Diaphorina citri psyllid: psy7627


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MGFFTPNRMVINAAIAAFCLEVIARHGEPAERLCNKDPLTLKSADYLSEIFPFAKFIFMVRDGRATVHSIISRKVTITGFDLESYRQCLKKWNEAISIMYQKCLRVGPSRCMVVYYEQLVLHPEKWLRRILQFFDLGWNSSVLHHEEMINKPGGVFLS
cccccccHHHHHHHHHHHHHHHHHHccccccCEECcccccHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHcHHHHHHHHHHHcccccccccccHHHHHccccccccc
*GFFTPNRMVINAAIAAFCLEVIARHGEPAERLCNKDPLTLKSADYLSEIFPFAKFIFMVRDGRATVHSIISRKVTITGFDLESYRQCLKKWNEAISIMYQKCLRVGPSRCMVVYYEQLVLHPEKWLRRILQFFDLGWNSSVLHHEEMI*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFFTPNRMVINAAIAAFCLEVIARHGEPAERLCNKDPLTLKSADYLSEIFPFAKFIFMVRDGRATVHSIISRKVTITGFDLESYRQCLKKWNEAISIMYQKCLRVGPSRCMVVYYEQLVLHPEKWLRRILQFFDLGWNSSVLHHEEMINKPGGVFLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein-tyrosine sulfotransferase Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides (By similarity). Has a role in protein secretion.confidentQ9VYB7
Protein-tyrosine sulfotransferase 1 Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides.confidentQ3KR92
Protein-tyrosine sulfotransferase 1 Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides.confidentO70281

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009306 [BP]protein secretionprobableGO:0033036, GO:0046903, GO:0006810, GO:0071702, GO:0044765, GO:0045184, GO:0032940, GO:0008104, GO:0044763, GO:0051649, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AP1, chain A
Confidence level:very confident
Coverage over the Query: 5-155
View the alignment between query and template
View the model in PyMOL