Query         psy7602
Match_columns 95
No_of_seqs    109 out of 687
Neff          7.0 
Searched_HMMs 46136
Date          Fri Aug 16 22:34:55 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7602.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7602hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1814|consensus               99.6   3E-16 6.4E-21  120.1   6.5   80    4-93    198-283 (445)
  2 KOG1815|consensus               99.6 3.4E-16 7.3E-21  121.4   4.9   80    5-94     83-169 (444)
  3 KOG1812|consensus               99.3 8.3E-12 1.8E-16   95.8   5.3   72    9-93    166-243 (384)
  4 smart00647 IBR In Between Ring  98.3 3.5E-07 7.6E-12   52.8   2.5   29   57-94      1-29  (64)
  5 PF01485 IBR:  IBR domain;  Int  98.1 3.7E-07 8.1E-12   52.6  -1.5   29   57-94      1-29  (64)
  6 PF15227 zf-C3HC4_4:  zinc fing  97.9   4E-06 8.7E-11   45.7   1.3   33    4-41      9-41  (42)
  7 PF13923 zf-C3HC4_2:  Zinc fing  97.8 6.5E-06 1.4E-10   43.8   1.1   20    7-26     13-32  (39)
  8 PF00097 zf-C3HC4:  Zinc finger  97.8 1.3E-05 2.7E-10   42.7   1.4   20    7-26     13-32  (41)
  9 PF13639 zf-RING_2:  Ring finge  97.6 3.4E-05 7.4E-10   41.8   1.4   24    3-26     13-36  (44)
 10 PF13445 zf-RING_UBOX:  RING-ty  97.4   8E-05 1.7E-09   40.8   1.5   29    7-40     15-43  (43)
 11 cd00162 RING RING-finger (Real  97.4 0.00015 3.2E-09   38.0   2.5   20    7-26     14-33  (45)
 12 smart00184 RING Ring finger. E  97.2 0.00029 6.4E-09   35.5   2.3   22    4-25      9-30  (39)
 13 PLN03208 E3 ubiquitin-protein   97.0 0.00041 8.9E-09   49.2   2.2   51    4-56     29-86  (193)
 14 PF13920 zf-C3HC4_3:  Zinc fing  97.0 0.00047   1E-08   38.3   1.6   35    4-49     13-48  (50)
 15 KOG0320|consensus               96.8  0.0009 1.9E-08   47.0   2.1   36    7-53    147-182 (187)
 16 PF14634 zf-RING_5:  zinc-RING   96.8   0.001 2.2E-08   36.1   1.9   21    4-24     13-33  (44)
 17 KOG0006|consensus               96.7  0.0027 5.8E-08   48.6   4.3   72    6-93    234-325 (446)
 18 PF11789 zf-Nse:  Zinc-finger o  96.5  0.0013 2.8E-08   38.0   1.3   33    6-45     25-57  (57)
 19 smart00504 Ubox Modified RING   96.5  0.0047   1E-07   35.2   3.4   42    4-56     12-53  (63)
 20 KOG0317|consensus               96.4  0.0028   6E-08   47.4   2.7   41    3-54    249-289 (293)
 21 KOG1002|consensus               96.3  0.0031 6.6E-08   51.1   2.6   44    2-51    545-588 (791)
 22 KOG2164|consensus               96.0  0.0038 8.2E-08   49.8   1.6   43    8-56    201-243 (513)
 23 KOG0978|consensus               95.9  0.0035 7.7E-08   51.7   1.2   42    4-55    654-695 (698)
 24 PHA02926 zinc finger-like prot  95.4   0.015 3.2E-07   42.4   2.7   36    8-48    194-229 (242)
 25 TIGR00599 rad18 DNA repair pro  95.1   0.023   5E-07   44.4   3.3   34    7-51     40-73  (397)
 26 KOG0823|consensus               95.1   0.011 2.3E-07   43.1   1.4   45    4-56     58-102 (230)
 27 TIGR00570 cdk7 CDK-activating   95.1    0.02 4.4E-07   43.3   2.9   33   10-52     25-57  (309)
 28 PHA02929 N1R/p28-like protein;  94.2   0.029 6.3E-07   41.0   1.8   31    8-49    197-227 (238)
 29 KOG2177|consensus               93.0   0.054 1.2E-06   37.7   1.5   28    7-45     27-54  (386)
 30 PF04564 U-box:  U-box domain;   90.9    0.34 7.4E-06   28.8   3.1   57    4-71     15-71  (73)
 31 PF12678 zf-rbx1:  RING-H2 zinc  90.0    0.13 2.7E-06   30.8   0.6   18    9-26     48-65  (73)
 32 COG5432 RAD18 RING-finger-cont  89.9    0.16 3.5E-06   38.6   1.3   38    9-52     41-78  (391)
 33 KOG0287|consensus               87.9    0.31 6.7E-06   37.8   1.6   34    9-53     39-72  (442)
 34 COG5574 PEX10 RING-finger-cont  85.8    0.67 1.4E-05   34.5   2.3   42    3-53    225-266 (271)
 35 KOG4739|consensus               83.5    0.42 9.1E-06   34.9   0.4   18    4-21     16-33  (233)
 36 KOG2660|consensus               82.6    0.44 9.6E-06   36.4   0.3   34    7-51     30-63  (331)
 37 PF06844 DUF1244:  Protein of u  81.2     1.3 2.9E-05   26.4   1.9   20   14-33     11-30  (68)
 38 KOG0824|consensus               80.4     1.2 2.6E-05   33.9   1.9   40    7-56     21-60  (324)
 39 KOG1428|consensus               79.1     5.5 0.00012   37.0   5.6   51    3-56   3499-3551(3738)
 40 KOG0802|consensus               78.3     1.6 3.6E-05   35.1   2.2   21    6-26    309-329 (543)
 41 PF14835 zf-RING_6:  zf-RING of  78.2    0.23   5E-06   29.5  -2.0   32    9-53     24-55  (65)
 42 PF11793 FANCL_C:  FANCL C-term  75.3     1.2 2.6E-05   26.4   0.5   39    9-50     26-67  (70)
 43 COG5152 Uncharacterized conser  75.2     1.4 2.9E-05   32.0   0.8   16    7-22    210-225 (259)
 44 KOG0311|consensus               74.2    0.91   2E-05   35.2  -0.3   20    6-25     57-76  (381)
 45 KOG1734|consensus               72.5     1.4   3E-05   33.3   0.3   41    4-53    245-285 (328)
 46 KOG2979|consensus               71.9       6 0.00013   29.4   3.6   50    6-62    190-241 (262)
 47 COG5540 RING-finger-containing  71.3     2.8 6.2E-05   32.2   1.8   37    4-50    337-373 (374)
 48 KOG4159|consensus               69.7     8.4 0.00018   30.3   4.1   53    7-70     98-154 (398)
 49 KOG1645|consensus               68.9     5.1 0.00011   31.8   2.8   44    4-56     20-63  (463)
 50 PF12861 zf-Apc11:  Anaphase-pr  67.8     5.4 0.00012   24.9   2.2   32    9-48     50-81  (85)
 51 KOG1001|consensus               67.7     2.7 5.9E-05   35.0   1.1   41    4-53    464-504 (674)
 52 COG3492 Uncharacterized protei  66.0     5.3 0.00012   25.4   2.0   19   14-32     42-60  (104)
 53 KOG2932|consensus               63.2     3.2 6.8E-05   32.0   0.7   13    9-21    107-119 (389)
 54 PF14447 Prok-RING_4:  Prokaryo  60.2     2.6 5.6E-05   24.2  -0.2   35    5-52     19-53  (55)
 55 PF07975 C1_4:  TFIIH C1-like d  57.5     5.5 0.00012   22.4   0.9   12    9-20     25-36  (51)
 56 COG5243 HRD1 HRD ubiquitin lig  55.7     7.7 0.00017   30.7   1.6   20    7-26    314-333 (491)
 57 KOG1039|consensus               54.3     6.4 0.00014   30.4   1.0   34    9-46    185-218 (344)
 58 KOG2879|consensus               53.8       8 0.00017   29.2   1.4   37    4-49    251-287 (298)
 59 KOG1785|consensus               53.2      10 0.00022   30.4   1.9   35    4-45    380-414 (563)
 60 KOG4692|consensus               51.8     9.7 0.00021   30.0   1.6   18    9-26    438-455 (489)
 61 PF14570 zf-RING_4:  RING/Ubox   50.4      11 0.00024   20.9   1.3   17    9-25     18-34  (48)
 62 KOG4628|consensus               49.2       8 0.00017   29.9   0.8   24    4-27    243-266 (348)
 63 KOG0297|consensus               46.6       8 0.00017   30.1   0.5   18    9-26     38-55  (391)
 64 cd00065 FYVE FYVE domain; Zinc  46.2     8.6 0.00019   21.0   0.5   20    9-28     22-41  (57)
 65 COG5112 UFD2 U1-like Zn-finger  45.9      10 0.00022   24.8   0.8   20   10-29     52-71  (126)
 66 PHA03096 p28-like protein; Pro  43.1      19 0.00041   27.0   2.0   20   10-29    203-222 (284)
 67 KOG1941|consensus               42.1      17 0.00037   29.0   1.7   38    3-49    379-416 (518)
 68 KOG0006|consensus               41.1      15 0.00032   28.6   1.1   76   10-93    341-425 (446)
 69 KOG3579|consensus               39.7      14 0.00031   28.1   0.9   32   12-47    291-323 (352)
 70 PF01530 zf-C2HC:  Zinc finger,  38.9      17 0.00038   18.4   0.9   10   86-95      4-13  (31)
 71 KOG1813|consensus               37.5      13 0.00029   28.3   0.4   18    7-24    255-272 (313)
 72 PF01776 Ribosomal_L22e:  Ribos  36.0      59  0.0013   21.2   3.2   51   20-72     26-81  (112)
 73 KOG2930|consensus               35.7      29 0.00063   22.6   1.7   19   10-28     80-98  (114)
 74 KOG3408|consensus               34.7      17 0.00037   24.2   0.6   20   10-29     54-73  (129)
 75 COG5194 APC11 Component of SCF  34.2      30 0.00064   21.5   1.5   17   10-26     53-69  (88)
 76 KOG0828|consensus               33.8      33 0.00071   28.2   2.1   32    8-49    603-634 (636)
 77 PF04891 NifQ:  NifQ;  InterPro  33.7      44 0.00096   23.2   2.5   27   57-93    132-158 (167)
 78 KOG0827|consensus               33.3      32 0.00068   27.4   1.9   26    4-29     18-44  (465)
 79 PF14353 CpXC:  CpXC protein     33.1      35 0.00077   21.9   1.9   23   23-48     26-48  (128)
 80 smart00064 FYVE Protein presen  33.0      20 0.00043   20.4   0.6   19   10-28     31-49  (68)
 81 PF10426 zf-RAG1:  Recombinatio  32.8      17 0.00037   18.3   0.2   15   36-50      2-16  (30)
 82 KOG2594|consensus               32.6      47   0.001   26.1   2.7   23    7-29     26-48  (396)
 83 COG5222 Uncharacterized conser  30.0      32  0.0007   26.6   1.4   29    8-46    290-318 (427)
 84 KOG0825|consensus               30.0      31 0.00067   30.0   1.4   17    9-25    142-158 (1134)
 85 KOG4185|consensus               29.8      28  0.0006   25.5   1.0   39    8-56     24-64  (296)
 86 KOG3039|consensus               29.6      34 0.00073   25.7   1.4   20   10-29     60-79  (303)
 87 PF04641 Rtf2:  Rtf2 RING-finge  27.8      66  0.0014   23.4   2.8   36    9-56    133-168 (260)
 88 KOG4445|consensus               27.8      49  0.0011   25.6   2.0   25    4-28    129-153 (368)
 89 COG1996 RPC10 DNA-directed RNA  27.6      16 0.00036   20.4  -0.4   26   16-48      9-34  (49)
 90 KOG3002|consensus               27.6      37  0.0008   25.7   1.4   10   12-21     68-77  (299)
 91 KOG3434|consensus               26.0      80  0.0017   21.0   2.6   54   18-71     36-92  (125)
 92 PF08882 Acetone_carb_G:  Aceto  24.5      27 0.00058   22.9   0.1   23    7-29     25-49  (112)
 93 KOG3268|consensus               22.8 1.5E+02  0.0032   21.3   3.6   40    7-49    186-228 (234)
 94 PF01363 FYVE:  FYVE zinc finge  22.4      11 0.00024   21.5  -1.8   17   10-26     30-46  (69)
 95 PF14319 Zn_Tnp_IS91:  Transpos  21.8      21 0.00046   22.9  -0.7   23    6-28     53-75  (111)
 96 PF02748 PyrI_C:  Aspartate car  21.7      38 0.00082   18.9   0.4   11   84-94      7-17  (52)
 97 COG5220 TFB3 Cdk activating ki  21.4      30 0.00066   25.9  -0.1   31   10-48     33-63  (314)
 98 PF10571 UPF0547:  Uncharacteri  21.3      46   0.001   15.9   0.6    6   10-15     19-24  (26)
 99 PF03854 zf-P11:  P-11 zinc fin  20.1      19 0.00041   20.2  -1.1    9   13-21      2-10  (50)

No 1  
>KOG1814|consensus
Probab=99.64  E-value=3e-16  Score=120.13  Aligned_cols=80  Identities=26%  Similarity=0.458  Sum_probs=74.2

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH------HHHHHHHHHHHHhhCCCCCCC
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF------DVYQGILSNQVTNCRLASLVP   77 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l------~ky~~~l~~~~v~~~~~~~~~   77 (95)
                      ..++.++|+|+||+.|++.|.++.|+ +|++..++||+++|+...++.+++++      +||+++++++-++...     
T Consensus       198 ~c~~~lpC~Hv~Ck~C~kdY~~~~i~-eg~v~~l~Cp~~~C~~~a~~g~vKelvg~EL~arYe~l~lqk~l~~ms-----  271 (445)
T KOG1814|consen  198 HCFKFLPCSHVFCKSCLKDYFTIQIQ-EGQVSCLKCPDPKCGSVAPPGQVKELVGDELFARYEKLMLQKTLELMS-----  271 (445)
T ss_pred             ceeeecccchHHHHHHHHHHHHHhhh-cceeeeecCCCCCCcccCCchHHHHHHHHHHHHHHHHHHHHHHHHhhc-----
Confidence            34667899999999999999999998 79988999999999999999999988      9999999999999984     


Q ss_pred             CCCCCeeeCCCCCCcc
Q psy7602          78 CKCSWVRFPPGADFIL   93 (95)
Q Consensus        78 ~~~~~~~~CP~~~C~~   93 (95)
                          ++.|||++.|+.
T Consensus       272 ----dv~yCPr~~Cq~  283 (445)
T KOG1814|consen  272 ----DVVYCPRACCQL  283 (445)
T ss_pred             ----ccccCChhhccC
Confidence                999999999986


No 2  
>KOG1815|consensus
Probab=99.62  E-value=3.4e-16  Score=121.44  Aligned_cols=80  Identities=34%  Similarity=0.667  Sum_probs=71.2

Q ss_pred             CcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH-------HHHHHHHHHHHHhhCCCCCCC
Q psy7602           5 LMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF-------DVYQGILSNQVTNCRLASLVP   77 (95)
Q Consensus         5 ~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l-------~ky~~~l~~~~v~~~~~~~~~   77 (95)
                      ++..+.|||.||..||..||..+|. +|....|+||..+|...+..++|..+       ++|++++.++||+++.     
T Consensus        83 ~~~~~~c~H~~c~~cw~~yl~~kI~-~~~~~~i~cp~~~C~a~v~~~~i~~~~s~~~~~~ky~~~i~~syve~~~-----  156 (444)
T KOG1815|consen   83 EIIGLGCGHPFCPPCWTGYLGTKIH-EGEEAKIKCPAHGCPALVGEDTVEKLVSDKEDKEKYQRYILRSYVEDNV-----  156 (444)
T ss_pred             hhhhcCCCcHHHHHHHHHHhhheee-ccccccccCCCCCccccCCCceeeeecCCHHHHHHHHHHHHHHHHhcCC-----
Confidence            5777899999999999999999998 55533599999999999998888665       8999999999999996     


Q ss_pred             CCCCCeeeCCCCCCccC
Q psy7602          78 CKCSWVRFPPGADFILN   94 (95)
Q Consensus        78 ~~~~~~~~CP~~~C~~~   94 (95)
                          .++|||+|+|++.
T Consensus       157 ----~lkwCP~~~C~~a  169 (444)
T KOG1815|consen  157 ----PLKWCPAPGCGLA  169 (444)
T ss_pred             ----ccccCCCCCCCce
Confidence                6999999999873


No 3  
>KOG1812|consensus
Probab=99.25  E-value=8.3e-12  Score=95.81  Aligned_cols=72  Identities=24%  Similarity=0.499  Sum_probs=63.1

Q ss_pred             CCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH------HHHHHHHHHHHHhhCCCCCCCCCCCC
Q psy7602           9 LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF------DVYQGILSNQVTNCRLASLVPCKCSW   82 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l------~ky~~~l~~~~v~~~~~~~~~~~~~~   82 (95)
                      +.|+|.||.+||++|++.+.. +|  ..|+||+.+|+..++.+....+      +.|+..+.+.+|....         .
T Consensus       166 ~~C~H~fC~~C~k~~iev~~~-~~--~~~~C~~~~C~~~l~~~~c~~llt~kl~e~~e~~~~e~~i~~~~---------~  233 (384)
T KOG1812|consen  166 LKCGHRFCKDCVKQHIEVKLL-SG--TVIRCPHDGCESRLTLESCRKLLTPKLREMWEQRLKEEVIPSLD---------R  233 (384)
T ss_pred             hcccchhhhHHhHHHhhhhhc-cC--CCccCCCCCCCccCCHHHHhhhcCHHHHHHHHHHHHHHhhhhhh---------c
Confidence            689999999999999999954 44  3799999999999999988777      8888999999998884         5


Q ss_pred             eeeCCCCCCcc
Q psy7602          83 VRFPPGADFIL   93 (95)
Q Consensus        83 ~~~CP~~~C~~   93 (95)
                      + |||+|+|..
T Consensus       234 ~-ycp~~~C~~  243 (384)
T KOG1812|consen  234 V-YCPYPRCSS  243 (384)
T ss_pred             c-cCCCCCchH
Confidence            6 999999964


No 4  
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=98.34  E-value=3.5e-07  Score=52.76  Aligned_cols=29  Identities=14%  Similarity=0.255  Sum_probs=25.9

Q ss_pred             HHHHHHHHHHHHhhCCCCCCCCCCCCeeeCCCCCCccC
Q psy7602          57 DVYQGILSNQVTNCRLASLVPCKCSWVRFPPGADFILN   94 (95)
Q Consensus        57 ~ky~~~l~~~~v~~~~~~~~~~~~~~~~~CP~~~C~~~   94 (95)
                      ++|++++++++|+.++         +++|||+|+|+.+
T Consensus         1 ~~y~~~~~~~~i~~~~---------~~~~CP~~~C~~~   29 (64)
T smart00647        1 EKYERLLLESYVESNP---------DLKWCPAPDCSAA   29 (64)
T ss_pred             ChHHHHHHHHHHhcCC---------CccCCCCCCCcce
Confidence            4899999999999985         9999999999753


No 5  
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=98.06  E-value=3.7e-07  Score=52.57  Aligned_cols=29  Identities=21%  Similarity=0.266  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHhhCCCCCCCCCCCCeeeCCCCCCccC
Q psy7602          57 DVYQGILSNQVTNCRLASLVPCKCSWVRFPPGADFILN   94 (95)
Q Consensus        57 ~ky~~~l~~~~v~~~~~~~~~~~~~~~~~CP~~~C~~~   94 (95)
                      +||+++++++||+.++         +++|||+|||+.+
T Consensus         1 eky~~~~~~~~~~~~~---------~~~~Cp~~~C~~~   29 (64)
T PF01485_consen    1 EKYQKFLLKRYLESDP---------NIRWCPNPDCEYI   29 (64)
T ss_dssp             HCHHHCCCHS---S------------CC--TTSST---
T ss_pred             ChHHHHHHHHHHHCCC---------CccCCCCCCCccc
Confidence            5899999999998774         9999999999864


No 6  
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=97.94  E-value=4e-06  Score=45.65  Aligned_cols=33  Identities=21%  Similarity=0.464  Sum_probs=21.6

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCc
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAA   41 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~   41 (95)
                      ++-++|+|||.||.+|+..+.+..-.   .  .+.||.
T Consensus         9 ~~Pv~l~CGH~FC~~Cl~~~~~~~~~---~--~~~CP~   41 (42)
T PF15227_consen    9 KDPVSLPCGHSFCRSCLERLWKEPSG---S--GFSCPE   41 (42)
T ss_dssp             SSEEE-SSSSEEEHHHHHHHHCCSSS---S--T---SS
T ss_pred             CCccccCCcCHHHHHHHHHHHHccCC---c--CCCCcC
Confidence            45567999999999999999876432   2  277874


No 7  
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=97.85  E-value=6.5e-06  Score=43.76  Aligned_cols=20  Identities=35%  Similarity=0.876  Sum_probs=18.3

Q ss_pred             ccCCCCchhhHHHHHHHHHh
Q psy7602           7 TGLECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~   26 (95)
                      ..+.|||.||.+||.+|++.
T Consensus        13 ~~~~CGH~fC~~C~~~~~~~   32 (39)
T PF13923_consen   13 VVTPCGHSFCKECIEKYLEK   32 (39)
T ss_dssp             EECTTSEEEEHHHHHHHHHC
T ss_pred             EECCCCCchhHHHHHHHHHC
Confidence            57899999999999999876


No 8  
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=97.76  E-value=1.3e-05  Score=42.69  Aligned_cols=20  Identities=35%  Similarity=0.894  Sum_probs=18.6

Q ss_pred             ccCCCCchhhHHHHHHHHHh
Q psy7602           7 TGLECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~   26 (95)
                      ..++|||.||.+|+.+|++.
T Consensus        13 ~~~~C~H~fC~~C~~~~~~~   32 (41)
T PF00097_consen   13 ILLPCGHSFCRDCLRKWLEN   32 (41)
T ss_dssp             EETTTSEEEEHHHHHHHHHH
T ss_pred             EEecCCCcchHHHHHHHHHh
Confidence            37899999999999999998


No 9  
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=97.57  E-value=3.4e-05  Score=41.80  Aligned_cols=24  Identities=29%  Similarity=0.588  Sum_probs=20.9

Q ss_pred             CCCcccCCCCchhhHHHHHHHHHh
Q psy7602           3 STLMTGLECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         3 ~~~~~~l~CgH~FC~~C~~~yl~~   26 (95)
                      .+....++|||.|+.+|+.+|++.
T Consensus        13 ~~~~~~l~C~H~fh~~Ci~~~~~~   36 (44)
T PF13639_consen   13 GEKVVKLPCGHVFHRSCIKEWLKR   36 (44)
T ss_dssp             TSCEEEETTSEEEEHHHHHHHHHH
T ss_pred             CCeEEEccCCCeeCHHHHHHHHHh
Confidence            456677899999999999999966


No 10 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=97.42  E-value=8e-05  Score=40.84  Aligned_cols=29  Identities=24%  Similarity=0.570  Sum_probs=18.0

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhhcCCceeeeecC
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACA   40 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp   40 (95)
                      ..|.|||.||++|+++.+.....     ..++||
T Consensus        15 ~~L~CGH~~c~~cl~~l~~~~~~-----~~~kCP   43 (43)
T PF13445_consen   15 MVLPCGHVFCKDCLQKLSKKSDR-----NRFKCP   43 (43)
T ss_dssp             EE-SSS-EEEHHHHHHHHHH-S------S-B--T
T ss_pred             EEEeCccHHHHHHHHHHHhcCCC-----CeeeCc
Confidence            44889999999999999885432     257776


No 11 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=97.41  E-value=0.00015  Score=37.99  Aligned_cols=20  Identities=35%  Similarity=0.848  Sum_probs=16.9

Q ss_pred             ccCCCCchhhHHHHHHHHHh
Q psy7602           7 TGLECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~   26 (95)
                      ....|||.||.+|+..|++.
T Consensus        14 ~~~~C~H~~c~~C~~~~~~~   33 (45)
T cd00162          14 VLLPCGHVFCRSCIDKWLKS   33 (45)
T ss_pred             EecCCCChhcHHHHHHHHHh
Confidence            33459999999999999875


No 12 
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=97.22  E-value=0.00029  Score=35.52  Aligned_cols=22  Identities=32%  Similarity=0.712  Sum_probs=19.0

Q ss_pred             CCcccCCCCchhhHHHHHHHHH
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLT   25 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~   25 (95)
                      +....+.|||.||.+|++.|++
T Consensus         9 ~~~~~~~C~H~~c~~C~~~~~~   30 (39)
T smart00184        9 KDPVVLPCGHTFCRSCIRKWLK   30 (39)
T ss_pred             CCcEEecCCChHHHHHHHHHHH
Confidence            4556678999999999999987


No 13 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=97.03  E-value=0.00041  Score=49.22  Aligned_cols=51  Identities=16%  Similarity=0.308  Sum_probs=35.6

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhc-------CCceeeeecCccccCcccccchhhhH
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQ-------EGMGQTIACAAHGCNILVDDGKPIEF   56 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~-------~g~~~~i~Cp~~~C~~~i~~~~i~~l   56 (95)
                      ++-+.+.|||.||..|+.+|+...-..       .......+||.  |+..|+...+..+
T Consensus        29 ~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPv--CR~~Is~~~LvPi   86 (193)
T PLN03208         29 RDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPV--CKSDVSEATLVPI   86 (193)
T ss_pred             CCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCC--CCCcCChhcEEEe
Confidence            344557899999999999998753110       00112578996  9999988777665


No 14 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=96.96  E-value=0.00047  Score=38.26  Aligned_cols=35  Identities=26%  Similarity=0.584  Sum_probs=25.9

Q ss_pred             CCcccCCCCch-hhHHHHHHHHHhhhhcCCceeeeecCccccCcccc
Q psy7602           4 TLMTGLECSHR-FCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVD   49 (95)
Q Consensus         4 ~~~~~l~CgH~-FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~   49 (95)
                      .+...++|||. ||.+|+..++.   .      ..+||.  |+..|+
T Consensus        13 ~~~~~~pCgH~~~C~~C~~~~~~---~------~~~CP~--Cr~~i~   48 (50)
T PF13920_consen   13 RDVVLLPCGHLCFCEECAERLLK---R------KKKCPI--CRQPIE   48 (50)
T ss_dssp             SSEEEETTCEEEEEHHHHHHHHH---T------TSBBTT--TTBB-S
T ss_pred             CceEEeCCCChHHHHHHhHHhcc---c------CCCCCc--CChhhc
Confidence            45566799999 99999999998   1      246775  766554


No 15 
>KOG0320|consensus
Probab=96.77  E-value=0.0009  Score=47.03  Aligned_cols=36  Identities=28%  Similarity=0.651  Sum_probs=25.4

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchh
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKP   53 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i   53 (95)
                      ++..|||.||+.|++.-+..         .-+||.  |...|+..++
T Consensus       147 vsTkCGHvFC~~Cik~alk~---------~~~CP~--C~kkIt~k~~  182 (187)
T KOG0320|consen  147 VSTKCGHVFCSQCIKDALKN---------TNKCPT--CRKKITHKQF  182 (187)
T ss_pred             cccccchhHHHHHHHHHHHh---------CCCCCC--cccccchhhh
Confidence            56789999999998875543         245876  6556665544


No 16 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=96.76  E-value=0.001  Score=36.08  Aligned_cols=21  Identities=24%  Similarity=0.509  Sum_probs=17.9

Q ss_pred             CCcccCCCCchhhHHHHHHHH
Q psy7602           4 TLMTGLECSHRFCTQCWCEYL   24 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl   24 (95)
                      .....++|||.||.+|+.+..
T Consensus        13 ~~~~l~~CgH~~C~~C~~~~~   33 (44)
T PF14634_consen   13 RRPRLTSCGHIFCEKCLKKLK   33 (44)
T ss_pred             CCeEEcccCCHHHHHHHHhhc
Confidence            456678999999999999876


No 17 
>KOG0006|consensus
Probab=96.69  E-value=0.0027  Score=48.60  Aligned_cols=72  Identities=21%  Similarity=0.338  Sum_probs=51.3

Q ss_pred             cccCCCC--chhhHHHHHHHHHhhhhcCCce-------eeeecCccccCcccccchhhhH-----------HHHHHHHHH
Q psy7602           6 MTGLECS--HRFCTQCWCEYLTTKIIQEGMG-------QTIACAAHGCNILVDDGKPIEF-----------DVYQGILSN   65 (95)
Q Consensus         6 ~~~l~Cg--H~FC~~C~~~yl~~~I~~~g~~-------~~i~Cp~~~C~~~i~~~~i~~l-----------~ky~~~l~~   65 (95)
                      ...+.|.  |.-|.+|++.|..+++. +-+.       ..+.||+ +|..    +.|+.+           ++|+++-.+
T Consensus       234 vlvf~Cns~HvtC~dCFr~yc~~Rl~-~rqf~~~p~~gyslpc~a-gc~~----s~i~e~HHF~ilg~e~Y~rYQr~atE  307 (446)
T KOG0006|consen  234 VLVFQCNSRHVTCLDCFRLYCVTRLN-DRQFVHDPQLGYSLPCVA-GCPN----SLIKELHHFRILGEEQYNRYQRYATE  307 (446)
T ss_pred             eEEEecCCceeehHHhhhhHhhhccc-ccccccCccccccccccC-CCch----HHHHhhhhheecchhHHHHHHHhhhh
Confidence            3446788  99999999999999996 4442       1356665 5653    333333           899999888


Q ss_pred             HHHhhCCCCCCCCCCCCeeeCCCCCCcc
Q psy7602          66 QVTNCRLASLVPCKCSWVRFPPGADFIL   93 (95)
Q Consensus        66 ~~v~~~~~~~~~~~~~~~~~CP~~~C~~   93 (95)
                      .+|....         .+ -||+|+|+.
T Consensus       308 e~vlq~g---------GV-lCP~pgCG~  325 (446)
T KOG0006|consen  308 ECVLQMG---------GV-LCPRPGCGA  325 (446)
T ss_pred             hheeecC---------CE-ecCCCCCCc
Confidence            8887773         34 499999874


No 18 
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=96.53  E-value=0.0013  Score=38.04  Aligned_cols=33  Identities=24%  Similarity=0.646  Sum_probs=22.1

Q ss_pred             cccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccC
Q psy7602           6 MTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCN   45 (95)
Q Consensus         6 ~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~   45 (95)
                      +.+..|||.|-++-+.+||    + .+  ..++||..||+
T Consensus        25 V~s~~C~H~fek~aI~~~i----~-~~--~~~~CPv~GC~   57 (57)
T PF11789_consen   25 VKSKKCGHTFEKEAILQYI----Q-RN--GSKRCPVAGCN   57 (57)
T ss_dssp             EEESSS--EEEHHHHHHHC----T-TT--S-EE-SCCC-S
T ss_pred             cCcCCCCCeecHHHHHHHH----H-hc--CCCCCCCCCCC
Confidence            3456899999999999999    3 22  25899999995


No 19 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=96.45  E-value=0.0047  Score=35.17  Aligned_cols=42  Identities=7%  Similarity=-0.059  Sum_probs=29.3

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF   56 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l   56 (95)
                      ++-+.++|||.||++|+.+|++.    +     ..||.  |+..++.+++...
T Consensus        12 ~~Pv~~~~G~v~~~~~i~~~~~~----~-----~~cP~--~~~~~~~~~l~~~   53 (63)
T smart00504       12 KDPVILPSGQTYERRAIEKWLLS----H-----GTDPV--TGQPLTHEDLIPN   53 (63)
T ss_pred             CCCEECCCCCEEeHHHHHHHHHH----C-----CCCCC--CcCCCChhhceeC
Confidence            34456789999999999999975    1     25665  5666665555443


No 20 
>KOG0317|consensus
Probab=96.38  E-value=0.0028  Score=47.41  Aligned_cols=41  Identities=27%  Similarity=0.573  Sum_probs=32.4

Q ss_pred             CCCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhh
Q psy7602           3 STLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPI   54 (95)
Q Consensus         3 ~~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~   54 (95)
                      .++-..++|||.||-.|+.+|+..+- |        ||.  |...+.++.+.
T Consensus       249 ~~~pSaTpCGHiFCWsCI~~w~~ek~-e--------CPl--CR~~~~pskvi  289 (293)
T KOG0317|consen  249 RSNPSATPCGHIFCWSCILEWCSEKA-E--------CPL--CREKFQPSKVI  289 (293)
T ss_pred             CCCCCcCcCcchHHHHHHHHHHcccc-C--------CCc--ccccCCCccee
Confidence            34566789999999999999998866 2        875  88887777653


No 21 
>KOG1002|consensus
Probab=96.29  E-value=0.0031  Score=51.07  Aligned_cols=44  Identities=25%  Similarity=0.614  Sum_probs=34.7

Q ss_pred             CCCCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccc
Q psy7602           2 PSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDG   51 (95)
Q Consensus         2 ~~~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~   51 (95)
                      |+++.+..+|.|.||+.|+++|+..-..  |.  .++||.  |...++.+
T Consensus       545 ~aed~i~s~ChH~FCrlCi~eyv~~f~~--~~--nvtCP~--C~i~LsiD  588 (791)
T KOG1002|consen  545 PAEDYIESSCHHKFCRLCIKEYVESFME--NN--NVTCPV--CHIGLSID  588 (791)
T ss_pred             hhhhhHhhhhhHHHHHHHHHHHHHhhhc--cc--CCCCcc--cccccccc
Confidence            4566777899999999999999998773  33  489996  87665544


No 22 
>KOG2164|consensus
Probab=95.95  E-value=0.0038  Score=49.83  Aligned_cols=43  Identities=23%  Similarity=0.593  Sum_probs=34.3

Q ss_pred             cCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH
Q psy7602           8 GLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF   56 (95)
Q Consensus         8 ~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l   56 (95)
                      .+.|||.||-.|+-+|+..... .+   ...||-  |...|...++..+
T Consensus       201 ~t~CGHiFC~~CiLqy~~~s~~-~~---~~~CPi--C~s~I~~kdl~pv  243 (513)
T KOG2164|consen  201 RTNCGHIFCGPCILQYWNYSAI-KG---PCSCPI--CRSTITLKDLLPV  243 (513)
T ss_pred             ccccCceeeHHHHHHHHhhhcc-cC---CccCCc--hhhhccccceeee
Confidence            3569999999999999998832 22   578986  9988888777665


No 23 
>KOG0978|consensus
Probab=95.88  E-value=0.0035  Score=51.75  Aligned_cols=42  Identities=21%  Similarity=0.427  Sum_probs=33.5

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhh
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIE   55 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~   55 (95)
                      .+++...|||.||.+|.+..+.++-+        +||.  |+.-+...+|..
T Consensus       654 Kd~vI~kC~H~FC~~Cvq~r~etRqR--------KCP~--Cn~aFganDv~~  695 (698)
T KOG0978|consen  654 KDAVITKCGHVFCEECVQTRYETRQR--------KCPK--CNAAFGANDVHR  695 (698)
T ss_pred             hhHHHHhcchHHHHHHHHHHHHHhcC--------CCCC--CCCCCCcccccc
Confidence            45667789999999999999887653        5884  888888877754


No 24 
>PHA02926 zinc finger-like protein; Provisional
Probab=95.37  E-value=0.015  Score=42.44  Aligned_cols=36  Identities=25%  Similarity=0.563  Sum_probs=27.2

Q ss_pred             cCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCccc
Q psy7602           8 GLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILV   48 (95)
Q Consensus         8 ~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i   48 (95)
                      ..+|+|.||..|++++-.++- +.|.  .-.||.  |+..+
T Consensus       194 L~~CnHsFCl~CIr~Wr~~r~-~~~~--~rsCPi--CR~~f  229 (242)
T PHA02926        194 LDSCNHIFCITCINIWHRTRR-ETGA--SDNCPI--CRTRF  229 (242)
T ss_pred             cCCCCchHHHHHHHHHHHhcc-ccCc--CCcCCC--Cccee
Confidence            348999999999999999865 2343  468997  77543


No 25 
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=95.12  E-value=0.023  Score=44.35  Aligned_cols=34  Identities=26%  Similarity=0.605  Sum_probs=25.1

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccc
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDG   51 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~   51 (95)
                      +.++|||.||..|++.|+..      .   ..||.  |...+..+
T Consensus        40 vitpCgH~FCs~CI~~~l~~------~---~~CP~--Cr~~~~~~   73 (397)
T TIGR00599        40 VLTSCSHTFCSLCIRRCLSN------Q---PKCPL--CRAEDQES   73 (397)
T ss_pred             cCCCCCCchhHHHHHHHHhC------C---CCCCC--CCCccccc
Confidence            45799999999999999853      1   26874  77665543


No 26 
>KOG0823|consensus
Probab=95.12  E-value=0.011  Score=43.08  Aligned_cols=45  Identities=22%  Similarity=0.444  Sum_probs=35.1

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF   56 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l   56 (95)
                      ++-+...|||-||=-|+.+|+..+-.      .-.||.  |+..|+.+.|-.|
T Consensus        58 kdPVvTlCGHLFCWpClyqWl~~~~~------~~~cPV--CK~~Vs~~~vvPl  102 (230)
T KOG0823|consen   58 KDPVVTLCGHLFCWPCLYQWLQTRPN------SKECPV--CKAEVSIDTVVPL  102 (230)
T ss_pred             CCCEEeecccceehHHHHHHHhhcCC------CeeCCc--cccccccceEEee
Confidence            44555679999999999999998764      134665  9998888887666


No 27 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=95.09  E-value=0.02  Score=43.30  Aligned_cols=33  Identities=21%  Similarity=0.653  Sum_probs=24.4

Q ss_pred             CCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccch
Q psy7602          10 ECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGK   52 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~   52 (95)
                      .|||.||..|+...+    . .|.   ..||  .|+..+....
T Consensus        25 ~CGH~~C~sCv~~l~----~-~~~---~~CP--~C~~~lrk~~   57 (309)
T TIGR00570        25 VCGHTLCESCVDLLF----V-RGS---GSCP--ECDTPLRKNN   57 (309)
T ss_pred             CCCCcccHHHHHHHh----c-CCC---CCCC--CCCCccchhh
Confidence            799999999999986    2 232   4799  6877655544


No 28 
>PHA02929 N1R/p28-like protein; Provisional
Probab=94.18  E-value=0.029  Score=41.02  Aligned_cols=31  Identities=23%  Similarity=0.551  Sum_probs=23.1

Q ss_pred             cCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccc
Q psy7602           8 GLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVD   49 (95)
Q Consensus         8 ~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~   49 (95)
                      ..+|+|.||.+|+.++++.         .-.||.  |+..+.
T Consensus       197 l~~C~H~FC~~CI~~Wl~~---------~~tCPl--CR~~~~  227 (238)
T PHA02929        197 LSNCNHVFCIECIDIWKKE---------KNTCPV--CRTPFI  227 (238)
T ss_pred             cCCCCCcccHHHHHHHHhc---------CCCCCC--CCCEee
Confidence            3589999999999999753         136886  776543


No 29 
>KOG2177|consensus
Probab=93.02  E-value=0.054  Score=37.70  Aligned_cols=28  Identities=29%  Similarity=0.834  Sum_probs=23.1

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccC
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCN   45 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~   45 (95)
                      ..+.|||.||..|+.....         ..+.||.  |.
T Consensus        27 ~~l~C~H~~c~~C~~~~~~---------~~~~Cp~--cr   54 (386)
T KOG2177|consen   27 VLLPCGHNFCRACLTRSWE---------GPLSCPV--CR   54 (386)
T ss_pred             ccccccchHhHHHHHHhcC---------CCcCCcc--cC
Confidence            5678999999999999888         2378886  66


No 30 
>PF04564 U-box:  U-box domain;  InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis. Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A ....
Probab=90.94  E-value=0.34  Score=28.76  Aligned_cols=57  Identities=7%  Similarity=-0.075  Sum_probs=32.3

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhHHHHHHHHHHHHHhhC
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEFDVYQGILSNQVTNCR   71 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l~ky~~~l~~~~v~~~   71 (95)
                      .+-+.+++||.|.+.++.+|++.  .      ...||.  ++..++.+++..-...++ .++.|++.|
T Consensus        15 ~dPVi~~~G~tyer~~I~~~l~~--~------~~~~P~--t~~~l~~~~l~pn~~Lk~-~I~~~~~~~   71 (73)
T PF04564_consen   15 RDPVILPSGHTYERSAIERWLEQ--N------GGTDPF--TRQPLSESDLIPNRALKS-AIEEWCAEN   71 (73)
T ss_dssp             SSEEEETTSEEEEHHHHHHHHCT--T------SSB-TT--T-SB-SGGGSEE-HHHHH-HHHHHHHHC
T ss_pred             hCceeCCcCCEEcHHHHHHHHHc--C------CCCCCC--CCCcCCcccceECHHHHH-HHHHHHHHc
Confidence            44456789999999999999987  1      234554  456666655433222222 233555554


No 31 
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=89.99  E-value=0.13  Score=30.80  Aligned_cols=18  Identities=28%  Similarity=0.648  Sum_probs=16.1

Q ss_pred             CCCCchhhHHHHHHHHHh
Q psy7602           9 LECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~   26 (95)
                      ..|||.|-..|++++|+.
T Consensus        48 ~~C~H~FH~~Ci~~Wl~~   65 (73)
T PF12678_consen   48 GPCGHIFHFHCISQWLKQ   65 (73)
T ss_dssp             ETTSEEEEHHHHHHHHTT
T ss_pred             cccCCCEEHHHHHHHHhc
Confidence            479999999999999954


No 32 
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=89.89  E-value=0.16  Score=38.60  Aligned_cols=38  Identities=24%  Similarity=0.552  Sum_probs=27.2

Q ss_pred             CCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccch
Q psy7602           9 LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGK   52 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~   52 (95)
                      ..|||.||.-|++.||..+-+      --.|-++-|...+..+.
T Consensus        41 TtCgHtFCslCIR~hL~~qp~------CP~Cr~~~~esrlr~~s   78 (391)
T COG5432          41 TTCGHTFCSLCIRRHLGTQPF------CPVCREDPCESRLRGSS   78 (391)
T ss_pred             cccccchhHHHHHHHhcCCCC------CccccccHHhhhcccch
Confidence            579999999999999976442      23566666766555443


No 33 
>KOG0287|consensus
Probab=87.85  E-value=0.31  Score=37.81  Aligned_cols=34  Identities=32%  Similarity=0.792  Sum_probs=24.6

Q ss_pred             CCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchh
Q psy7602           9 LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKP   53 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i   53 (95)
                      .+|+|.||.-|++.||..+-+         ||.  |-..+.++.+
T Consensus        39 tpCsHtfCSlCIR~~L~~~p~---------CP~--C~~~~~Es~L   72 (442)
T KOG0287|consen   39 TPCSHTFCSLCIRKFLSYKPQ---------CPT--CCVTVTESDL   72 (442)
T ss_pred             ccccchHHHHHHHHHhccCCC---------CCc--eecccchhhh
Confidence            479999999999999976542         543  6655555544


No 34 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=85.82  E-value=0.67  Score=34.54  Aligned_cols=42  Identities=26%  Similarity=0.406  Sum_probs=26.5

Q ss_pred             CCCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchh
Q psy7602           3 STLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKP   53 (95)
Q Consensus         3 ~~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i   53 (95)
                      +.....+.|||.||..|+-...+.+-       .-.||.  |.....+..+
T Consensus       225 ~~~ps~t~CgHlFC~~Cl~~~~t~~k-------~~~Cpl--CRak~~pk~v  266 (271)
T COG5574         225 PEVPSCTPCGHLFCLSCLLISWTKKK-------YEFCPL--CRAKVYPKKV  266 (271)
T ss_pred             cCCcccccccchhhHHHHHHHHHhhc-------cccCch--hhhhccchhh
Confidence            34455578999999999987532221       234765  7766555443


No 35 
>KOG4739|consensus
Probab=83.53  E-value=0.42  Score=34.94  Aligned_cols=18  Identities=28%  Similarity=0.610  Sum_probs=14.8

Q ss_pred             CCcccCCCCchhhHHHHH
Q psy7602           4 TLMTGLECSHRFCTQCWC   21 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~   21 (95)
                      ..++.++|+|+||..|.+
T Consensus        16 ~~f~LTaC~HvfC~~C~k   33 (233)
T KOG4739|consen   16 DPFFLTACRHVFCEPCLK   33 (233)
T ss_pred             Cceeeeechhhhhhhhcc
Confidence            456667999999999965


No 36 
>KOG2660|consensus
Probab=82.64  E-value=0.44  Score=36.42  Aligned_cols=34  Identities=35%  Similarity=0.870  Sum_probs=25.7

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccc
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDG   51 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~   51 (95)
                      ....|-|.||+.|+-.|++.         ...||.  |+..|..+
T Consensus        30 TI~eCLHTFCkSCivk~l~~---------~~~CP~--C~i~ih~t   63 (331)
T KOG2660|consen   30 TITECLHTFCKSCIVKYLEE---------SKYCPT--CDIVIHKT   63 (331)
T ss_pred             hHHHHHHHHHHHHHHHHHHH---------hccCCc--cceeccCc
Confidence            34579999999999999987         135775  77665554


No 37 
>PF06844 DUF1244:  Protein of unknown function (DUF1244);  InterPro: IPR009654 This family consists of several short bacterial proteins of around 100 residues in length. The function of this family is unknown.; PDB: 2O35_A 3FYB_B.
Probab=81.19  E-value=1.3  Score=26.38  Aligned_cols=20  Identities=20%  Similarity=0.687  Sum_probs=14.2

Q ss_pred             hhhHHHHHHHHHhhhhcCCc
Q psy7602          14 RFCTQCWCEYLTTKIIQEGM   33 (95)
Q Consensus        14 ~FC~~C~~~yl~~~I~~~g~   33 (95)
                      .||++|+..++.....+.|.
T Consensus        11 gFCRNCLskWy~~aA~~~g~   30 (68)
T PF06844_consen   11 GFCRNCLSKWYREAAEERGI   30 (68)
T ss_dssp             S--HHHHHHHHHHHHHHCT-
T ss_pred             HHHHHHHHHHHHHHHHhcCC
Confidence            49999999999998875453


No 38 
>KOG0824|consensus
Probab=80.38  E-value=1.2  Score=33.90  Aligned_cols=40  Identities=28%  Similarity=0.559  Sum_probs=29.0

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF   56 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l   56 (95)
                      +.|.|+|.||--|+++-+..     +   ...|+.  |...|+++.+.+.
T Consensus        21 v~l~C~HkFCyiCiKGsy~n-----d---k~~Cav--CR~pids~i~~~p   60 (324)
T KOG0824|consen   21 VNLYCFHKFCYICIKGSYKN-----D---KKTCAV--CRFPIDSTIDFEP   60 (324)
T ss_pred             ccccccchhhhhhhcchhhc-----C---CCCCce--ecCCCCcchhcch
Confidence            56899999999998764432     2   235775  8888888876544


No 39 
>KOG1428|consensus
Probab=79.11  E-value=5.5  Score=37.00  Aligned_cols=51  Identities=22%  Similarity=0.359  Sum_probs=41.3

Q ss_pred             CCCcccCCCCchhhHHHHHHHHHhhhhcCCc--eeeeecCccccCcccccchhhhH
Q psy7602           3 STLMTGLECSHRFCTQCWCEYLTTKIIQEGM--GQTIACAAHGCNILVDDGKPIEF   56 (95)
Q Consensus         3 ~~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~--~~~i~Cp~~~C~~~i~~~~i~~l   56 (95)
                      ....+.|.|+|.|=..|-+.-|+.+-. +.+  ..-|.||-  |...|....++.|
T Consensus      3499 AAP~IqL~C~HiFHlqC~R~vLE~RW~-GPRItF~FisCPi--C~n~InH~~LkDL 3551 (3738)
T KOG1428|consen 3499 AAPAIQLDCSHIFHLQCCRRVLENRWL-GPRITFGFISCPI--CKNKINHIVLKDL 3551 (3738)
T ss_pred             CCcceecCCccchhHHHHHHHHHhccc-CCeeEEeeeeccc--ccchhhhHHHHHH
Confidence            345678999999999999999999986 444  23689996  9999988877766


No 40 
>KOG0802|consensus
Probab=78.29  E-value=1.6  Score=35.07  Aligned_cols=21  Identities=24%  Similarity=0.575  Sum_probs=18.9

Q ss_pred             cccCCCCchhhHHHHHHHHHh
Q psy7602           6 MTGLECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         6 ~~~l~CgH~FC~~C~~~yl~~   26 (95)
                      ...|.|||.|+..|++.|++.
T Consensus       309 ~~rL~C~Hifh~~CL~~W~er  329 (543)
T KOG0802|consen  309 PKRLPCGHIFHDSCLRSWFER  329 (543)
T ss_pred             cceeecccchHHHHHHHHHHH
Confidence            456899999999999999987


No 41 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=78.17  E-value=0.23  Score=29.49  Aligned_cols=32  Identities=25%  Similarity=0.471  Sum_probs=14.0

Q ss_pred             CCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchh
Q psy7602           9 LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKP   53 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i   53 (95)
                      -.|.|.||..|.++    .+.       ..||.  |....-..++
T Consensus        24 ~~CeH~fCs~Ci~~----~~~-------~~CPv--C~~Paw~qD~   55 (65)
T PF14835_consen   24 GGCEHIFCSSCIRD----CIG-------SECPV--CHTPAWIQDI   55 (65)
T ss_dssp             -SSS--B-TTTGGG----GTT-------TB-SS--S--B-S-SS-
T ss_pred             ccCccHHHHHHhHH----hcC-------CCCCC--cCChHHHHHH
Confidence            47999999999854    331       13775  7765554444


No 42 
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=75.30  E-value=1.2  Score=26.37  Aligned_cols=39  Identities=18%  Similarity=0.396  Sum_probs=20.5

Q ss_pred             CCCCchhhHHHHHHHHHhhhhcCCcee-ee--ecCccccCccccc
Q psy7602           9 LECSHRFCTQCWCEYLTTKIIQEGMGQ-TI--ACAAHGCNILVDD   50 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I~~~g~~~-~i--~Cp~~~C~~~i~~   50 (95)
                      ..|++.|=..|+.+|+++.-. +.+.+ +|  .||.  |+..|+-
T Consensus        26 ~~C~~~fH~~CL~~wf~~~~~-~~~~~~~~~G~CP~--C~~~i~~   67 (70)
T PF11793_consen   26 PSCGKKFHLLCLSEWFLSLEK-SRQSFIPIFGECPY--CSSPISW   67 (70)
T ss_dssp             TT----B-SGGGHHHHHHHHS-SS-TTT--EEE-TT--T-SEEEG
T ss_pred             cccCCHHHHHHHHHHHHHccc-CCeeecccccCCcC--CCCeeeE
Confidence            368999999999999987664 32212 33  7885  8877764


No 43 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=75.21  E-value=1.4  Score=32.02  Aligned_cols=16  Identities=38%  Similarity=0.881  Sum_probs=12.9

Q ss_pred             ccCCCCchhhHHHHHH
Q psy7602           7 TGLECSHRFCTQCWCE   22 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~   22 (95)
                      +...|||.||..|.-.
T Consensus       210 vvt~CGH~FC~~Cai~  225 (259)
T COG5152         210 VVTECGHSFCSLCAIR  225 (259)
T ss_pred             hhhhcchhHHHHHHHH
Confidence            4468999999999753


No 44 
>KOG0311|consensus
Probab=74.17  E-value=0.91  Score=35.23  Aligned_cols=20  Identities=50%  Similarity=0.933  Sum_probs=15.0

Q ss_pred             cccCCCCchhhHHHHHHHHH
Q psy7602           6 MTGLECSHRFCTQCWCEYLT   25 (95)
Q Consensus         6 ~~~l~CgH~FC~~C~~~yl~   25 (95)
                      |....|.|+||.+|+-.-++
T Consensus        57 mttkeClhrfc~~ci~~a~r   76 (381)
T KOG0311|consen   57 MTTKECLHRFCFDCIWKALR   76 (381)
T ss_pred             cccHHHHHHHHHHHHHHHHH
Confidence            44568999999999865443


No 45 
>KOG1734|consensus
Probab=72.45  E-value=1.4  Score=33.28  Aligned_cols=41  Identities=24%  Similarity=0.408  Sum_probs=31.6

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchh
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKP   53 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i   53 (95)
                      ++++.|+|+|+|=..|.+++...     |+  .-+||=  |+..++.+.+
T Consensus       245 enty~LsCnHvFHEfCIrGWciv-----GK--kqtCPY--CKekVdl~rm  285 (328)
T KOG1734|consen  245 ENTYKLSCNHVFHEFCIRGWCIV-----GK--KQTCPY--CKEKVDLKRM  285 (328)
T ss_pred             hhheeeecccchHHHhhhhheee-----cC--CCCCch--HHHHhhHhhh
Confidence            46889999999999999999753     43  357885  8888876543


No 46 
>KOG2979|consensus
Probab=71.91  E-value=6  Score=29.45  Aligned_cols=50  Identities=22%  Similarity=0.354  Sum_probs=32.5

Q ss_pred             cccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccC--cccccchhhhHHHHHHH
Q psy7602           6 MTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCN--ILVDDGKPIEFDVYQGI   62 (95)
Q Consensus         6 ~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~--~~i~~~~i~~l~ky~~~   62 (95)
                      +.+-.|||+|=++=..+|+..      . ..|+||..||.  ..+....+...+-+++-
T Consensus       190 viSkkC~HvydrDsI~~~l~~------~-~~i~CPv~gC~~~~~~~~~~l~~d~el~~k  241 (262)
T KOG2979|consen  190 VISKKCGHVYDRDSIMQILCD------E-ITIRCPVLGCENPYYIQPGHLDEDKELQQK  241 (262)
T ss_pred             hhhcCcCcchhhhhHHHHhcc------C-ceeecccccCCccccccccccCchHHHHHH
Confidence            455679999877766666543      2 35999999999  45555544444344333


No 47 
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=71.27  E-value=2.8  Score=32.15  Aligned_cols=37  Identities=27%  Similarity=0.631  Sum_probs=28.4

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCccccc
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDD   50 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~   50 (95)
                      ++...|+|.|+|-..|...|+.      |.  ..+||.  |+..+++
T Consensus       337 d~~~vlPC~H~FH~~Cv~kW~~------~y--~~~CPv--Crt~iPP  373 (374)
T COG5540         337 DRLRVLPCDHRFHVGCVDKWLL------GY--SNKCPV--CRTAIPP  373 (374)
T ss_pred             ceEEEeccCceechhHHHHHHh------hh--cccCCc--cCCCCCC
Confidence            4456689999999999999874      33  467886  8887765


No 48 
>KOG4159|consensus
Probab=69.69  E-value=8.4  Score=30.29  Aligned_cols=53  Identities=15%  Similarity=0.329  Sum_probs=30.5

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCccccc-chhhh---HHHHHHHHHHHHHhh
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDD-GKPIE---FDVYQGILSNQVTNC   70 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~-~~i~~---l~ky~~~l~~~~v~~   70 (95)
                      +.++|||.||..|+.+    .. +  +  .-.||.  |...+.. ....+   +.++...++.+|++.
T Consensus        98 v~tpcghs~c~~Cl~r----~l-d--~--~~~cp~--Cr~~l~e~~~~~~~~~~~r~~~~li~~F~~~  154 (398)
T KOG4159|consen   98 VVTPCGHSFCLECLDR----SL-D--Q--ETECPL--CRDELVELPALEQALSLNRLLCKLITKFLEG  154 (398)
T ss_pred             ccccccccccHHHHHH----Hh-c--c--CCCCcc--cccccccchHHHHHHHHHHHHHHHHHHhhhh
Confidence            4569999999999555    22 1  2  345665  7765553 22221   255555555555544


No 49 
>KOG1645|consensus
Probab=68.91  E-value=5.1  Score=31.84  Aligned_cols=44  Identities=23%  Similarity=0.432  Sum_probs=32.0

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF   56 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l   56 (95)
                      ..+.++.|||-|=.+|.+.+|- |+.      ...||.  |+..-...+|...
T Consensus        20 hr~vsl~cghlFgs~cie~wl~-k~~------~~~cp~--c~~katkr~i~~e   63 (463)
T KOG1645|consen   20 HRIVSLQCGHLFGSQCIEKWLG-KKT------KMQCPL--CSGKATKRQIRPE   63 (463)
T ss_pred             eEEeeecccccccHHHHHHHHh-hhh------hhhCcc--cCChhHHHHHHHH
Confidence            4567899999999999999994 442      478886  7765555554433


No 50 
>PF12861 zf-Apc11:  Anaphase-promoting complex subunit 11 RING-H2 finger
Probab=67.83  E-value=5.4  Score=24.86  Aligned_cols=32  Identities=28%  Similarity=0.570  Sum_probs=23.4

Q ss_pred             CCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCccc
Q psy7602           9 LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILV   48 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i   48 (95)
                      -.|+|.|-..|+.++|+++-   ++   =.||.  |+...
T Consensus        50 g~C~H~FH~hCI~kWl~~~~---~~---~~CPm--CR~~w   81 (85)
T PF12861_consen   50 GKCSHNFHMHCILKWLSTQS---SK---GQCPM--CRQPW   81 (85)
T ss_pred             ccCccHHHHHHHHHHHcccc---CC---CCCCC--cCCee
Confidence            36999999999999999852   12   26775  65543


No 51 
>KOG1001|consensus
Probab=67.71  E-value=2.7  Score=35.03  Aligned_cols=41  Identities=20%  Similarity=0.474  Sum_probs=27.4

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchh
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKP   53 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i   53 (95)
                      +..+...|||.||.+||..+++..-.  .     .||  .|...+....+
T Consensus       464 ~~~~it~c~h~~c~~c~~~~i~~~~~--~-----~~~--~cr~~l~~~~l  504 (674)
T KOG1001|consen  464 DSFFITRCGHDFCVECLKKSIQQSEN--A-----PCP--LCRNVLKEKKL  504 (674)
T ss_pred             ccceeecccchHHHHHHHhccccccC--C-----CCc--HHHHHHHHHHH
Confidence            34455789999999999999876432  1     444  47655554443


No 52 
>COG3492 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=65.96  E-value=5.3  Score=25.41  Aligned_cols=19  Identities=21%  Similarity=0.663  Sum_probs=15.7

Q ss_pred             hhhHHHHHHHHHhhhhcCC
Q psy7602          14 RFCTQCWCEYLTTKIIQEG   32 (95)
Q Consensus        14 ~FC~~C~~~yl~~~I~~~g   32 (95)
                      -||++|+..|++......|
T Consensus        42 gFCRNCLs~Wy~eaae~~g   60 (104)
T COG3492          42 GFCRNCLSNWYREAAEAQG   60 (104)
T ss_pred             HHHHHHHHHHHHHHHhccC
Confidence            5999999999999885334


No 53 
>KOG2932|consensus
Probab=63.25  E-value=3.2  Score=32.00  Aligned_cols=13  Identities=38%  Similarity=1.088  Sum_probs=11.6

Q ss_pred             CCCCchhhHHHHH
Q psy7602           9 LECSHRFCTQCWC   21 (95)
Q Consensus         9 l~CgH~FC~~C~~   21 (95)
                      ..|.|+||.+|-+
T Consensus       107 IPCkHvFCl~CAr  119 (389)
T KOG2932|consen  107 IPCKHVFCLECAR  119 (389)
T ss_pred             cccchhhhhhhhh
Confidence            5899999999976


No 54 
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=60.22  E-value=2.6  Score=24.22  Aligned_cols=35  Identities=26%  Similarity=0.546  Sum_probs=23.9

Q ss_pred             CcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccch
Q psy7602           5 LMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGK   52 (95)
Q Consensus         5 ~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~   52 (95)
                      .-..++|||.-|.+||-          |. ..-.||-  |...++.+.
T Consensus        19 ~~~~~pCgH~I~~~~f~----------~~-rYngCPf--C~~~~~~~~   53 (55)
T PF14447_consen   19 KGTVLPCGHLICDNCFP----------GE-RYNGCPF--CGTPFEFDD   53 (55)
T ss_pred             ccccccccceeeccccC----------hh-hccCCCC--CCCcccCCC
Confidence            34568999999999993          22 2346775  777666554


No 55 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=57.54  E-value=5.5  Score=22.43  Aligned_cols=12  Identities=33%  Similarity=1.038  Sum_probs=7.3

Q ss_pred             CCCCchhhHHHH
Q psy7602           9 LECSHRFCTQCW   20 (95)
Q Consensus         9 l~CgH~FC~~C~   20 (95)
                      -.|++.||.+|=
T Consensus        25 ~~C~~~FC~dCD   36 (51)
T PF07975_consen   25 PKCKNHFCIDCD   36 (51)
T ss_dssp             TTTT--B-HHHH
T ss_pred             CCCCCccccCcC
Confidence            469999999993


No 56 
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]
Probab=55.74  E-value=7.7  Score=30.70  Aligned_cols=20  Identities=25%  Similarity=0.591  Sum_probs=17.8

Q ss_pred             ccCCCCchhhHHHHHHHHHh
Q psy7602           7 TGLECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~   26 (95)
                      ..|+|||.+-..|++.|++-
T Consensus       314 KrLpCGHilHl~CLknW~ER  333 (491)
T COG5243         314 KRLPCGHILHLHCLKNWLER  333 (491)
T ss_pred             ccccccceeeHHHHHHHHHh
Confidence            45899999999999999874


No 57 
>KOG1039|consensus
Probab=54.27  E-value=6.4  Score=30.36  Aligned_cols=34  Identities=24%  Similarity=0.712  Sum_probs=24.1

Q ss_pred             CCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCc
Q psy7602           9 LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNI   46 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~   46 (95)
                      .+|.|.||..|.+.+=..+-. +.. ..-.||.  |..
T Consensus       185 pnC~H~~Cl~Cir~wr~~~q~-~~~-~sksCP~--CRv  218 (344)
T KOG1039|consen  185 PNCNHSFCLNCIRKWRQATQF-ESK-TSKSCPF--CRV  218 (344)
T ss_pred             CCcchhhhhcHhHhhhhhhcc-ccc-cccCCCc--ccC
Confidence            469999999999988765553 222 3457886  653


No 58 
>KOG2879|consensus
Probab=53.79  E-value=8  Score=29.20  Aligned_cols=37  Identities=19%  Similarity=0.393  Sum_probs=24.9

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccc
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVD   49 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~   49 (95)
                      -.+....|||.||--|.+.-+...+       ..+||.  |+....
T Consensus       251 iP~~~~~C~HiyCY~Ci~ts~~~~a-------sf~Cp~--Cg~~~~  287 (298)
T KOG2879|consen  251 IPHVIGKCGHIYCYYCIATSRLWDA-------SFTCPL--CGENVE  287 (298)
T ss_pred             CCeeeccccceeehhhhhhhhcchh-------hcccCc--cCCCCc
Confidence            3445566999999999876544322       478885  776544


No 59 
>KOG1785|consensus
Probab=53.16  E-value=10  Score=30.38  Aligned_cols=35  Identities=26%  Similarity=0.643  Sum_probs=25.6

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccC
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCN   45 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~   45 (95)
                      .+....+|||-.|..|+..|-.+   ++|+    .||--.|.
T Consensus       380 KdvkIEPCGHLlCt~CLa~WQ~s---d~gq----~CPFCRcE  414 (563)
T KOG1785|consen  380 KDVKIEPCGHLLCTSCLAAWQDS---DEGQ----TCPFCRCE  414 (563)
T ss_pred             CCcccccccchHHHHHHHhhccc---CCCC----CCCceeeE
Confidence            45667799999999999988654   4454    47765554


No 60 
>KOG4692|consensus
Probab=51.85  E-value=9.7  Score=29.99  Aligned_cols=18  Identities=39%  Similarity=0.761  Sum_probs=15.7

Q ss_pred             CCCCchhhHHHHHHHHHh
Q psy7602           9 LECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~   26 (95)
                      .+|+|+-|.+|+.+|+-.
T Consensus       438 ~PC~H~SC~~CI~qHlmN  455 (489)
T KOG4692|consen  438 APCSHRSCYGCITQHLMN  455 (489)
T ss_pred             cCCCCchHHHHHHHHHhc
Confidence            589999999999998753


No 61 
>PF14570 zf-RING_4:  RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B.
Probab=50.40  E-value=11  Score=20.94  Aligned_cols=17  Identities=29%  Similarity=0.888  Sum_probs=10.2

Q ss_pred             CCCCchhhHHHHHHHHH
Q psy7602           9 LECSHRFCTQCWCEYLT   25 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~   25 (95)
                      =.||+..|+.||..-++
T Consensus        18 C~Cgf~IC~~C~~~i~~   34 (48)
T PF14570_consen   18 CECGFQICRFCYHDILE   34 (48)
T ss_dssp             STTS----HHHHHHHTT
T ss_pred             CcCCCcHHHHHHHHHHh
Confidence            36999999999987655


No 62 
>KOG4628|consensus
Probab=49.20  E-value=8  Score=29.93  Aligned_cols=24  Identities=33%  Similarity=0.625  Sum_probs=20.5

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhh
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTK   27 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~   27 (95)
                      +.+..|+|+|.|-.+|..-||...
T Consensus       243 dklRiLPC~H~FH~~CIDpWL~~~  266 (348)
T KOG4628|consen  243 DKLRILPCSHKFHVNCIDPWLTQT  266 (348)
T ss_pred             CeeeEecCCCchhhccchhhHhhc
Confidence            455669999999999999999874


No 63 
>KOG0297|consensus
Probab=46.57  E-value=8  Score=30.07  Aligned_cols=18  Identities=44%  Similarity=1.041  Sum_probs=16.0

Q ss_pred             CCCCchhhHHHHHHHHHh
Q psy7602           9 LECSHRFCTQCWCEYLTT   26 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~   26 (95)
                      ..|||.||..|....++.
T Consensus        38 ~~cgh~fC~~C~~~~~~~   55 (391)
T KOG0297|consen   38 TTCGHRFCAGCLLESLSN   55 (391)
T ss_pred             CCCCCcccccccchhhcc
Confidence            689999999999887776


No 64 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=46.24  E-value=8.6  Score=21.03  Aligned_cols=20  Identities=20%  Similarity=0.615  Sum_probs=15.9

Q ss_pred             CCCCchhhHHHHHHHHHhhh
Q psy7602           9 LECSHRFCTQCWCEYLTTKI   28 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I   28 (95)
                      -.||+.||.+|.........
T Consensus        22 r~Cg~~~C~~C~~~~~~~~~   41 (57)
T cd00065          22 RNCGRIFCSKCSSNRIPLPS   41 (57)
T ss_pred             CcCcCCcChHHcCCeeecCc
Confidence            36999999999998766443


No 65 
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=45.92  E-value=10  Score=24.85  Aligned_cols=20  Identities=20%  Similarity=0.602  Sum_probs=17.1

Q ss_pred             CCCchhhHHHHHHHHHhhhh
Q psy7602          10 ECSHRFCTQCWCEYLTTKII   29 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~~I~   29 (95)
                      .=||.||.+|-+.++++++.
T Consensus        52 GlGqhYCieCaryf~t~~aL   71 (126)
T COG5112          52 GLGQHYCIECARYFITEKAL   71 (126)
T ss_pred             CCceeeeehhHHHHHHHHHH
Confidence            46899999999999987764


No 66 
>PHA03096 p28-like protein; Provisional
Probab=43.11  E-value=19  Score=27.05  Aligned_cols=20  Identities=25%  Similarity=0.446  Sum_probs=18.2

Q ss_pred             CCCchhhHHHHHHHHHhhhh
Q psy7602          10 ECSHRFCTQCWCEYLTTKII   29 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~~I~   29 (95)
                      .|.|.||..|.+.+..++..
T Consensus       203 ~c~h~fc~~ci~~wr~~~~~  222 (284)
T PHA03096        203 EIKHEFNIFCIKIWMTESLY  222 (284)
T ss_pred             cCCcHHHHHHHHHHHHhhhh
Confidence            79999999999999998763


No 67 
>KOG1941|consensus
Probab=42.06  E-value=17  Score=28.98  Aligned_cols=38  Identities=34%  Similarity=0.673  Sum_probs=27.0

Q ss_pred             CCCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccc
Q psy7602           3 STLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVD   49 (95)
Q Consensus         3 ~~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~   49 (95)
                      ++.+-.|+|.|.|=..|...||+.    +|   +=.||.  |+.+++
T Consensus       379 ~e~LqALpCsHIfH~rCl~e~L~~----n~---~rsCP~--CrklrS  416 (518)
T KOG1941|consen  379 NERLQALPCSHIFHLRCLQEILEN----NG---TRSCPN--CRKLRS  416 (518)
T ss_pred             cccccccchhHHHHHHHHHHHHHh----CC---CCCCcc--HHHHHh
Confidence            456678999999999999999943    23   235764  664433


No 68 
>KOG0006|consensus
Probab=41.06  E-value=15  Score=28.63  Aligned_cols=76  Identities=14%  Similarity=0.280  Sum_probs=40.8

Q ss_pred             CCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhHHHHHHHHHHHHHhhCCCCCCC---------CCC
Q psy7602          10 ECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEFDVYQGILSNQVTNCRLASLVP---------CKC   80 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l~ky~~~l~~~~v~~~~~~~~~---------~~~   80 (95)
                      .||-.||++|.+.|-+-.-. .+-..   =-...|.+.+++...++ ++|+.+... -|+.. +.-||         .++
T Consensus       341 gCgf~FCR~C~e~yh~geC~-~~~~a---s~t~tc~y~vde~~a~~-arwd~as~~-TIk~t-TkpCPkChvptErnGGC  413 (446)
T KOG0006|consen  341 GCGFAFCRECKEAYHEGECS-AVFEA---SGTTTCAYRVDERAAEQ-ARWDAASKE-TIKKT-TKPCPKCHVPTERNGGC  413 (446)
T ss_pred             CchhHhHHHHHhhhccccce-eeecc---ccccceeeecChhhhhh-hhhhhhhhh-hhhhc-cCCCCCccCccccCCce
Confidence            59999999999998653332 11100   01124666666644333 455544322 23322 23343         244


Q ss_pred             CCeeeCCCCCCcc
Q psy7602          81 SWVRFPPGADFIL   93 (95)
Q Consensus        81 ~~~~~CP~~~C~~   93 (95)
                      ..++ ||.|.|++
T Consensus       414 mHm~-Ct~~~Cg~  425 (446)
T KOG0006|consen  414 MHMK-CTQPQCGL  425 (446)
T ss_pred             EEee-cCCCCCCc
Confidence            4555 88888876


No 69 
>KOG3579|consensus
Probab=39.71  E-value=14  Score=28.14  Aligned_cols=32  Identities=28%  Similarity=0.698  Sum_probs=25.6

Q ss_pred             CchhhHHHHHHHHHhhhhcCCceeeeecCcc-ccCcc
Q psy7602          12 SHRFCTQCWCEYLTTKIIQEGMGQTIACAAH-GCNIL   47 (95)
Q Consensus        12 gH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~-~C~~~   47 (95)
                      .|.||.-|-++.|+.+=. .|   .++||.. +|..+
T Consensus       291 ~HKFCFPCSResIK~Qg~-sg---evYCPSGdkCPLv  323 (352)
T KOG3579|consen  291 SHKFCFPCSRESIKQQGA-SG---EVYCPSGDKCPLV  323 (352)
T ss_pred             ccceecccCHHHHHhhcC-CC---ceeCCCCCcCccc
Confidence            699999999999998775 44   5899986 57643


No 70 
>PF01530 zf-C2HC:  Zinc finger, C2HC type;  InterPro: IPR002515 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (C2HC) type zinc finger domain found in eukaryotes. Proteins containing these domains include:   MYST family histone acetyltransferases [, [] Myelin transcription factor Myt1 [] Suppressor of tumourigenicity protein 18 (ST18) []   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2CS8_A 1PXE_A 2JX1_A 2JYD_A.
Probab=38.89  E-value=17  Score=18.41  Aligned_cols=10  Identities=20%  Similarity=0.079  Sum_probs=6.1

Q ss_pred             CCCCCCccCC
Q psy7602          86 PPGADFILNG   95 (95)
Q Consensus        86 CP~~~C~~~~   95 (95)
                      ||.|+|.=.|
T Consensus         4 CPtpGCdg~G   13 (31)
T PF01530_consen    4 CPTPGCDGSG   13 (31)
T ss_dssp             SSSTT--SCS
T ss_pred             CCCCCCCccc
Confidence            9999997443


No 71 
>KOG1813|consensus
Probab=37.47  E-value=13  Score=28.27  Aligned_cols=18  Identities=28%  Similarity=0.632  Sum_probs=14.0

Q ss_pred             ccCCCCchhhHHHHHHHH
Q psy7602           7 TGLECSHRFCTQCWCEYL   24 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl   24 (95)
                      +...|+|.||..|-...+
T Consensus       255 Vvt~c~h~fc~~ca~~~~  272 (313)
T KOG1813|consen  255 VVTKCGHYFCEVCALKPY  272 (313)
T ss_pred             hhhcCCceeehhhhcccc
Confidence            456899999999976544


No 72 
>PF01776 Ribosomal_L22e:  Ribosomal L22e protein family;  InterPro: IPR002671 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L22e forms part of the 60S ribosomal subunit []. This family is found in eukaryotes. Rattus norvegicus (Rat) L22 is related to ribosomal proteins from other eukaryotes and is identical in amino acid sequence to human EAP, the EBER 1 (Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4) encoded RNA) associated protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1D_M 4A1B_M 4A19_M 4A18_M 3IZR_W 3IZS_W.
Probab=35.96  E-value=59  Score=21.23  Aligned_cols=51  Identities=16%  Similarity=0.236  Sum_probs=27.5

Q ss_pred             HHHHHHhhhhcCCceee----eecCccccCcccccchhhhH-HHHHHHHHHHHHhhCC
Q psy7602          20 WCEYLTTKIIQEGMGQT----IACAAHGCNILVDDGKPIEF-DVYQGILSNQVTNCRL   72 (95)
Q Consensus        20 ~~~yl~~~I~~~g~~~~----i~Cp~~~C~~~i~~~~i~~l-~ky~~~l~~~~v~~~~   72 (95)
                      +..||+.+|+=+|....    +..-..+=...++. .+ .+ .+|.+.|-+.|+..+.
T Consensus        26 fe~fL~erIKV~gk~gnlg~~V~i~~~~~ki~V~s-~v-~fsKrYLKYLTKKyLKK~~   81 (112)
T PF01776_consen   26 FEKFLQERIKVNGKTGNLGNKVTISRDKNKITVTS-EV-PFSKRYLKYLTKKYLKKNN   81 (112)
T ss_dssp             HHHHHHHHHHHHSCSSSSTTTEEEEE-SSEEEEEE-SS-S-SHHHHHHHHHHHHTTSS
T ss_pred             HHHHHHHheEeCCcccccCCeEEEEecCCEEEEEe-cc-cccHHHHHHHHHHHHhhcc
Confidence            56788887764443222    22211111111211 12 33 9999999999998773


No 73 
>KOG2930|consensus
Probab=35.67  E-value=29  Score=22.59  Aligned_cols=19  Identities=32%  Similarity=0.726  Sum_probs=17.1

Q ss_pred             CCCchhhHHHHHHHHHhhh
Q psy7602          10 ECSHRFCTQCWCEYLTTKI   28 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~~I   28 (95)
                      .|.|.|=..|+..+|.++-
T Consensus        80 ~CNHaFH~hCisrWlktr~   98 (114)
T KOG2930|consen   80 VCNHAFHFHCISRWLKTRN   98 (114)
T ss_pred             ecchHHHHHHHHHHHhhcC
Confidence            5999999999999998864


No 74 
>KOG3408|consensus
Probab=34.69  E-value=17  Score=24.24  Aligned_cols=20  Identities=15%  Similarity=0.501  Sum_probs=17.4

Q ss_pred             CCCchhhHHHHHHHHHhhhh
Q psy7602          10 ECSHRFCTQCWCEYLTTKII   29 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~~I~   29 (95)
                      +=|+.||..|-+.++.+++.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l   73 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKAL   73 (129)
T ss_pred             CCceeehhhhhhhhcchHHH
Confidence            36899999999999988876


No 75 
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]
Probab=34.16  E-value=30  Score=21.54  Aligned_cols=17  Identities=35%  Similarity=0.843  Sum_probs=16.0

Q ss_pred             CCCchhhHHHHHHHHHh
Q psy7602          10 ECSHRFCTQCWCEYLTT   26 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~   26 (95)
                      -|.|.|=..|+..+|.+
T Consensus        53 ~CnHaFH~HCI~rWL~T   69 (88)
T COG5194          53 VCNHAFHDHCIYRWLDT   69 (88)
T ss_pred             ecchHHHHHHHHHHHhh
Confidence            49999999999999998


No 76 
>KOG0828|consensus
Probab=33.84  E-value=33  Score=28.22  Aligned_cols=32  Identities=22%  Similarity=0.594  Sum_probs=23.2

Q ss_pred             cCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccc
Q psy7602           8 GLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVD   49 (95)
Q Consensus         8 ~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~   49 (95)
                      ..+|.|.|=+.|++++..      +.  .+.||.  |+..++
T Consensus       603 ~tPC~HifH~~CL~~WMd------~y--kl~CPv--CR~pLP  634 (636)
T KOG0828|consen  603 LTPCHHIFHRQCLLQWMD------TY--KLICPV--CRCPLP  634 (636)
T ss_pred             ccchHHHHHHHHHHHHHh------hh--cccCCc--cCCCCC
Confidence            358999999999999865      22  366776  555554


No 77 
>PF04891 NifQ:  NifQ;  InterPro: IPR006975 NifQ is involved in early stages of the biosynthesis of the iron-molybdenum cofactor (FeMo-co) [], which is an integral part of the active site of dinitrogenase []. The conserved C-terminal cysteine residues may be involved in metal binding [].; GO: 0030151 molybdenum ion binding, 0009399 nitrogen fixation
Probab=33.67  E-value=44  Score=23.18  Aligned_cols=27  Identities=4%  Similarity=-0.084  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHhhCCCCCCCCCCCCeeeCCCCCCcc
Q psy7602          57 DVYQGILSNQVTNCRLASLVPCKCSWVRFPPGADFIL   93 (95)
Q Consensus        57 ~ky~~~l~~~~v~~~~~~~~~~~~~~~~~CP~~~C~~   93 (95)
                      -||+||+-++.=++.          .+.=|+.|.|..
T Consensus       132 MrWKKFfYrqlCe~e----------G~~~C~aPsC~~  158 (167)
T PF04891_consen  132 MRWKKFFYRQLCERE----------GLYLCRAPSCEE  158 (167)
T ss_pred             CcHHHHHHHHHHHHc----------CCCcCCCCCCCC
Confidence            678888887766666          455588988863


No 78 
>KOG0827|consensus
Probab=33.33  E-value=32  Score=27.42  Aligned_cols=26  Identities=19%  Similarity=0.459  Sum_probs=21.0

Q ss_pred             CCcccCC-CCchhhHHHHHHHHHhhhh
Q psy7602           4 TLMTGLE-CSHRFCTQCWCEYLTTKII   29 (95)
Q Consensus         4 ~~~~~l~-CgH~FC~~C~~~yl~~~I~   29 (95)
                      .++-..+ |||.|=..|+.+|.+..-.
T Consensus        18 ~~l~~i~~cGhifh~~cl~qwfe~~Ps   44 (465)
T KOG0827|consen   18 HELGPIGTCGHIFHTTCLTQWFEGDPS   44 (465)
T ss_pred             cccccccchhhHHHHHHHHHHHccCCc
Confidence            3445555 9999999999999988765


No 79 
>PF14353 CpXC:  CpXC protein
Probab=33.07  E-value=35  Score=21.88  Aligned_cols=23  Identities=26%  Similarity=0.521  Sum_probs=17.2

Q ss_pred             HHHhhhhcCCceeeeecCccccCccc
Q psy7602          23 YLTTKIIQEGMGQTIACAAHGCNILV   48 (95)
Q Consensus        23 yl~~~I~~~g~~~~i~Cp~~~C~~~i   48 (95)
                      =+..+|. +|..+..+||.  |+..+
T Consensus        26 ~l~e~il-~g~l~~~~CP~--Cg~~~   48 (128)
T PF14353_consen   26 ELKEKIL-DGSLFSFTCPS--CGHKF   48 (128)
T ss_pred             HHHHHHH-cCCcCEEECCC--CCCce
Confidence            3577887 68878999997  76543


No 80 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF10426 zf-RAG1:  Recombination-activating protein 1 zinc-finger domain;  InterPro: IPR019485 During lymphocyte development, the genes encoding immunoglobulins and T-cell receptors are assembled from variable (V), diversity (D), and joining (J) gene segments. This combinatorial process, known as V(D)J recombination, allows the generation of an enormous range of binding specificities from a limited amount of genetic information. The V(D)J recombination-activating proteins 1 and 2 (RAG1 and RAG2) form a complex that initiates this process by binding to the conserved recombination signal sequences (RSS) and introducing a double-strand break between the RSS and the adjacent coding segment. These breaks are generated in two steps, nicking of one strand (hydrolysis), followed by hairpin formation (transesterification). RAG1/2 has also been shown to function as a transposase in vitro, and to possess RSS-independent endonuclease activity (end processing) and hairpin opening. RAG1 alone can bind to RSS but stable, efficient binding requires RAG2. All known catalytic activities require the presence of both proteins. For more information see []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets [].  This entry represents a C2H2-type zinc-finger domain found in the RAG1 protein. The structure contains the characteristic two-stranded beta-sheet and alpha-helix of a classical zinc-finger. The domain binds one zinc and, in complex with an adjacent RING-type zinc finger domain, helps to stabilise the whole of the dimerisation region of recombination activating protein 1 (RAG1) []. The function of the whole is to bind double-stranded DNA. ; GO: 0016788 hydrolase activity, acting on ester bonds, 0016881 acid-amino acid ligase activity; PDB: 1RMD_A.
Probab=32.83  E-value=17  Score=18.33  Aligned_cols=15  Identities=20%  Similarity=0.516  Sum_probs=7.7

Q ss_pred             eeecCccccCccccc
Q psy7602          36 TIACAAHGCNILVDD   50 (95)
Q Consensus        36 ~i~Cp~~~C~~~i~~   50 (95)
                      .++||.-+|...|..
T Consensus         2 ~vrCPvkdC~EEv~l   16 (30)
T PF10426_consen    2 VVRCPVKDCDEEVSL   16 (30)
T ss_dssp             EEE--STT---EEEH
T ss_pred             ccccccccCcchhhh
Confidence            489999999987764


No 82 
>KOG2594|consensus
Probab=32.58  E-value=47  Score=26.14  Aligned_cols=23  Identities=22%  Similarity=0.439  Sum_probs=18.7

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhh
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKII   29 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~   29 (95)
                      +.++=.-.||.+|+.+|++.|++
T Consensus        26 ~v~~~k~~~C~eCFv~~v~~KfR   48 (396)
T KOG2594|consen   26 TVDGKKDAFCDECFVNNVRNKFR   48 (396)
T ss_pred             cccccchhHHHHHHHHHHHHHHH
Confidence            33444558999999999999998


No 83 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=30.01  E-value=32  Score=26.59  Aligned_cols=29  Identities=28%  Similarity=0.769  Sum_probs=19.9

Q ss_pred             cCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCc
Q psy7602           8 GLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNI   46 (95)
Q Consensus         8 ~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~   46 (95)
                      .-.|+|.||.+|+..-|    .|    ....||.  |..
T Consensus       290 T~cC~~~fc~eci~~al----~d----sDf~Cpn--C~r  318 (427)
T COG5222         290 TPCCGHTFCDECIGTAL----LD----SDFKCPN--CSR  318 (427)
T ss_pred             CccccchHHHHHHhhhh----hh----ccccCCC--ccc
Confidence            34799999999987543    32    1467885  764


No 84 
>KOG0825|consensus
Probab=29.97  E-value=31  Score=30.02  Aligned_cols=17  Identities=24%  Similarity=0.630  Sum_probs=13.9

Q ss_pred             CCCCchhhHHHHHHHHH
Q psy7602           9 LECSHRFCTQCWCEYLT   25 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~   25 (95)
                      ..|+|.||..|+..|-+
T Consensus       142 k~c~H~FC~~Ci~sWsR  158 (1134)
T KOG0825|consen  142 KHTAHYFCEECVGSWSR  158 (1134)
T ss_pred             cccccccHHHHhhhhhh
Confidence            46999999999887654


No 85 
>KOG4185|consensus
Probab=29.82  E-value=28  Score=25.47  Aligned_cols=39  Identities=28%  Similarity=0.644  Sum_probs=27.8

Q ss_pred             cCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcc--cccchhhhH
Q psy7602           8 GLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNIL--VDDGKPIEF   56 (95)
Q Consensus         8 ~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~--i~~~~i~~l   56 (95)
                      .|.|||.+|..|....+..     +   .|.||  -|...  ++...++.+
T Consensus        24 ~l~c~h~~c~~c~~~l~~~-----~---~i~cp--fcR~~~~~~~~~~~~l   64 (296)
T KOG4185|consen   24 VLKCGHTICQNCASKLLGN-----S---RILCP--FCRETTEIPDGDVKSL   64 (296)
T ss_pred             ccccCceehHhHHHHHhcC-----c---eeecc--CCCCcccCCchhHhhh
Confidence            3679999999998876543     2   35664  47766  777777777


No 86 
>KOG3039|consensus
Probab=29.61  E-value=34  Score=25.72  Aligned_cols=20  Identities=15%  Similarity=0.095  Sum_probs=17.4

Q ss_pred             CCCchhhHHHHHHHHHhhhh
Q psy7602          10 ECSHRFCTQCWCEYLTTKII   29 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~~I~   29 (95)
                      .=||.||++|+-+||.++=+
T Consensus        60 ~~GylfdrEaILe~ilaqKk   79 (303)
T KOG3039|consen   60 PDGYLFDREAILEYILAQKK   79 (303)
T ss_pred             CCCeeeeHHHHHHHHHHHHH
Confidence            44899999999999998776


No 87 
>PF04641 Rtf2:  Rtf2 RING-finger
Probab=27.82  E-value=66  Score=23.40  Aligned_cols=36  Identities=19%  Similarity=0.359  Sum_probs=26.0

Q ss_pred             CCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH
Q psy7602           9 LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF   56 (95)
Q Consensus         9 l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l   56 (95)
                      -+|||+|....+++.   + . +     -.||.  |+..+..++|..|
T Consensus       133 ~~cG~V~s~~alke~---k-~-~-----~~Cp~--c~~~f~~~DiI~L  168 (260)
T PF04641_consen  133 RPCGCVFSEKALKEL---K-K-S-----KKCPV--CGKPFTEEDIIPL  168 (260)
T ss_pred             cCCCCEeeHHHHHhh---c-c-c-----ccccc--cCCccccCCEEEe
Confidence            389999999999887   1 2 1     22775  8887777766555


No 88 
>KOG4445|consensus
Probab=27.78  E-value=49  Score=25.57  Aligned_cols=25  Identities=28%  Similarity=0.513  Sum_probs=20.8

Q ss_pred             CCcccCCCCchhhHHHHHHHHHhhh
Q psy7602           4 TLMTGLECSHRFCTQCWCEYLTTKI   28 (95)
Q Consensus         4 ~~~~~l~CgH~FC~~C~~~yl~~~I   28 (95)
                      ..++...|-|+|=..|+..||+...
T Consensus       129 ~~ft~T~C~Hy~H~~ClaRyl~~~~  153 (368)
T KOG4445|consen  129 PAFTVTACDHYMHFACLARYLTECL  153 (368)
T ss_pred             CceeeehhHHHHHHHHHHHHHHHHH
Confidence            3467789999999999999987644


No 89 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=27.60  E-value=16  Score=20.39  Aligned_cols=26  Identities=27%  Similarity=0.519  Sum_probs=15.7

Q ss_pred             hHHHHHHHHHhhhhcCCceeeeecCccccCccc
Q psy7602          16 CTQCWCEYLTTKIIQEGMGQTIACAAHGCNILV   48 (95)
Q Consensus        16 C~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i   48 (95)
                      |..|++.+  ..+. .+  ..|+||.  |+..|
T Consensus         9 C~~Cg~~~--~~~~-~~--~~irCp~--Cg~rI   34 (49)
T COG1996           9 CARCGREV--ELDQ-ET--RGIRCPY--CGSRI   34 (49)
T ss_pred             hhhcCCee--ehhh-cc--CceeCCC--CCcEE
Confidence            66777777  3232 22  3699996  77643


No 90 
>KOG3002|consensus
Probab=27.60  E-value=37  Score=25.68  Aligned_cols=10  Identities=30%  Similarity=0.816  Sum_probs=7.9

Q ss_pred             CchhhHHHHH
Q psy7602          12 SHRFCTQCWC   21 (95)
Q Consensus        12 gH~FC~~C~~   21 (95)
                      ||--|..|-.
T Consensus        68 GHlaCssC~~   77 (299)
T KOG3002|consen   68 GHLACSSCRT   77 (299)
T ss_pred             CcEehhhhhh
Confidence            7888888873


No 91 
>KOG3434|consensus
Probab=25.97  E-value=80  Score=21.03  Aligned_cols=54  Identities=9%  Similarity=0.018  Sum_probs=29.1

Q ss_pred             HHHHHHHHhhhhcCCceeeeecCcc--ccCccccc-chhhhHHHHHHHHHHHHHhhC
Q psy7602          18 QCWCEYLTTKIIQEGMGQTIACAAH--GCNILVDD-GKPIEFDVYQGILSNQVTNCR   71 (95)
Q Consensus        18 ~C~~~yl~~~I~~~g~~~~i~Cp~~--~C~~~i~~-~~i~~l~ky~~~l~~~~v~~~   71 (95)
                      +=+.+||.++|+-+|..-++.=...  .=+..|+- +......+|.++|.+.|++.|
T Consensus        36 A~fe~fLqerIKv~GK~gnLg~vv~ie~~kskitV~s~~~Fs~rylKyltkkYLkk~   92 (125)
T KOG3434|consen   36 ADLEKFLQERIKVNGKVGNLGNVVTIERSKSKITVVSTVHFSKRYLKYLTKKYLKKN   92 (125)
T ss_pred             HHHHHHHHHHhhhcccccccCCeEEEecCCcEEEEEecCCccHHHHHHHHHHHHhhh
Confidence            4478899999886665433310000  00001111 011111899999999999887


No 92 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=24.47  E-value=27  Score=22.85  Aligned_cols=23  Identities=22%  Similarity=0.544  Sum_probs=15.1

Q ss_pred             ccCCCCchhhH--HHHHHHHHhhhh
Q psy7602           7 TGLECSHRFCT--QCWCEYLTTKII   29 (95)
Q Consensus         7 ~~l~CgH~FC~--~C~~~yl~~~I~   29 (95)
                      +.-.|||.||.  +=|+.+....++
T Consensus        25 vkc~CGh~f~d~r~NwK~~alv~vR   49 (112)
T PF08882_consen   25 VKCDCGHEFCDARENWKLGALVYVR   49 (112)
T ss_pred             eeccCCCeecChhcChhhCcEEEec
Confidence            33469999996  556666555444


No 93 
>KOG3268|consensus
Probab=22.79  E-value=1.5e+02  Score=21.32  Aligned_cols=40  Identities=18%  Similarity=0.492  Sum_probs=29.9

Q ss_pred             ccCCCCchhhHHHHHHHHHhhhhcCCceeee---ecCccccCcccc
Q psy7602           7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTI---ACAAHGCNILVD   49 (95)
Q Consensus         7 ~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i---~Cp~~~C~~~i~   49 (95)
                      ....||..|=.-|+..||+.-.. .-+++.|   .||-  |...|.
T Consensus       186 dN~qCgkpFHqiCL~dWLRgilT-sRQSFdiiFGeCPY--CS~Pia  228 (234)
T KOG3268|consen  186 DNIQCGKPFHQICLTDWLRGILT-SRQSFDIIFGECPY--CSDPIA  228 (234)
T ss_pred             cccccCCcHHHHHHHHHHHHHhh-ccceeeeeeccCCC--CCCcce
Confidence            34679999999999999998886 5676666   5664  655443


No 94 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=22.36  E-value=11  Score=21.50  Aligned_cols=17  Identities=18%  Similarity=0.676  Sum_probs=10.4

Q ss_pred             CCCchhhHHHHHHHHHh
Q psy7602          10 ECSHRFCTQCWCEYLTT   26 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~   26 (95)
                      .||+.||.+|....+..
T Consensus        30 ~CG~~vC~~Cs~~~~~~   46 (69)
T PF01363_consen   30 NCGRVVCSSCSSQRIPL   46 (69)
T ss_dssp             TT--EEECCCS-EEEEE
T ss_pred             CCCCEECCchhCCEEcc
Confidence            49999999998665543


No 95 
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=21.85  E-value=21  Score=22.87  Aligned_cols=23  Identities=22%  Similarity=0.469  Sum_probs=16.3

Q ss_pred             cccCCCCchhhHHHHHHHHHhhh
Q psy7602           6 MTGLECSHRFCTQCWCEYLTTKI   28 (95)
Q Consensus         6 ~~~l~CgH~FC~~C~~~yl~~~I   28 (95)
                      ....+|+|++|..|=..+-+.=+
T Consensus        53 ~~~~SCk~R~CP~C~~~~~~~W~   75 (111)
T PF14319_consen   53 IVYNSCKNRHCPSCQAKATEQWI   75 (111)
T ss_pred             EecCcccCcCCCCCCChHHHHHH
Confidence            45578999999999765444333


No 96 
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=21.71  E-value=38  Score=18.94  Aligned_cols=11  Identities=27%  Similarity=0.232  Sum_probs=7.1

Q ss_pred             eeCCCCCCccC
Q psy7602          84 RFPPGADFILN   94 (95)
Q Consensus        84 ~~CP~~~C~~~   94 (95)
                      --||+|+|.=+
T Consensus         7 l~C~Np~CITn   17 (52)
T PF02748_consen    7 LKCPNPNCITN   17 (52)
T ss_dssp             SE-SSTTBTTT
T ss_pred             EEcCCCCcccC
Confidence            34999999643


No 97 
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]
Probab=21.41  E-value=30  Score=25.88  Aligned_cols=31  Identities=35%  Similarity=0.945  Sum_probs=23.4

Q ss_pred             CCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCccc
Q psy7602          10 ECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILV   48 (95)
Q Consensus        10 ~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i   48 (95)
                      .|-|+.|-.|.-     +|...|   +-.||-.+|+.++
T Consensus        33 ECyHrmCESCvd-----RIFs~G---pAqCP~~gC~kIL   63 (314)
T COG5220          33 ECYHRMCESCVD-----RIFSRG---PAQCPYKGCGKIL   63 (314)
T ss_pred             HHHHHHHHHHHH-----HHhcCC---CCCCCCccHHHHH
Confidence            499999999975     455334   5789999998654


No 98 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=21.27  E-value=46  Score=15.91  Aligned_cols=6  Identities=33%  Similarity=0.932  Sum_probs=3.5

Q ss_pred             CCCchh
Q psy7602          10 ECSHRF   15 (95)
Q Consensus        10 ~CgH~F   15 (95)
                      .|||.|
T Consensus        19 ~CG~~F   24 (26)
T PF10571_consen   19 HCGYDF   24 (26)
T ss_pred             CCCCCC
Confidence            366655


No 99 
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=20.10  E-value=19  Score=20.20  Aligned_cols=9  Identities=33%  Similarity=1.198  Sum_probs=1.8

Q ss_pred             chhhHHHHH
Q psy7602          13 HRFCTQCWC   21 (95)
Q Consensus        13 H~FC~~C~~   21 (95)
                      -.+|+.||.
T Consensus         2 r~nCKsCWf   10 (50)
T PF03854_consen    2 RYNCKSCWF   10 (50)
T ss_dssp             -----SS-S
T ss_pred             CccChhhhh
Confidence            345666664


Done!