Query         psy7580
Match_columns 133
No_of_seqs    143 out of 1338
Neff          7.2 
Searched_HMMs 46136
Date          Fri Aug 16 22:04:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7580.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7580hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2413|consensus               99.7 2.1E-17 4.6E-22  139.4   6.7  104    8-119   156-269 (606)
  2 KOG2413|consensus               99.3 1.6E-12 3.5E-17  110.1   2.0   65    1-74    204-268 (606)
  3 PF01321 Creatinase_N:  Creatin  91.4     0.2 4.2E-06   33.9   2.7   92   37-131     3-105 (132)
  4 PF09162 Tap-RNA_bind:  Tap, RN  56.4      11 0.00025   24.9   2.3   25    8-35     32-56  (88)
  5 PF08955 BofC_C:  BofC C-termin  54.7     8.2 0.00018   24.8   1.4   35   81-118    40-74  (75)
  6 KOG3451|consensus               44.8      19 0.00041   22.8   1.9   22   22-44     37-58  (71)
  7 PRK09795 aminopeptidase; Provi  43.6      67  0.0015   25.9   5.5   55   34-95      3-64  (361)
  8 PF06331 Tbf5:  Transcription f  33.9      44 0.00096   21.0   2.3   23   22-45     35-57  (68)
  9 PF02512 UK:  Virulence determi  33.3      22 0.00047   23.3   0.9    9    5-13     61-70  (96)
 10 KOG2648|consensus               32.7      26 0.00055   29.9   1.4   17  117-133   374-390 (453)
 11 PF00543 P-II:  Nitrogen regula  32.1      50  0.0011   21.7   2.5   31   27-58      2-33  (102)
 12 PF09902 DUF2129:  Uncharacteri  25.3      47   0.001   21.1   1.4   22   23-45     30-51  (71)
 13 PRK14464 ribosomal RNA large s  24.0      55  0.0012   26.9   1.9   27   33-60    293-319 (344)
 14 PRK14461 ribosomal RNA large s  23.1      52  0.0011   27.4   1.6   45    8-61    311-355 (371)
 15 COG0820 Predicted Fe-S-cluster  21.8      54  0.0012   27.1   1.4    8    9-16    290-297 (349)
 16 PF05456 eIF_4EBP:  Eukaryotic   21.7      21 0.00046   24.8  -0.8   14    1-14     55-68  (116)
 17 PF02244 Propep_M14:  Carboxype  20.9      97  0.0021   18.7   2.2   28   23-51     33-60  (74)

No 1  
>KOG2413|consensus
Probab=99.70  E-value=2.1e-17  Score=139.36  Aligned_cols=104  Identities=38%  Similarity=0.715  Sum_probs=98.6

Q ss_pred             CCCCCceeeeeEEEeCCceeeeecCCcchHHHHHHhhhCCCCee----------eeccccCCcCCCchhhhhhhhccCce
Q psy7580           8 DIPYNPVFFSYLIITNTDVHLFIPESKMSADIQNHFKSENCPIN----------MLNLRGADIPYNPVFFSYLIITNNDV   77 (133)
Q Consensus         8 Dip~nPv~~sy~~~~~~sv~Lfid~~Ki~~~v~~~L~~~~~~~~----------LlNlRg~Di~y~PV~~s~~il~~~~~   77 (133)
                      ..|.+||......++|.++     ..|+ ..+|+.|+..+++++          |+||||+|+|||||+++|++++.+++
T Consensus       156 ~~~~~~v~~l~~~~~G~~~-----~~Kv-~~LR~~l~~~~~~a~Vvs~LdeIaWllNLRGsDipynPv~~sY~~it~dei  229 (606)
T KOG2413|consen  156 ERPGNPVIVLDLEFAGLSV-----DDKV-DNLRKKLKEKKCDAFVVTALDEIAWLLNLRGSDIPYNPVFYSYAIITMDEI  229 (606)
T ss_pred             ccCCCceEEeeccccCcch-----hHHH-HHHHHHHhhcCCcEEehhhHHHHHHHHhcccCcCCCCchhhhhhhhhhhhh
Confidence            4689999999999999999     9999 999999999999988          99999999999999999999999999


Q ss_pred             EEEEeCCCCcHHHHHHhcCCCCCeEEechhhHHHHHHhhhcC
Q psy7580          78 HLFIPESKMSADIQNHFNSENCPISIHPYDAIQSFLSELENL  119 (133)
Q Consensus        78 ~lfid~~k~~~~~~~~l~~~~~~v~i~~y~~~~~~l~~~~~~  119 (133)
                      .+|+|.+|++.+..+|+. ..+ |+|+||+++...++.+.+.
T Consensus       230 ~lfvd~~k~~~~~~~~~~-~~~-v~i~pY~~i~~~i~~~~~~  269 (606)
T KOG2413|consen  230 FLFVDNSKLSDESKKHLR-EDG-VEIRPYDQIWSDIKNWASA  269 (606)
T ss_pred             heeecCcccCchhHHHHh-hCc-eeeeeHHHHHHHHHHHhcc
Confidence            999999999999999998 677 9999999999999999754


No 2  
>KOG2413|consensus
Probab=99.26  E-value=1.6e-12  Score=110.11  Aligned_cols=65  Identities=42%  Similarity=0.831  Sum_probs=56.4

Q ss_pred             CcccCCCCCCCCceeeeeEEEeCCceeeeecCCcchHHHHHHhhhCCCCeeeeccccCCcCCCchhhhhhhhcc
Q psy7580           1 MLNLRGADIPYNPVFFSYLIITNTDVHLFIPESKMSADIQNHFKSENCPINMLNLRGADIPYNPVFFSYLIITN   74 (133)
Q Consensus         1 llNiRG~Dip~nPv~~sy~~~~~~sv~Lfid~~Ki~~~v~~~L~~~~~~~~LlNlRg~Di~y~PV~~s~~il~~   74 (133)
                      ||||||+||||||||+||++++.+++.||+|.+|++.+..++++..+++..         ||..+....+-+..
T Consensus       204 llNLRGsDipynPv~~sY~~it~dei~lfvd~~k~~~~~~~~~~~~~v~i~---------pY~~i~~~i~~~~~  268 (606)
T KOG2413|consen  204 LLNLRGSDIPYNPVFYSYAIITMDEIFLFVDNSKLSDESKKHLREDGVEIR---------PYDQIWSDIKNWAS  268 (606)
T ss_pred             HHhcccCcCCCCchhhhhhhhhhhhhheeecCcccCchhHHHHhhCceeee---------eHHHHHHHHHHHhc
Confidence            689999999999999999999999999999999999999999987777766         66666666555543


No 3  
>PF01321 Creatinase_N:  Creatinase/Prolidase N-terminal domain;  InterPro: IPR000587 Creatinase or creatine amidinohydrolase (3.5.3.3 from EC) catalyses the conversion of creatine and water to sarcosine and urea. The enzyme works as a homodimer, and is induced by choline chloride. Each monomer of creatinase has two clearly defined domains, a small N-terminal domain, and a large C-terminal domain. The structure of the C-terminal region represents the "pita-bread" fold. The fold contains both alpha helices and an anti-parallel beta sheet within two structurally similar domains that are thought to be derived from an ancient gene duplication. The active site, where conserved, is located between the two domains. The fold is common to methionine aminopeptidase (3.4.11.18 from EC), aminopeptidase P (3.4.11.9 from EC), prolidase (3.4.13.9 from EC), agropine synthase and creatinase (3.5.3.3 from EC). Though many of these peptidases require a divalent cation, creatinase is not a metal-dependent enzyme [, , ]. ; GO: 0016787 hydrolase activity; PDB: 1PV9_A 3CTZ_A 3IL0_B 3PN9_A 2HOW_A 1WN1_B 3I7M_A 1CHM_B 3QOC_D 1KP0_B ....
Probab=91.42  E-value=0.2  Score=33.88  Aligned_cols=92  Identities=17%  Similarity=0.262  Sum_probs=50.9

Q ss_pred             HHHHHHhhhCCCCeeee----ccc---cCCcCCCchhhhhhh-hccCceEEEEeCCCCcHHHHHHhcCCCCCeEEec-hh
Q psy7580          37 ADIQNHFKSENCPINML----NLR---GADIPYNPVFFSYLI-ITNNDVHLFIPESKMSADIQNHFNSENCPISIHP-YD  107 (133)
Q Consensus        37 ~~v~~~L~~~~~~~~Ll----NlR---g~Di~y~PV~~s~~i-l~~~~~~lfid~~k~~~~~~~~l~~~~~~v~i~~-y~  107 (133)
                      +++++.|++.+++++++    |++   |..  +.+..-.+++ ++.++..+|++.........+.....+- +...+ ++
T Consensus         3 ~rl~~~m~~~gid~lll~~~~ni~YltG~~--~~~~~~~~~l~i~~~~~~l~~~~~~~~~~~~~~~~~~~v-~~~~~~~~   79 (132)
T PF01321_consen    3 ERLRAAMAEAGIDALLLTSPENIRYLTGFR--WQPGERPVLLVITADGAVLFVPKGEYERAAEESAPDDEV-VEYEDPYE   79 (132)
T ss_dssp             HHHHHHHHHTT-SEEEEESHHHHHHHHS----ST-TSSEEEEEEESSSEEEEEEGGGHHHHHHHHTTSSEE-EEESTHHH
T ss_pred             HHHHHHHHHCCCCEEEEcChhhceEecCCC--cCCCcceEEEEecccCcEEEeccccHHHHHHhhcCCceE-EEEecccc
Confidence            78999999999998822    222   332  2222222334 5666668888745444333333110122 33333 66


Q ss_pred             hHHHHHHhhh--cCcEEEeecccccc
Q psy7580         108 AIQSFLSELE--NLIHFYSTWDFPMD  131 (133)
Q Consensus       108 ~~~~~l~~~~--~~~~~~~~~~~~~~  131 (133)
                      ++.+.|++..  .+.+-+|...+|..
T Consensus        80 ~~~~~l~~~~~~~~~igve~~~~~~~  105 (132)
T PF01321_consen   80 AIAEALKKLGPEGKRIGVEPDSLSAA  105 (132)
T ss_dssp             HHHHHHHHHTTTTSEEEEETTTSBHH
T ss_pred             hHHHHHHHhCCCCCEEEEcCCcChHH
Confidence            7788888774  47778887666543


No 4  
>PF09162 Tap-RNA_bind:  Tap, RNA-binding;  InterPro: IPR015245 This domain adopts a structure consisting of an alpha+beta sandwich with an antiparallel beta-sheet, arranged in a 2(beta-alpha-beta) motif. It is mainly found in mRNA export factors, which mediate the sequence nonspecific nuclear export of cellular mRNAs as well as the sequence-specific export of retroviral mRNAs bearing the constitutive transport element []. ; GO: 0003723 RNA binding, 0006406 mRNA export from nucleus, 0005634 nucleus, 0005737 cytoplasm; PDB: 1FT8_A 1KOH_C 1KOO_C 3RW6_B 3RW7_C 1FO1_A.
Probab=56.37  E-value=11  Score=24.89  Aligned_cols=25  Identities=24%  Similarity=0.697  Sum_probs=17.0

Q ss_pred             CCCCCceeeeeEEEeCCceeeeecCCcc
Q psy7580           8 DIPYNPVFFSYLIITNTDVHLFIPESKM   35 (133)
Q Consensus         8 Dip~nPv~~sy~~~~~~sv~Lfid~~Ki   35 (133)
                      .+|++|+..+|.   +..+..||+..+.
T Consensus        32 ~v~F~Pv~fh~~---~~~a~FfV~D~~t   56 (88)
T PF09162_consen   32 SVPFTPVDFHYE---KNRAQFFVEDAST   56 (88)
T ss_dssp             SS----EEEEEE---TTEEEEEESSHHH
T ss_pred             CCCeeeeeeeee---CCEEEEEeCCHHH
Confidence            578999887775   7799999987766


No 5  
>PF08955 BofC_C:  BofC C-terminal domain;  InterPro: IPR015050 The C-terminal domain of the bacterial protein, bypass of forespore C (BofC), contains a three-stranded beta-sheet and three alpha-helices. The exact function is unknown []. ; PDB: 2BW2_A.
Probab=54.68  E-value=8.2  Score=24.84  Aligned_cols=35  Identities=14%  Similarity=0.290  Sum_probs=22.8

Q ss_pred             EeCCCCcHHHHHHhcCCCCCeEEechhhHHHHHHhhhc
Q psy7580          81 IPESKMSADIQNHFNSENCPISIHPYDAIQSFLSELEN  118 (133)
Q Consensus        81 id~~k~~~~~~~~l~~~~~~v~i~~y~~~~~~l~~~~~  118 (133)
                      +|..++.....++|.  +| |+|.+-+++.+.|+.+.+
T Consensus        40 Idv~~Les~~~~~L~--~G-IrV~~~~ey~~vLe~~~~   74 (75)
T PF08955_consen   40 IDVEKLESSDHDQLK--RG-IRVRSKEEYNSVLETFKE   74 (75)
T ss_dssp             --TTTS-HHHHHHHH--H---S---HHHHHHHHHHHHH
T ss_pred             cCHHHcCHhHHHHHh--CC-CeeCCHHHHHHHHHhhcC
Confidence            578888888999997  78 999999999998887653


No 6  
>KOG3451|consensus
Probab=44.76  E-value=19  Score=22.76  Aligned_cols=22  Identities=27%  Similarity=0.471  Sum_probs=18.6

Q ss_pred             eCCceeeeecCCcchHHHHHHhh
Q psy7580          22 TNTDVHLFIPESKMSADIQNHFK   44 (133)
Q Consensus        22 ~~~sv~Lfid~~Ki~~~v~~~L~   44 (133)
                      ..++.+|||++++. +-++.++.
T Consensus        37 eLDdthLfV~p~~v-emvk~~le   58 (71)
T KOG3451|consen   37 ELDDTHLFVNPSIV-EMVKNELE   58 (71)
T ss_pred             EeccceeeecHHHH-HHHHHHHH
Confidence            37899999999998 88887775


No 7  
>PRK09795 aminopeptidase; Provisional
Probab=43.55  E-value=67  Score=25.91  Aligned_cols=55  Identities=16%  Similarity=0.369  Sum_probs=32.0

Q ss_pred             cchHHHHHHhhhCCCCee----eec---cccCCcCCCchhhhhhhhccCceEEEEeCCCCcHHHHHHhc
Q psy7580          34 KMSADIQNHFKSENCPIN----MLN---LRGADIPYNPVFFSYLIITNNDVHLFIPESKMSADIQNHFN   95 (133)
Q Consensus        34 Ki~~~v~~~L~~~~~~~~----LlN---lRg~Di~y~PV~~s~~il~~~~~~lfid~~k~~~~~~~~l~   95 (133)
                      ++ +++++.|++++++++    -.|   +.|-.-  ++   .+++++.++..+|+|. +...+..+...
T Consensus         3 Rl-~~l~~~m~~~~lDa~lI~~~~n~~YLTGf~g--~~---g~llIt~~~~~l~td~-ry~~qa~~~~~   64 (361)
T PRK09795          3 LL-ASLRDWLKAQQLDAVLLSSRQNKQPHLGIST--GS---GYVVISRESAHILVDS-RYYADVEARAQ   64 (361)
T ss_pred             HH-HHHHHHHHHCCCCEEEECCccccccccCccC--CC---eEEEEECCCCEEEcCc-chHHHHHhhCC
Confidence            55 789999999999988    112   223321  11   1345666677777776 33344434443


No 8  
>PF06331 Tbf5:  Transcription factor TFIIH complex subunit Tfb5;  InterPro: IPR009400  This entry represents nucleotide excision repair (NER) proteins, such as TTDA subunit of TFIIH basal transcription factor complex (also known as subunit 5 of RNA polymerase II transcription factor B), and Rex1. These proteins have a structural motif consisting of a 2-layer sandwich structure with an alpha/beta plait topology. Nucleotide excision repair is a major pathway for repairing UV light-induced DNA damage in most organisms. Transcription/repair factor IIH (TFIIH) is essential for RNA polymerase II transcription and nucleotide excision repair. The TFIIH complex consists of ten subunits: ERCC2, ERCC3, GTF2H1, GTF2H2, GTF2H3, GTF2H4, GTF2H5, MNAT1, CDK7 and CCNH. Defects in GTF2H5 cause the disease trichothiodystrophy (TTD), therefore GTF2H5 (general transcription factor 2H subunit 5) is also known as the TTD group A (TTDA) subunit (and as Tfb5) []. The TTDA subunit is responsible for the DNA repair function of the complex. TTDA is present both bound to TFIIH, and as a free fraction that shuffles between the cytoplasm and nucleus; induction of NER-type DNA lesions shifts the balance towards TTDA's more stable association with TFIIH []. TTDA is also required for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.  REX1 (required for excision 1) is required for DNA repair in the single-celled, photosynthetic algae Chlamydomonas reinhardtii [], and has homologues in other eukaryotes.; GO: 0003677 DNA binding, 0006289 nucleotide-excision repair; PDB: 2JNJ_B 1YDL_A 3DGP_B 3DOM_B.
Probab=33.86  E-value=44  Score=20.97  Aligned_cols=23  Identities=17%  Similarity=0.384  Sum_probs=18.8

Q ss_pred             eCCceeeeecCCcchHHHHHHhhh
Q psy7580          22 TNTDVHLFIPESKMSADIQNHFKS   45 (133)
Q Consensus        22 ~~~sv~Lfid~~Ki~~~v~~~L~~   45 (133)
                      -.++.+|||+++++ +.+++++.+
T Consensus        35 dLDdthlfV~~~~v-~~lk~~l~~   57 (68)
T PF06331_consen   35 DLDDTHLFVKPDVV-EMLKEELDE   57 (68)
T ss_dssp             EECTTEEEE-CCCH-HHHHHHHHH
T ss_pred             EcCCCeEEEcHhHH-HHHHHHHHH
Confidence            46789999999998 899998875


No 9  
>PF02512 UK:  Virulence determinant
Probab=33.34  E-value=22  Score=23.30  Aligned_cols=9  Identities=56%  Similarity=1.173  Sum_probs=7.5

Q ss_pred             CCCCCC-CCc
Q psy7580           5 RGADIP-YNP   13 (133)
Q Consensus         5 RG~Dip-~nP   13 (133)
                      ||+|+| ++|
T Consensus        61 rgndvpcccp   70 (96)
T PF02512_consen   61 RGNDVPCCCP   70 (96)
T ss_pred             cCCCCCccCC
Confidence            899999 566


No 10 
>KOG2648|consensus
Probab=32.71  E-value=26  Score=29.95  Aligned_cols=17  Identities=41%  Similarity=0.749  Sum_probs=14.5

Q ss_pred             hcCcEEEeeccccccCC
Q psy7580         117 ENLIHFYSTWDFPMDFY  133 (133)
Q Consensus       117 ~~~~~~~~~~~~~~~~~  133 (133)
                      .++.+-...||+|||+|
T Consensus       374 ~~~~~~~~~~d~pm~~~  390 (453)
T KOG2648|consen  374 ESEFHSSELGDYPMDYY  390 (453)
T ss_pred             cccccccccccCccccc
Confidence            37777789999999997


No 11 
>PF00543 P-II:  Nitrogen regulatory protein P-II members of this family.;  InterPro: IPR002187 In Gram-negative bacteria, the activity and concentration of glutamine synthetase (GS) is regulated in response to nitrogen source availability. PII, a tetrameric protein encoded by the glnB gene, is a component of the adenylation cascade involved in the regulation of GS activity []. In nitrogen-limiting conditions, when the ratio of glutamine to 2-ketoglutarate decreases, P-II is uridylylated on a tyrosine residue to form P-II-UMP. P-II-UMP allows the deadenylation of GS, thus activating the enzyme. Conversely, in nitrogen excess, P-II-UMP is deuridylated and then promotes the adenylation of GS. P-II also indirectly controls the transcription of the GS gene (glnA) by preventing NR-II (ntrB) to phosphorylate NR-I (ntrC) which is the transcriptional activator of glnA. Once P-II is uridylylated, these events are reversed. P-II is a protein of about 110 amino acid residues extremely well conserved. The tyrosine which is uridylated is located in the central part of the protein. In cyanobacteria, P-II seems to be phosphorylated on a serine residue rather than being uridylated. In methanogenic archaebacteria, the nitrogenase iron protein gene (nifH) is followed by two open reading frames highly similar to the eubacterial P-II protein []. These proteins could be involved in the regulation of nitrogen fixation. In the red alga, Porphyra purpurea, there is a glnB homologue encoded in the chloroplast genome. Other proteins highly similar to glnB are:   Bacillus subtilis protein nrgB [].  Escherichia coli hypothetical protein ybaI []. ; GO: 0030234 enzyme regulator activity, 0006808 regulation of nitrogen utilization; PDB: 1V3S_B 1V3R_C 2XZW_A 2XUL_A 2V5H_J 2XG8_C 2JJ4_F 1QY7_C 4AFF_A 2XBP_A ....
Probab=32.05  E-value=50  Score=21.72  Aligned_cols=31  Identities=16%  Similarity=0.347  Sum_probs=24.7

Q ss_pred             eeeecCCcchHHHHHHhhhCCCCee-eeccccC
Q psy7580          27 HLFIPESKMSADIQNHFKSENCPIN-MLNLRGA   58 (133)
Q Consensus        27 ~Lfid~~Ki~~~v~~~L~~~~~~~~-LlNlRg~   58 (133)
                      ..++.++|+ .++.+.|.+.++..+ +...+|.
T Consensus         2 ~aIir~~~~-~~v~~aL~~~G~~g~Tv~~v~G~   33 (102)
T PF00543_consen    2 EAIIRPEKL-EEVIEALREAGVPGMTVSEVRGR   33 (102)
T ss_dssp             EEEEEGGGH-HHHHHHHHHTTGSCEEEEEEEEE
T ss_pred             EEEEChhHH-HHHHHHHHHCCCCeEEEEEeEEe
Confidence            457889999 999999999888777 6666654


No 12 
>PF09902 DUF2129:  Uncharacterized protein conserved in bacteria (DUF2129);  InterPro: IPR016979 This is a group of uncharacterised conserved proteins.
Probab=25.29  E-value=47  Score=21.06  Aligned_cols=22  Identities=23%  Similarity=0.385  Sum_probs=18.9

Q ss_pred             CCceeeeecCCcchHHHHHHhhh
Q psy7580          23 NTDVHLFIPESKMSADIQNHFKS   45 (133)
Q Consensus        23 ~~sv~Lfid~~Ki~~~v~~~L~~   45 (133)
                      +.=+.||+|++++ +++.+.|++
T Consensus        30 ~kYvvlYvn~~~~-e~~~~kl~~   51 (71)
T PF09902_consen   30 MKYVVLYVNEEDV-EEIIEKLKK   51 (71)
T ss_pred             ccEEEEEECHHHH-HHHHHHHhc
Confidence            5678999999999 888888875


No 13 
>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional
Probab=24.03  E-value=55  Score=26.89  Aligned_cols=27  Identities=11%  Similarity=0.266  Sum_probs=16.7

Q ss_pred             CcchHHHHHHhhhCCCCeeeeccccCCc
Q psy7580          33 SKMSADIQNHFKSENCPINMLNLRGADI   60 (133)
Q Consensus        33 ~Ki~~~v~~~L~~~~~~~~LlNlRg~Di   60 (133)
                      +++ .++.+.|.++|+...+-.-||.|+
T Consensus       293 ~~i-~~f~~~L~~~gi~~tiR~~~G~di  319 (344)
T PRK14464        293 ERI-VAMARYLHRRGVLTKVRNSAGQDV  319 (344)
T ss_pred             HHH-HHHHHHHHHCCceEEEECCCCCch
Confidence            344 566777776776666555556655


No 14 
>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional
Probab=23.10  E-value=52  Score=27.38  Aligned_cols=45  Identities=22%  Similarity=0.326  Sum_probs=29.2

Q ss_pred             CCCCCceeeeeEEEeCCceeeeecCCcchHHHHHHhhhCCCCeeeeccccCCcC
Q psy7580           8 DIPYNPVFFSYLIITNTDVHLFIPESKMSADIQNHFKSENCPINMLNLRGADIP   61 (133)
Q Consensus         8 Dip~nPv~~sy~~~~~~sv~Lfid~~Ki~~~v~~~L~~~~~~~~LlNlRg~Di~   61 (133)
                      =|||||+--+.  + ....     .+++ .+.++.|.++|+.+.+-.-||.||.
T Consensus       311 LIp~Np~~~~~--~-~~ps-----~~~i-~~F~~~L~~~gi~vtiR~s~G~DI~  355 (371)
T PRK14461        311 LIPWNPVPGTP--L-GRSE-----RERV-TTFQRILTDYGIPCTVRVERGVEIA  355 (371)
T ss_pred             EecCCCCCCCC--C-CCCC-----HHHH-HHHHHHHHHCCceEEEeCCCCcChh
Confidence            37899964332  1 1122     4455 7888999888888776666688763


No 15 
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only]
Probab=21.76  E-value=54  Score=27.11  Aligned_cols=8  Identities=75%  Similarity=1.049  Sum_probs=3.6

Q ss_pred             CCCCceee
Q psy7580           9 IPYNPVFF   16 (133)
Q Consensus         9 ip~nPv~~   16 (133)
                      |||||+.-
T Consensus       290 IP~Np~~~  297 (349)
T COG0820         290 IPYNPVPG  297 (349)
T ss_pred             eecCCCCC
Confidence            44555433


No 16 
>PF05456 eIF_4EBP:  Eukaryotic translation initiation factor 4E binding protein (EIF4EBP);  InterPro: IPR008606 This family consists of several eukaryotic translation initiation factor 4E binding proteins (EIF4EBP1, -2 and -3). Translation initiation in eukaryotes is mediated by the cap structure (m7GpppN, where N is any nucleotide) present at the 5' end of all cellular mRNAs, except organellar. The cap is recognised by eukaryotic initiation factor 4F (eIF4F), which consists of three polypeptides, including eIF4E, the cap-binding protein subunit. The interaction of the cap with eIF4E facilitates the binding of the ribosome to the mRNA. eIF4E activity is regulated in part by translational repressors, 4E-BP1, 4E-BP2 and 4E-BP3 which bind to it and prevent its assembly into eIF4F [].; GO: 0008190 eukaryotic initiation factor 4E binding, 0045947 negative regulation of translational initiation; PDB: 2JGB_B 2V8Y_F 1WKW_B 3HXG_C 3U7X_D 3M94_C 3M93_C 2V8X_B 3HXI_C 2V8W_B ....
Probab=21.74  E-value=21  Score=24.83  Aligned_cols=14  Identities=21%  Similarity=0.463  Sum_probs=5.1

Q ss_pred             CcccCCCCCCCCce
Q psy7580           1 MLNLRGADIPYNPV   14 (133)
Q Consensus         1 llNiRG~Dip~nPv   14 (133)
                      |||+|+|.+..+|=
T Consensus        55 LL~~RnSPlSrTPP   68 (116)
T PF05456_consen   55 LLECRNSPLSRTPP   68 (116)
T ss_dssp             HHCTCG--------
T ss_pred             HHHhcCCCcccCCC
Confidence            68999998888885


No 17 
>PF02244 Propep_M14:  Carboxypeptidase activation peptide;  InterPro: IPR003146 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The peptidases are synthesised as inactive molecules, zymogens, with propeptides that must be removed by proteolytic cleavage to activate the enzyme. Structural studies of carboxypeptidases A and B reveal the propeptide to exist as a globular domain, followed by an extended alpha-helix; this shields the catalytic site, without specifically binding to it, while the substrate-binding site is blocked by making specific contacts [, ]. Members of this propeptide family are found in the metallocarboxypeptidases: A1, A2 [], A3, A4, A5, A6, U, insect gut carboxypeptidase and B [], and and are associated with peptidases belonging to MEROPS peptidase family M14A.  Carboxypeptidases are found in abundance in pancreatic secretions. The pro-segment moiety (activation peptide) accounts for up to a quarter of the total length of the peptidase.; GO: 0004180 carboxypeptidase activity, 0006508 proteolysis; PDB: 3D68_C 3D67_B 3D66_A 1PBA_A 3GLJ_A 1NSA_A 1KWM_A 2BOA_B 1PYT_A 1JQG_A ....
Probab=20.91  E-value=97  Score=18.74  Aligned_cols=28  Identities=14%  Similarity=0.386  Sum_probs=23.1

Q ss_pred             CCceeeeecCCcchHHHHHHhhhCCCCee
Q psy7580          23 NTDVHLFIPESKMSADIQNHFKSENCPIN   51 (133)
Q Consensus        23 ~~sv~Lfid~~Ki~~~v~~~L~~~~~~~~   51 (133)
                      |+.+++.|.+++. ..+.+.|++.+.+..
T Consensus        33 ~~~~dv~V~p~~~-~~f~~~L~~~~i~~~   60 (74)
T PF02244_consen   33 GRPVDVMVPPEKL-EEFEELLKEHGIEYE   60 (74)
T ss_dssp             TSEEEEEEEGGGH-HHHHHHHHHTT-EEE
T ss_pred             CCeEEEEECHHHH-HHHHHHHHHCCCcEE
Confidence            6789999999998 899999988776544


Done!