2-11 (40)
17 COG5217 BIM1 Microtubule-bindi 25.1 30 0.00065 27.5 0.5 38 28-65 105-143 (342)
18 PF04674 Phi_1: Phosphate-indu 25.0 25 0.00054 27.0 0.1 31 27-70 17-56 (273)
19 cd04896 ACT_ACR-like_3 ACT dom 22.9 36 0.00078 21.0 0.5 26 39-64 49-75 (75)
20 PF00786 PBD: P21-Rho-binding 22.5 72 0.0016 18.4 1.7 14 32-45 10-23 (59)
21 PF15540 Toxin_62: Putative to 22.0 46 0.00099 22.8 0.9 14 32-45 82-95 (113)
22 smart00818 Amelogenin Amelogen 21.6 25 0.00054 25.5 -0.5 17 26-42 11-32 (165)
23 PRK09798 antitoxin MazE; Provi 21.5 77 0.0017 19.8 1.8 25 41-65 39-66 (82)
24 cd00132 CRIB PAK (p21 activate 20.5 47 0.001 18.2 0.6 29 30-60 9-37 (42)
25 PF02927 CelD_N: N-terminal ig 20.5 49 0.0011 20.3 0.8 15 33-47 13-27 (91)
No 1
>KOG0650|consensus
Probab=99.95 E-value=1.4e-28 Score=200.55 Aligned_cols=62 Identities=53% Similarity=1.057 Sum_probs=59.6
Q ss_pred CCCCcccccccCcccccccccccCCCcccccCCCCeeccCCCccHHHHHHHhCCCCCCCeeC
Q psy7569 9 SGQLVKSEDIRNTVGNIPMNWYDDLPHLGYDWSGKKIMKPEQSDQLDDFLSKMENPNFWIQA 70 (71)
Q Consensus 9 ~~DssdeE~~~NtiGnVPl~WYdd~~HIGYDidGkkI~K~~~~d~lD~fL~~~ddp~~WrtV 70 (71)
++||||||+++||||||||+|||+++|||||++||||+||+++++||+||++||+|++||+|
T Consensus 110 ~~~sSde~d~rntvgnipl~wYdd~~hIgYD~~gkkI~kp~k~~~ld~fl~~iedp~~Wr~v 171 (733)
T KOG0650|consen 110 EEDSSDEEDTRNTVGNIPLKWYDDEKHIGYDIDGKKITKPAKGDELDSFLAKIEDPDYWRKV 171 (733)
T ss_pred cccCcchhhhhcccCCcccccccccccccccccccEecCCCccchHHHHHHhhcCcchhccc
Confidence 35788899999999999999999999999999999999999999999999999999999997
No 2
>PF08145 BOP1NT: BOP1NT (NUC169) domain; InterPro: IPR012953 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide. WD40 repeats usually assume a 7-8 bladed beta-propeller fold, but proteins have been found with 4 to 16 repeated units, which also form a circularised beta-propeller structure. WD-repeat proteins are a large family found in all eukaryotes and are implicated in a variety of functions ranging from signal transduction and transcription regulation to cell cycle control and apoptosis. Repeated WD40 motifs act as a site for protein-protein interaction, and proteins containing WD40 repeats are known to serve as platforms for the assembly of protein complexes or mediators of transient interplay among other proteins. The specificity of the proteins is determined by the sequences outside the repeats themselves. Examples of such complexes are G proteins (beta subunit is a beta-propeller), TAFII transcription factor, and E3 ubiquitin ligase [, ]. In Arabidopsis spp., several WD40-containing proteins act as key regulators of plant-specific developmental events. This N-terminal domain is found in BOP1-like WD40 proteins. Bop1 is a nucleolar protein involved in rRNA processing, thereby controlling the cell cycle []. It is required for the maturation of the 25S and 5.8S ribosomal RNAs. It may serve as an essential factor in ribosome formation that coordinates processing of the spacer regions in pre-rRNA. The Pes1-Bop1 complex has several components: BOP1, GRWD1, PES1, ORC6L, and RPL3 and is involved in ribosome biogenesis and altered chromosome segregation. The overexpression of BOP1 increases the percentage of multipolar spindles in human cells. Deregulation of the BOP1 pathway may contribute to colorectal tumourigenesis in humans []. Elevated levels of Bop1 induces Bop1/WDR12 and Bop1/Pes1 subcomplexes and the assembly and integrity of the PeBoW complex is highly sensitive to changes in Bop1 protein levels []. Nop7p-Erb1p-Ytm1p, found in yeast, is potentially the homologous complex of Pes1-Bop1-WDR12 as it is involved in the control of ribosome biogenesis and S phase entry. The integrity of the PeBoW complex is required for ribosome biogenesis and cell proliferation in mammalian cells []. In Giardia, the species specific cytoskeleton protein, beta-giardin, interacts with Bop1 []. ; GO: 0006364 rRNA processing, 0005634 nucleus
Probab=99.79 E-value=3.6e-20 Score=138.24 Aligned_cols=42 Identities=57% Similarity=1.151 Sum_probs=40.9
Q ss_pred ccCCCcccccCCCCeeccCCCccHHHHHHHhCCCCCCCeeCC
Q psy7569 30 YDDLPHLGYDWSGKKIMKPEQSDQLDDFLSKMENPNFWIQAP 71 (71)
Q Consensus 30 Ydd~~HIGYDidGkkI~K~~~~d~lD~fL~~~ddp~~WrtV~ 71 (71)
|++|+|||||++||||+|++++|+||+||+++|||++||||.
T Consensus 1 Ydd~~HIGYDi~GkkI~K~~~~d~LD~fL~~~ddp~~Wrtv~ 42 (260)
T PF08145_consen 1 YDDYPHIGYDIDGKKIMKPAKGDALDKFLDSMDDPNYWRTVY 42 (260)
T ss_pred CCCCCccCcCCCCCEecCCCchhHHHHHHHhccCccCCceeE
Confidence 899999999999999999999999999999999999999983
No 3
>PF01788 PsbJ: PsbJ; InterPro: IPR002682 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection []. This family represents the low molecular weight transmembrane protein PsbJ found in PSII. PsbJ is one of the most hydrophobic proteins in the thylakoid membrane, and is located in a gene cluster with PsbE, PsbF and PsbL (PsbEFJL). Both PsbJ and PsbL (IPR003372 from INTERPRO) are essential for proper assembly of the OEC. Mutations in PsbJ cause the light-harvesting antenna to remain detached from the PSII dimers []. In addition, both PsbJ and PsbL are involved in the unidirectional flow of electrons, where PsbJ regulates the forward electron flow from D2 (Qa) to the plastoquinone pool, and PsbL prevents the reduction of PSII by back electron flow from plastoquinol protecting PSII from photo-inactivation [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3A0H_J 3ARC_J 3A0B_J 3KZI_J 2AXT_J 3PRQ_J 4FBY_b 3BZ2_J 1S5L_j 3PRR_J ....
Probab=42.70 E-value=8 Score=22.20 Aligned_cols=10 Identities=50% Similarity=0.780 Sum_probs=5.1
Q ss_pred cCcccccccc
Q psy7569 19 RNTVGNIPMN 28 (71)
Q Consensus 19 ~NtiGnVPl~ 28 (71)
.||.|+|||.
T Consensus 2 ~~ttGRIPLW 11 (40)
T PF01788_consen 2 ANTTGRIPLW 11 (40)
T ss_dssp ---TTSS-HH
T ss_pred CCCCCcccch
Confidence 4789999984
No 4
>PF15407 Spo7_2_N: Sporulation protein family 7
Probab=39.60 E-value=10 Score=23.35 Aligned_cols=14 Identities=36% Similarity=0.693 Sum_probs=12.1
Q ss_pred cccccccccccCCC
Q psy7569 21 TVGNIPMNWYDDLP 34 (71)
Q Consensus 21 tiGnVPl~WYdd~~ 34 (71)
=||-||--||.+..
T Consensus 31 flG~IP~~W~~~~~ 44 (67)
T PF15407_consen 31 FLGPIPEIWLQDHR 44 (67)
T ss_pred EECCCChHHHHcCc
Confidence 48999999999865
No 5
>PF10711 DUF2513: Hypothetical protein (DUF2513); InterPro: IPR019650 The function of this family is not known.
Probab=34.69 E-value=9.6 Score=24.16 Aligned_cols=16 Identities=25% Similarity=0.723 Sum_probs=13.7
Q ss_pred HHHHHhCCCCCCCeeC
Q psy7569 55 DDFLSKMENPNFWIQA 70 (71)
Q Consensus 55 D~fL~~~ddp~~WrtV 70 (71)
-+||+++.++.-|+++
T Consensus 74 HdFLd~IRd~~vW~k~ 89 (102)
T PF10711_consen 74 HDFLDAIRDDTVWNKT 89 (102)
T ss_pred HHHHHHhcCchHHHHH
Confidence 3799999999999864
No 6
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins. This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD10 (also known as CGI-52, PTCP-like, and SDCCAG28). The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD10 binds phophatidylcholine and phosphatidylethanolamine. This protein is widely expressed and is synthesized constitutively in many organs. It may function in the liver in the export of phospholipids into bile. It is concentrated in the sperm flagellum, and may play a role in energy metabolism. In the mammary gland it may participate in the enrichment of lipids in milk, and be a potential marker of differentiation. Its expression is induced in this gland during gestation and lactation. It is overe
Probab=33.51 E-value=35 Score=23.67 Aligned_cols=25 Identities=8% Similarity=0.305 Sum_probs=21.3
Q ss_pred ccCCCccHHHHHHHhCCCCCCCeeC
Q psy7569 46 MKPEQSDQLDDFLSKMENPNFWIQA 70 (71)
Q Consensus 46 ~K~~~~d~lD~fL~~~ddp~~WrtV 70 (71)
.+|.+..+++.|++-+++++.|..+
T Consensus 4 ~~~~~~~~~~~~~~~~~~~~~W~~~ 28 (222)
T cd08871 4 VRLPTDADFEEFKKLCDSTDGWKLK 28 (222)
T ss_pred ecCCCHHHHHHHHHHhcCCCCcEEE
Confidence 3567889999999999999999864
No 7
>PF07872 DUF1659: Protein of unknown function (DUF1659); InterPro: IPR012454 This family consists of hypothetical bacterial proteins of unknown function
Probab=32.92 E-value=21 Score=20.16 Aligned_cols=15 Identities=40% Similarity=0.579 Sum_probs=12.8
Q ss_pred cccccCCCCeeccCC
Q psy7569 35 HLGYDWSGKKIMKPE 49 (71)
Q Consensus 35 HIGYDidGkkI~K~~ 49 (71)
..|.|.+|+.|.|..
T Consensus 13 ~~G~d~~Gkpi~k~k 27 (47)
T PF07872_consen 13 QTGVDENGKPIFKTK 27 (47)
T ss_pred EcccCCCCCEEEEee
Confidence 359999999999984
No 8
>cd02850 Cellulase_N_term Cellulase N-terminus domain. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually catagorized into either exoglucanases which sequentially release sugar units from the cellulose chain and endoglucanases which also attack the chain internally. The N-terminus of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase.
Probab=32.55 E-value=24 Score=21.62 Aligned_cols=14 Identities=29% Similarity=0.396 Sum_probs=11.8
Q ss_pred CCcccccCCCCeec
Q psy7569 33 LPHLGYDWSGKKIM 46 (71)
Q Consensus 33 ~~HIGYDidGkkI~ 46 (71)
..||||..++.|+.
T Consensus 4 vNQvGY~~~~~K~A 17 (86)
T cd02850 4 VNQVGYLPNGPKKA 17 (86)
T ss_pred eecccccCCCCEEE
Confidence 46999999999943
No 9
>KOG1317|consensus
Probab=31.84 E-value=18 Score=29.69 Aligned_cols=16 Identities=50% Similarity=0.808 Sum_probs=12.3
Q ss_pred CCcccccCCCCeeccCC
Q psy7569 33 LPHLGYDWSGKKIMKPE 49 (71)
Q Consensus 33 ~~HIGYDidGkkI~K~~ 49 (71)
.||||||. --||.|.+
T Consensus 437 NPhIGYD~-aAkiAKtA 452 (487)
T KOG1317|consen 437 NPHIGYDN-AAKIAKTA 452 (487)
T ss_pred CCccCchh-HHHHHHHH
Confidence 48999997 56777764
No 10
>PF10415 FumaraseC_C: Fumarase C C-terminus; InterPro: IPR018951 Fumarase C catalyses the stereo-specific interconversion of fumarate to L-malate as part of the Krebs cycle. The full-length protein forms a tetramer with visible globular shape. FumaraseC_C is the C-terminal 65 residues referred to as domain 3. The core of the molecule consists of a bundle of 20 alpha-helices from the five-helix bundle of domain 2. The projections from the core of the tetramer are generated from domains 1 and 3 of each subunit []. This entry does not appear to be part of either the active site or the activation site but is helical in structure forming a little bundle. ; GO: 0016829 lyase activity, 0006099 tricarboxylic acid cycle; PDB: 3RRP_A 3OCE_D 3OCF_D 3E04_B 3GTD_A 3R6V_F 3R6Q_F 1J3U_B 1FUR_A 1YFE_A ....
Probab=28.92 E-value=7.8 Score=22.66 Aligned_cols=14 Identities=36% Similarity=0.693 Sum_probs=9.3
Q ss_pred CcccccCCCCeeccC
Q psy7569 34 PHLGYDWSGKKIMKP 48 (71)
Q Consensus 34 ~HIGYDidGkkI~K~ 48 (71)
|||||+. +-+|.|.
T Consensus 7 p~iGYe~-aa~iAk~ 20 (55)
T PF10415_consen 7 PYIGYEK-AAEIAKE 20 (55)
T ss_dssp HHHHHHH-HHHHHHH
T ss_pred chhccHH-HHHHHHH
Confidence 5889987 5555544
No 11
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species. The cyclin-dependent kinase (Cdk)-associated protein phosphatase (KAP) is a human dual specificity protein phosphatase that dephosphorylates Cdk2 on threonine 160 in a cyclin-dependent manner [], []. This domain is also found in MAP kinase phosphatase and esterases. This entry contains both eukaryotic and bacterial proteins.; GO: 0004721 phosphoprotein phosphatase activity, 0004725 protein tyrosine phosphatase activity; PDB: 1FQ1_A 1FPZ_F.
Probab=28.87 E-value=20 Score=25.67 Aligned_cols=31 Identities=19% Similarity=0.266 Sum_probs=2.4
Q ss_pred CceeeeccC--CCCcccccccCccccccccccc
Q psy7569 1 MKLILLMKS--GQLVKSEDIRNTVGNIPMNWYD 31 (71)
Q Consensus 1 ~~~~~~~~~--~DssdeE~~~NtiGnVPl~WYd 31 (71)
|||--.|.. .||||||..-.----+.+.|-.
T Consensus 1 ~~~~~~~~~~~~~ss~~~~~~~~~~P~~i~~l~ 33 (168)
T PF05706_consen 1 MKPPSAMRTSEFDSSDEEVVEEEQTPIQIDWLP 33 (168)
T ss_dssp ----------------------BTS----EEEE
T ss_pred CCCCcccccccCCCCccCcccccCCceeeeeec
Confidence 566655554 5788776543321233344543
No 12
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=27.72 E-value=54 Score=20.54 Aligned_cols=21 Identities=24% Similarity=0.534 Sum_probs=17.3
Q ss_pred CCCCeeccCCCccHHHHHHHh
Q psy7569 40 WSGKKIMKPEQSDQLDDFLSK 60 (71)
Q Consensus 40 idGkkI~K~~~~d~lD~fL~~ 60 (71)
++|+++....+.++|.++|++
T Consensus 142 inG~~~~~~~~~~~l~~~Id~ 162 (162)
T PF13462_consen 142 INGKYVVGPYTIEELKELIDK 162 (162)
T ss_dssp ETTCEEETTTSHHHHHHHHHH
T ss_pred ECCEEeCCCCCHHHHHHHHcC
Confidence 589998888888888888864
No 13
>cd01093 CRIB_PAK_like PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway. This subgroup of CRIB/PBD-domains is found N-terminal of Serine/Threonine kinase domains in PAK and PAK-like proteins.
Probab=27.08 E-value=26 Score=19.65 Aligned_cols=28 Identities=18% Similarity=0.458 Sum_probs=17.5
Q ss_pred ccCCCcccccC-CCCeeccCCCccHHHHHHHh
Q psy7569 30 YDDLPHLGYDW-SGKKIMKPEQSDQLDDFLSK 60 (71)
Q Consensus 30 Ydd~~HIGYDi-dGkkI~K~~~~d~lD~fL~~ 60 (71)
+.-.-|||||. .|. ..-- ..+..++|.+
T Consensus 9 ~~H~~Hv~~d~~~g~-f~gl--P~eW~~ll~~ 37 (46)
T cd01093 9 FKHRVHVGFDPQTGE-FTGL--PEEWQRLLKS 37 (46)
T ss_pred ceeeeEeeECCCCCc-ccCC--CHHHHHHHHH
Confidence 44567999998 554 3211 3566777765
No 14
>smart00285 PBD P21-Rho-binding domain. Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB).
Probab=26.72 E-value=25 Score=18.79 Aligned_cols=13 Identities=23% Similarity=0.603 Sum_probs=8.8
Q ss_pred CCcccccCCCCee
Q psy7569 33 LPHLGYDWSGKKI 45 (71)
Q Consensus 33 ~~HIGYDidGkkI 45 (71)
--|+|||-.+..+
T Consensus 10 ~~HVg~d~~~~~f 22 (36)
T smart00285 10 IAHVGFDGQTGEF 22 (36)
T ss_pred EEEeeECCCCCcc
Confidence 4599999844443
No 15
>COG3981 Predicted acetyltransferase [General function prediction only]
Probab=26.25 E-value=24 Score=25.64 Aligned_cols=20 Identities=30% Similarity=0.390 Sum_probs=15.5
Q ss_pred cccccccccccC------CCcccccC
Q psy7569 21 TVGNIPMNWYDD------LPHLGYDW 40 (71)
Q Consensus 21 tiGnVPl~WYdd------~~HIGYDi 40 (71)
-||-|-+.|.-+ --||||++
T Consensus 80 ivG~i~lRh~Ln~~ll~~gGHIGY~V 105 (174)
T COG3981 80 IVGFINLRHQLNDFLLEEGGHIGYSV 105 (174)
T ss_pred EEEEEEeeeecchHHHhcCCccccee
Confidence 578888888643 46999998
No 16
>CHL00108 psbJ photosystem II protein J
Probab=25.94 E-value=29 Score=19.94 Aligned_cols=10 Identities=40% Similarity=0.727 Sum_probs=7.6
Q ss_pred cCcccccccc
Q psy7569 19 RNTVGNIPMN 28 (71)
Q Consensus 19 ~NtiGnVPl~ 28 (71)
.++.|+|||.
T Consensus 2 ~~~tGRiPLW 11 (40)
T CHL00108 2 ADTTGRIPLW 11 (40)
T ss_pred CCCcccccEE
Confidence 3577999985
No 17
>COG5217 BIM1 Microtubule-binding protein involved in cell cycle control [Cell division and chromosome partitioning / Cytoskeleton]
Probab=25.06 E-value=30 Score=27.53 Aligned_cols=38 Identities=21% Similarity=0.637 Sum_probs=29.1
Q ss_pred ccccCCCcccccCCCCeecc-CCCccHHHHHHHhCCCCC
Q psy7569 28 NWYDDLPHLGYDWSGKKIMK-PEQSDQLDDFLSKMENPN 65 (71)
Q Consensus 28 ~WYdd~~HIGYDidGkkI~K-~~~~d~lD~fL~~~ddp~ 65 (71)
+|-..++||-||.+-++.-+ |+..-++-+.++....|-
T Consensus 105 hWvr~~~~~~yd~~arr~~r~p~~tr~~~~~~rs~~~p~ 143 (342)
T COG5217 105 HWVRNLGHISYDRNARRLGRTPKSTRELIEWIRSLGIPI 143 (342)
T ss_pred HHHhhCCCCccChhHHhcCCCcchHHHHHhhhhhcCCch
Confidence 79999999999999999888 666555666666555543
No 18
>PF04674 Phi_1: Phosphate-induced protein 1 conserved region; InterPro: IPR006766 This entry represents a family of conserved plant proteins. A conserved region in these proteins was identified in a phosphate-induced protein of unknown function [].
Probab=25.01 E-value=25 Score=27.01 Aligned_cols=31 Identities=26% Similarity=0.758 Sum_probs=25.6
Q ss_pred cccccCCCcccccCCCCeeccCCCccHHHHHHHhCCCCC---------CCeeC
Q psy7569 27 MNWYDDLPHLGYDWSGKKIMKPEQSDQLDDFLSKMENPN---------FWIQA 70 (71)
Q Consensus 27 l~WYdd~~HIGYDidGkkI~K~~~~d~lD~fL~~~ddp~---------~WrtV 70 (71)
+=||-.+. |+++..|-.||.++..+. ||+|+
T Consensus 17 lIWYG~ft-------------p~QkaiI~DFl~SLs~~~~~~~PSVa~WW~t~ 56 (273)
T PF04674_consen 17 LIWYGRFT-------------PAQKAIIRDFLRSLSSSAPAPSPSVAQWWKTT 56 (273)
T ss_pred EEEeeCCC-------------HHHHHHHHHHHHhcCCCCCCCCCChhhhhhhH
Confidence 45887664 667889999999999999 99986
No 19
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the third ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) have been described, however, the ACR-like sequences in this CD are distinct from those characterized. This CD includes the Oryza sativa ACR-like protein (Os05g0113000) encoded on chromosome 5 and the Arabidopsis thaliana predicted gene product, At2g39570. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=22.89 E-value=36 Score=21.04 Aligned_cols=26 Identities=35% Similarity=0.445 Sum_probs=18.2
Q ss_pred cCCCCeeccCCCccHHHHH-HHhCCCC
Q psy7569 39 DWSGKKIMKPEQSDQLDDF-LSKMENP 64 (71)
Q Consensus 39 DidGkkI~K~~~~d~lD~f-L~~~ddp 64 (71)
|.+|+||..+.+..+|.+. ++.++.|
T Consensus 49 ~~~g~kl~d~~~~~~L~~~L~~~l~~~ 75 (75)
T cd04896 49 QSDGKKIMDPKKQAALCARLREEMVCP 75 (75)
T ss_pred eCCCCccCCHHHHHHHHHHHHHHhcCC
Confidence 6889999888777777744 4455544
No 20
>PF00786 PBD: P21-Rho-binding domain; InterPro: IPR000095 The molecular bases of the versatile functions of Rho-like GTPases are still unknown. Small domains that bind Cdc42p- and/or Rho-like small GTPases. Also known as the Cdc42/Rac interactive binding (CRIB). The Cdc42/Rac interactive binding (CRIB) region has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway []. In fission yeast pak1+ encodes a protein kinase that interacts with Cdc42p and is involved in the control of cell polarity and mating [].; GO: 0005515 protein binding; PDB: 2OV2_O 1EES_B 2ODB_B 1E0A_B 2QME_I 1F3M_B 3PCS_H 1T84_A 2K42_A 1EJ5_A ....
Probab=22.51 E-value=72 Score=18.43 Aligned_cols=14 Identities=21% Similarity=0.461 Sum_probs=9.6
Q ss_pred CCCcccccCCCCee
Q psy7569 32 DLPHLGYDWSGKKI 45 (71)
Q Consensus 32 d~~HIGYDidGkkI 45 (71)
---|||||-+....
T Consensus 10 H~~HVg~d~~~g~~ 23 (59)
T PF00786_consen 10 HVAHVGWDPNTGGF 23 (59)
T ss_dssp EEEEEEEETTTTEE
T ss_pred ceeeeccCCCcccc
Confidence 34599999965543
No 21
>PF15540 Toxin_62: Putative toxin 62
Probab=22.04 E-value=46 Score=22.85 Aligned_cols=14 Identities=50% Similarity=1.042 Sum_probs=11.6
Q ss_pred CCCcccccCCCCee
Q psy7569 32 DLPHLGYDWSGKKI 45 (71)
Q Consensus 32 d~~HIGYDidGkkI 45 (71)
+-|||||---||+=
T Consensus 82 d~PHiGyQt~GKrg 95 (113)
T PF15540_consen 82 DVPHIGYQTAGKRG 95 (113)
T ss_pred CCCccccccCCccC
Confidence 67899999988853
No 22
>smart00818 Amelogenin Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth. They seem to regulate formation of crystallites during the secretory stage of tooth enamel development and are thought to play a major role in the structural organisation and mineralisation of developing enamel. The extracellular matrix of the developing enamel comprises two major classes of protein: the hydrophobic amelogenins and the acidic enamelins. Circular dichroism studies of porcine amelogenin have shown that the protein consists of 3 discrete folding units: the N-terminal region appears to contain beta-strand structures, while the C-terminal region displays characteristics of a random coil conformation. Subsequent studies on the bovine protein have indicated the amelogenin structure to contain a repetitive beta-turn segment and a "beta-spiral" between Gln112 and Leu138, which sequester a (Pro, Leu, Gln) rich region. The beta-spiral offers a probable site for interactions w
Probab=21.55 E-value=25 Score=25.46 Aligned_cols=17 Identities=41% Similarity=1.161 Sum_probs=13.8
Q ss_pred ccccccC-----CCcccccCCC
Q psy7569 26 PMNWYDD-----LPHLGYDWSG 42 (71)
Q Consensus 26 Pl~WYdd-----~~HIGYDidG 42 (71)
||+||.. |+--||--=|
T Consensus 11 PlkWyQsm~~~~YpsYGYEPMG 32 (165)
T smart00818 11 PLKWYQSMIRHPYPSYGYEPMG 32 (165)
T ss_pred hHHHHHHHhcCCCCCcCccccc
Confidence 9999987 8888886544
No 23
>PRK09798 antitoxin MazE; Provisional
Probab=21.54 E-value=77 Score=19.81 Aligned_cols=25 Identities=24% Similarity=0.469 Sum_probs=18.2
Q ss_pred CCCeeccCCCc---cHHHHHHHhCCCCC
Q psy7569 41 SGKKIMKPEQS---DQLDDFLSKMENPN 65 (71)
Q Consensus 41 dGkkI~K~~~~---d~lD~fL~~~ddp~ 65 (71)
+|+-|.+|.+. -.|+++|+.++..+
T Consensus 39 ~~~iiI~p~~~~~r~~l~eLla~~~~~~ 66 (82)
T PRK09798 39 DGKLIIEPVRKEPVFTLAELVNDITPEN 66 (82)
T ss_pred CCEEEEEECCCCCCCCHHHHHhcCCCcC
Confidence 57778888643 46999999987543
No 24
>cd00132 CRIB PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway. CRIB-containing effector proteins are functionally diverse and include serine/threonine kinases, tyrosine kinases, actin-binding proteins, and adapter molecules.
Probab=20.55 E-value=47 Score=18.22 Aligned_cols=29 Identities=17% Similarity=0.401 Sum_probs=17.4
Q ss_pred ccCCCcccccCCCCeeccCCCccHHHHHHHh
Q psy7569 30 YDDLPHLGYDWSGKKIMKPEQSDQLDDFLSK 60 (71)
Q Consensus 30 Ydd~~HIGYDidGkkI~K~~~~d~lD~fL~~ 60 (71)
+.--.|||+|-.|.-...- ..++..+|..
T Consensus 9 f~H~~HvG~d~~g~~~~~~--p~~w~~l~~~ 37 (42)
T cd00132 9 FKHISHVGWDGVGFDGANL--PPDLQSLFQT 37 (42)
T ss_pred cCcccccCCCCCCccccCC--CHHHHHHHHH
Confidence 4556799999876544111 1256666654
No 25
>PF02927 CelD_N: N-terminal ig-like domain of cellulase; InterPro: IPR004197 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Cellulases (Endoglucanases) 3.2.1.4 from EC catalyse the endohydrolysis of 1,4-beta-D-glucosidic linkages in cellulose. This is the N-terminal ig-like domain of cellulase, enzymes containing this domain belong to family 9 of the glycoside hydrolases (GH9 from CAZY).; GO: 0008810 cellulase activity, 0005975 carbohydrate metabolic process; PDB: 1CLC_A 1WMX_B 2C24_B 1RQ5_A 3K4Z_A 3H7L_B 3RX5_A 3RX8_A 3H2W_A 3RX7_A ....
Probab=20.50 E-value=49 Score=20.33 Aligned_cols=15 Identities=27% Similarity=0.439 Sum_probs=10.6
Q ss_pred CCcccccCCCCeecc
Q psy7569 33 LPHLGYDWSGKKIMK 47 (71)
Q Consensus 33 ~~HIGYDidGkkI~K 47 (71)
..||||-.++.|+.-
T Consensus 13 vNQvGY~~~~~K~Av 27 (91)
T PF02927_consen 13 VNQVGYLPDGPKVAV 27 (91)
T ss_dssp CTSSEEETTS--EEE
T ss_pred EECCCCCCCCCEEEE
Confidence 579999999998753
Done!