Query         psy7641
Match_columns 85
No_of_seqs    131 out of 692
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:38:26 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7641.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7641hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK13529 malate dehydrogenase;  99.9 1.3E-23 2.8E-28  169.8   6.9   76   10-85      3-81  (563)
  2 PTZ00317 NADP-dependent malic   99.9 3.2E-23   7E-28  167.5   6.4   72   14-85      9-83  (559)
  3 PLN03129 NADP-dependent malic   99.9 1.2E-22 2.5E-27  164.8   5.9   65   21-85     39-106 (581)
  4 KOG1257|consensus               99.9 4.9E-22 1.1E-26  159.9   6.0   68   18-85     25-95  (582)
  5 COG0281 SfcA Malic enzyme [Ene  71.8     2.4 5.1E-05   34.5   1.5   27   54-81      1-28  (432)
  6 PF09036 Bcr-Abl_Oligo:  Bcr-Ab  65.4     3.4 7.4E-05   26.2   1.0   32   53-84     27-62  (79)
  7 PF13877 RPAP3_C:  Potential Mo  53.4      18  0.0004   22.3   2.9   31   51-84      1-31  (94)
  8 PF04697 Pinin_SDK_N:  pinin/SD  49.6     9.7 0.00021   26.5   1.2   27   52-78      3-29  (134)
  9 PF14743 DNA_ligase_OB_2:  DNA   47.2     8.8 0.00019   23.1   0.6   17   32-48     25-41  (66)
 10 PF10410 DnaB_bind:  DnaB-helic  44.7      28 0.00061   19.3   2.5   23   62-84     26-48  (59)
 11 COG4235 Cytochrome c biogenesi  38.6      45 0.00098   25.7   3.5   33   50-82    131-163 (287)
 12 PF09006 Surfac_D-trimer:  Lung  38.4      15 0.00033   21.2   0.7   25   55-79      2-26  (46)
 13 cd06150 YjgF_YER057c_UK114_lik  36.6      40 0.00087   21.1   2.5   25   46-70     15-40  (105)
 14 COG0669 CoaD Phosphopantethein  36.2      19 0.00042   25.6   1.1   19   26-44     35-54  (159)
 15 PF06737 Transglycosylas:  Tran  34.9      72  0.0016   20.1   3.4   39   32-70     29-68  (77)
 16 TIGR00004 endoribonuclease L-P  34.5      45 0.00099   21.4   2.6   16   55-70     44-59  (124)
 17 TIGR03391 FeS_syn_CsdE cystein  33.8      63  0.0014   22.1   3.3   27   58-84      9-35  (138)
 18 PF00373 FERM_M:  FERM central   33.8      43 0.00092   20.8   2.3   33   52-84     83-115 (126)
 19 PF02731 SKIP_SNW:  SKIP/SNW do  33.6      30 0.00064   24.6   1.7   42   25-80     50-92  (158)
 20 cd08041 OBF_kDNA_ligase_like T  32.4      29 0.00062   20.9   1.3   14   32-45     36-49  (77)
 21 cd06156 eu_AANH_C_2 A group of  30.0      65  0.0014   20.9   2.8   16   55-70     29-44  (118)
 22 cd07971 OBF_DNA_ligase_LigD Th  30.0      31 0.00068   22.1   1.2   13   32-44     39-51  (115)
 23 PF15225 IL32:  Interleukin 32   29.3      50  0.0011   21.8   2.1   37   35-71      4-50  (104)
 24 cd08040 OBF_DNA_ligase_family   28.9      34 0.00074   21.7   1.3   13   32-44     40-52  (108)
 25 cd06155 eu_AANH_C_1 A group of  27.6      81  0.0018   19.6   2.8   17   54-70     21-37  (101)
 26 cd00448 YjgF_YER057c_UK114_fam  27.2      86  0.0019   18.8   2.9   17   54-70     27-43  (107)
 27 KOG4117|consensus               26.8      44 0.00096   20.8   1.4   28   52-79     30-57  (73)
 28 cd06154 YjgF_YER057c_UK114_lik  24.7      78  0.0017   20.3   2.4   16   55-70     40-55  (119)
 29 PF09776 Mitoc_L55:  Mitochondr  23.6      90  0.0019   21.1   2.6   47    5-52     45-92  (116)
 30 PF04679 DNA_ligase_A_C:  ATP d  23.0      44 0.00095   20.7   0.9   13   32-44     26-38  (97)
 31 cd06152 YjgF_YER057c_UK114_lik  22.0 1.1E+02  0.0025   19.7   2.8   16   55-70     30-45  (114)
 32 KOG0969|consensus               21.5      55  0.0012   29.3   1.5   48   28-79    602-649 (1066)
 33 cd06151 YjgF_YER057c_UK114_lik  20.4      87  0.0019   20.3   2.0   16   55-70     37-52  (126)

No 1  
>PRK13529 malate dehydrogenase; Provisional
Probab=99.89  E-value=1.3e-23  Score=169.84  Aligned_cols=76  Identities=32%  Similarity=0.512  Sum_probs=72.1

Q ss_pred             cCCCCCcceecccchhhhhhCC---CCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhccCChhhHHHHHHhcC
Q psy7641          10 EDEQGFPSSQVNLRLHSILRQS---MGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFTYLSELQ   85 (85)
Q Consensus        10 ~~~~~~~~~~~~~~g~~~l~~p---KGtaFt~eER~~lgl~GLLPp~v~tle~Q~~R~~~~l~~~~t~L~Ky~yL~~L~   85 (85)
                      .+..+.....+..+|.++|+||   ||||||.+||++|||+|||||+|+|+|+|++||+.||+++++||+||+||++||
T Consensus         3 ~~~~~~~~~~~~~~G~~lL~~p~~NKgtaFt~~ER~~lgl~GLLPp~v~t~e~Q~~R~~~~~~~~~~~l~ky~~L~~L~   81 (563)
T PRK13529          3 RDEKKKRPLYTPLRGPALLNNPLLNKGTAFTEEEREEFGLEGLLPPAVETLEEQAERAYRQYQSKPTDLEKHIYLRNLQ   81 (563)
T ss_pred             cccCCCcceeecccchhhhcCcccccccCCCHHHHHhcCCCCCCCCCccCHHHHHHHHHHHHhcCCChHHHHHHHHHHH
Confidence            4566777888899999999999   999999999999999999999999999999999999999999999999999986


No 2  
>PTZ00317 NADP-dependent malic enzyme; Provisional
Probab=99.88  E-value=3.2e-23  Score=167.47  Aligned_cols=72  Identities=33%  Similarity=0.594  Sum_probs=68.4

Q ss_pred             CCcceecccchhhhhhCC---CCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhccCChhhHHHHHHhcC
Q psy7641          14 GFPSSQVNLRLHSILRQS---MGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFTYLSELQ   85 (85)
Q Consensus        14 ~~~~~~~~~~g~~~l~~p---KGtaFt~eER~~lgl~GLLPp~v~tle~Q~~R~~~~l~~~~t~L~Ky~yL~~L~   85 (85)
                      +.+...+..+|.++|+||   ||||||.+||++|||+|||||+|+|+|+|++||+.+++++++||+||+||++||
T Consensus         9 ~~~~~~~~~~G~~lL~~p~~NKgtAFt~~ER~~l~l~GLlPp~v~t~e~Q~~R~~~~~~~~~~~l~Ky~~L~~L~   83 (559)
T PTZ00317          9 SKEKVPSNARGVDVLRNRFLNKGTAFTAEEREHLGIEGLLPPTVETLEQQVERLWTQFNRIETPINKYQFLRNIH   83 (559)
T ss_pred             cccccccCCcchhhhcCcccccccCCCHHHHHhcCCCCCCCCCccCHHHHHHHHHHHHhhCCChHHHHHHHHHHh
Confidence            455667888999999999   999999999999999999999999999999999999999999999999999986


No 3  
>PLN03129 NADP-dependent malic enzyme; Provisional
Probab=99.87  E-value=1.2e-22  Score=164.82  Aligned_cols=65  Identities=35%  Similarity=0.603  Sum_probs=63.3

Q ss_pred             ccchhhhhhCC---CCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhccCChhhHHHHHHhcC
Q psy7641          21 NLRLHSILRQS---MGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFTYLSELQ   85 (85)
Q Consensus        21 ~~~g~~~l~~p---KGtaFt~eER~~lgl~GLLPp~v~tle~Q~~R~~~~l~~~~t~L~Ky~yL~~L~   85 (85)
                      ..+|.++|+||   ||||||.+||++|||+|||||+|+|+|+|++|||.||+++++||+||+||++||
T Consensus        39 ~~~G~~ll~~p~~NKgtaFt~~ER~~lgl~GLlP~~v~t~e~Q~~R~~~~~~~~~~~l~ky~~L~~L~  106 (581)
T PLN03129         39 VASGYDLLRDPRYNKGLAFTETERDRLGLRGLLPPAVLSQELQVKRFMENLRALESPLAKYRALMDLQ  106 (581)
T ss_pred             CCcchhhhcCcccccccCCCHHHHhhcCCccCCCCCcCCHHHHHHHHHHHHhccCCcHHHHHHHHHHH
Confidence            56899999999   999999999999999999999999999999999999999999999999999986


No 4  
>KOG1257|consensus
Probab=99.86  E-value=4.9e-22  Score=159.90  Aligned_cols=68  Identities=44%  Similarity=0.780  Sum_probs=66.0

Q ss_pred             eecccchhhhhhCC---CCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhccCChhhHHHHHHhcC
Q psy7641          18 SQVNLRLHSILRQS---MGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFTYLSELQ   85 (85)
Q Consensus        18 ~~~~~~g~~~l~~p---KGtaFt~eER~~lgl~GLLPp~v~tle~Q~~R~~~~l~~~~t~L~Ky~yL~~L~   85 (85)
                      ..++.+|+++++||   ||+|||.+||++|||||||||+|.|+|+|++||+.+|++.++||+||+||++||
T Consensus        25 ~~~~~~g~~ll~~p~~NKglAFTl~ERq~l~i~GLLPp~v~t~d~Q~~r~~~~l~~~~~~l~ky~~L~~L~   95 (582)
T KOG1257|consen   25 VESKKRGYDLLRDPRYNKGLAFTLEERQRLGIHGLLPPVVRTQDEQALRCMNNLRSLTSPLAKYIYLMDLQ   95 (582)
T ss_pred             cccccCChhhccCCCcccccccCHHHHHhhCccccCCccccCHHHHHHHHHHHHHhccchHHHHHHHHHHH
Confidence            56789999999999   999999999999999999999999999999999999999999999999999985


No 5  
>COG0281 SfcA Malic enzyme [Energy production and conversion]
Probab=71.76  E-value=2.4  Score=34.48  Aligned_cols=27  Identities=26%  Similarity=0.452  Sum_probs=24.4

Q ss_pred             ccCHHHHHHHHHHHhhccCC-hhhHHHHH
Q psy7641          54 IKNQDQQIEVCRESVRRFQE-DLNKFTYL   81 (85)
Q Consensus        54 v~tle~Q~~R~~~~l~~~~t-~L~Ky~yL   81 (85)
                      ++|+| |.+|++.++....+ +|++|.|+
T Consensus         1 v~t~~-q~~~~~~~~~~~~~~aL~~h~~~   28 (432)
T COG0281           1 VETIE-QAERAYEQYEQLKTEALDKHEYL   28 (432)
T ss_pred             CccHH-HHHHHHHHHhhhhhhhHHHhccC
Confidence            56889 99999999998887 99999986


No 6  
>PF09036 Bcr-Abl_Oligo:  Bcr-Abl oncoprotein oligomerisation domain;  InterPro: IPR015123 This entry represents the oligomerisation domain of the breakpoint cluster region oncoprotein Bcr, and the Bcr/Abl (Abelson-leukemia-virus) fusion protein created by a reciprocal (9;22) fusion []. Brc displays serine/threonine protein kinase activity (2.7.11.1 from EC), acting as a GTPase-activating protein for RAC1 and CDC42. Brc promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them []. The Bcr/Abl fusion protein loses some of the regulatory function of Bcr with regards to small Rho-like GTPases with negative consequences on cell motility, in particular on the capacity to adhere to endothelial cells []. The Bcr, Bcr/Abl oncoprotein oligomerisation domain consists of a short N-terminal helix (alpha-1), a flexible loop and a long C-terminal helix (alpha-2). Together these form an N-shaped structure, with the loop allowing the two helices to assume a parallel orientation. The monomeric domains associate into a dimer through the formation of an antiparallel coiled coil between the alpha-2 helices and domain swapping of two alpha-1 helices, where one alpha-1 helix swings back and packs against the alpha-2 helix from the second monomer. Two dimers then associate into a tetramer. The oligomerisation domain is essential for the oncogenicity of the Bcr-Abl protein []. ; GO: 0004674 protein serine/threonine kinase activity, 0005096 GTPase activator activity, 0006468 protein phosphorylation, 0007165 signal transduction; PDB: 1K1F_C.
Probab=65.38  E-value=3.4  Score=26.24  Aligned_cols=32  Identities=34%  Similarity=0.812  Sum_probs=24.7

Q ss_pred             cccCHHHHHHHHHHHhhccCChhhH----HHHHHhc
Q psy7641          53 TIKNQDQQIEVCRESVRRFQEDLNK----FTYLSEL   84 (85)
Q Consensus        53 ~v~tle~Q~~R~~~~l~~~~t~L~K----y~yL~~L   84 (85)
                      .|.++|+.++||...++..+-.+.|    -|||..|
T Consensus        27 svgd~e~eLerCK~sirrLeqevnkERFrmiYLQTl   62 (79)
T PF09036_consen   27 SVGDIEQELERCKASIRRLEQEVNKERFRMIYLQTL   62 (79)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4667999999999999998876643    3577654


No 7  
>PF13877 RPAP3_C:  Potential Monad-binding region of RPAP3
Probab=53.42  E-value=18  Score=22.32  Aligned_cols=31  Identities=23%  Similarity=0.446  Sum_probs=21.7

Q ss_pred             CCcccCHHHHHHHHHHHhhccCChhhHHHHHHhc
Q psy7641          51 PPTIKNQDQQIEVCRESVRRFQEDLNKFTYLSEL   84 (85)
Q Consensus        51 Pp~v~tle~Q~~R~~~~l~~~~t~L~Ky~yL~~L   84 (85)
                      |+.-.| -.|-+|.|..+...  +-++|-||.++
T Consensus         1 p~~P~~-~~eF~~~w~~~~~~--~~~~~~yL~~i   31 (94)
T PF13877_consen    1 PPAPKN-SYEFERDWRRLKKD--PEERYEYLKSI   31 (94)
T ss_pred             CcCCCC-HHHHHHHHHHHcCC--HHHHHHHHHhC
Confidence            444444 56788889988743  33999999876


No 8  
>PF04697 Pinin_SDK_N:  pinin/SDK conserved region;  InterPro: IPR006787 This conserved region is found at the N-terminal of the member proteins. It is located adjacent and N-terminal to the pinin/SKD/memA domain IPR006786 from INTERPRO. Members of this family have very varied localisations within the eukaryotic cell. Pinin is known to localise at the desmosomes and is implicated in anchoring intermediate filaments to the desmosomal plaque [, ]. SDK2/3 is a dynamically localised nuclear protein thought to be involved in modulation of alternative pre-mRNA splicing []. MemA is a tumour marker preferentially expressed in human melanoma cell lines. A common feature of the members of this family is that they may all participate in regulating protein-protein interactions [].
Probab=49.58  E-value=9.7  Score=26.45  Aligned_cols=27  Identities=22%  Similarity=0.507  Sum_probs=24.0

Q ss_pred             CcccCHHHHHHHHHHHhhccCChhhHH
Q psy7641          52 PTIKNQDQQIEVCRESVRRFQEDLNKF   78 (85)
Q Consensus        52 p~v~tle~Q~~R~~~~l~~~~t~L~Ky   78 (85)
                      -+|.+++.|++.+.+.|+..+.+|-|-
T Consensus         3 vav~~Lq~qlE~Ake~Lk~vDenIkKl   29 (134)
T PF04697_consen    3 VAVRTLQAQLEKAKESLKNVDENIKKL   29 (134)
T ss_pred             hhHHHHHHHHHHHHHHhhhhhHHHHHH
Confidence            468899999999999999999888774


No 9  
>PF14743 DNA_ligase_OB_2:  DNA ligase OB-like domain; PDB: 2Q2U_D 2Q2T_A 1FVI_A 1P8L_A.
Probab=47.21  E-value=8.8  Score=23.13  Aligned_cols=17  Identities=29%  Similarity=0.470  Sum_probs=10.7

Q ss_pred             CCCCCCHHHHhhcccCC
Q psy7641          32 MGLAFSLRERQQLGIHG   48 (85)
Q Consensus        32 KGtaFt~eER~~lgl~G   48 (85)
                      =|++||+++|+.+-..|
T Consensus        25 iGsG~td~~R~~~~~iG   41 (66)
T PF14743_consen   25 IGSGFTDEEREEPPYIG   41 (66)
T ss_dssp             E-SS--HHHHHHHHHTT
T ss_pred             ECCCCCHHHHhcCCCCC
Confidence            47999999999876444


No 10 
>PF10410 DnaB_bind:  DnaB-helicase binding domain of primase;  InterPro: IPR019475  This entry represents the C-terminal region three-helical domain of DNA primase []. Primases synthesise short RNA strands on single-stranded DNA templates, thereby generating the hybrid duplexes required for the initiation of synthesis by DNA polymerases. Primases are recruited to single-stranded DNA by helicases - this domain binds DnaB-helicase []. It is associated with the Toprim domain IPR006171 from INTERPRO, which is the central catalytic core. ; GO: 0016779 nucleotidyltransferase activity; PDB: 1EQN_E 1DD9_A 3B39_B 1DDE_A.
Probab=44.73  E-value=28  Score=19.30  Aligned_cols=23  Identities=13%  Similarity=0.317  Sum_probs=16.6

Q ss_pred             HHHHHHhhccCChhhHHHHHHhc
Q psy7641          62 EVCRESVRRFQEDLNKFTYLSEL   84 (85)
Q Consensus        62 ~R~~~~l~~~~t~L~Ky~yL~~L   84 (85)
                      .++...+...++++.|..|+..|
T Consensus        26 ~~~~~~i~~i~~~i~r~~y~~~l   48 (59)
T PF10410_consen   26 REAAPLIAQIPDPIERELYIREL   48 (59)
T ss_dssp             HHHHHHHTT--SHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHH
Confidence            45566678889999999998865


No 11 
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]
Probab=38.60  E-value=45  Score=25.74  Aligned_cols=33  Identities=15%  Similarity=0.274  Sum_probs=30.0

Q ss_pred             CCCcccCHHHHHHHHHHHhhccCChhhHHHHHH
Q psy7641          50 MPPTIKNQDQQIEVCRESVRRFQEDLNKFTYLS   82 (85)
Q Consensus        50 LPp~v~tle~Q~~R~~~~l~~~~t~L~Ky~yL~   82 (85)
                      =||.-+++|.++.+.-..++..|+|.+.|.+|-
T Consensus       131 ~~~~~~~~~~l~a~Le~~L~~nP~d~egW~~Lg  163 (287)
T COG4235         131 QPPAEQEMEALIARLETHLQQNPGDAEGWDLLG  163 (287)
T ss_pred             cCCCcccHHHHHHHHHHHHHhCCCCchhHHHHH
Confidence            578888999999999999999999999999774


No 12 
>PF09006 Surfac_D-trimer:  Lung surfactant protein D coiled-coil trimerisation;  InterPro: IPR015097 This domain is found in the SFTPD family, which includes lung surfactant protein D (SFTPD), conglutinin, collectin-43 and collectin-46. It forms a triple-helical parallel coiled coil, and mediates trimerisation of the protein []. ; PDB: 4DN8_A 3G84_A 2RIE_C 3IKR_B 1B08_A 2GGX_B 2OS9_C 2ORK_B 1PWB_A 2RIA_C ....
Probab=38.37  E-value=15  Score=21.16  Aligned_cols=25  Identities=24%  Similarity=0.452  Sum_probs=18.0

Q ss_pred             cCHHHHHHHHHHHhhccCChhhHHH
Q psy7641          55 KNQDQQIEVCRESVRRFQEDLNKFT   79 (85)
Q Consensus        55 ~tle~Q~~R~~~~l~~~~t~L~Ky~   79 (85)
                      .++.+|++..-.+++...+.+.+|-
T Consensus         2 ~aLrqQv~aL~~qv~~Lq~~fs~yK   26 (46)
T PF09006_consen    2 NALRQQVEALQGQVQRLQAAFSQYK   26 (46)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4567777777777777777777664


No 13 
>cd06150 YjgF_YER057c_UK114_like_2 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=36.55  E-value=40  Score=21.12  Aligned_cols=25  Identities=8%  Similarity=0.088  Sum_probs=17.9

Q ss_pred             cCCCCCCc-ccCHHHHHHHHHHHhhc
Q psy7641          46 IHGLMPPT-IKNQDQQIEVCRESVRR   70 (85)
Q Consensus        46 l~GLLPp~-v~tle~Q~~R~~~~l~~   70 (85)
                      +.|.+|.. -.++++|.+.++.+++.
T Consensus        15 iSGq~~~~~~~~~~~Q~~~~~~nl~~   40 (105)
T cd06150          15 LAGQVADDTSADITGQTRQVLAKIDA   40 (105)
T ss_pred             EeCcCCcCCCCCHHHHHHHHHHHHHH
Confidence            44444432 27899999999999864


No 14 
>COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism]
Probab=36.20  E-value=19  Score=25.63  Aligned_cols=19  Identities=32%  Similarity=0.384  Sum_probs=16.2

Q ss_pred             hhhhCC-CCCCCCHHHHhhc
Q psy7641          26 SILRQS-MGLAFSLRERQQL   44 (85)
Q Consensus        26 ~~l~~p-KGtaFt~eER~~l   44 (85)
                      .+..|| |..=||.+||.++
T Consensus        35 aV~~np~K~plFsleER~~l   54 (159)
T COG0669          35 AVAINPSKKPLFSLEERVEL   54 (159)
T ss_pred             EEEeCCCcCCCcCHHHHHHH
Confidence            456788 9999999999876


No 15 
>PF06737 Transglycosylas:  Transglycosylase-like domain;  InterPro: IPR010618 This family of proteins is very likely to act as transglycosylase enzymes related to IPR001916 from INTERPRO and IPR008258 from INTERPRO. These other families are weakly matched by this family, and include the known active site residues.; GO: 0005576 extracellular region; PDB: 1XSF_A 3EO5_A.
Probab=34.89  E-value=72  Score=20.08  Aligned_cols=39  Identities=31%  Similarity=0.441  Sum_probs=32.2

Q ss_pred             CCCCCCHHHHhhcccCCCCC-CcccCHHHHHHHHHHHhhc
Q psy7641          32 MGLAFSLRERQQLGIHGLMP-PTIKNQDQQIEVCRESVRR   70 (85)
Q Consensus        32 KGtaFt~eER~~lgl~GLLP-p~v~tle~Q~~R~~~~l~~   70 (85)
                      -|.-|+...=+.+|=.|.-| |.--|-++|+.++.+-+..
T Consensus        29 Gg~Qf~~sTW~a~Gg~~yap~~~~As~~eQi~~A~~l~~~   68 (77)
T PF06737_consen   29 GGLQFSQSTWRAYGGSGYAPRPDQASRAEQIAVAEKLYAR   68 (77)
T ss_dssp             TTTTBBHHHHHHTTGGGT-SSCCCS-HHHHHHHHHHHHHH
T ss_pred             ceeccCHHHHHHhCCCcCCCChhhCCHHHHHHHHHHHHHH
Confidence            68899999999999888887 8888999999999887754


No 16 
>TIGR00004 endoribonuclease L-PSP, putative. This protein was described initially as an inhibitor of protein synthesis intiation but is now viewed as an endoribonuclease active on single-stranded mRNA. The cleavage of mRNA is responsible for the inhibition of protein synthesis. A role in purine regulation has also been suggested.
Probab=34.52  E-value=45  Score=21.36  Aligned_cols=16  Identities=19%  Similarity=0.227  Sum_probs=13.9

Q ss_pred             cCHHHHHHHHHHHhhc
Q psy7641          55 KNQDQQIEVCRESVRR   70 (85)
Q Consensus        55 ~tle~Q~~R~~~~l~~   70 (85)
                      .++++|++.|+.+++.
T Consensus        44 ~d~~~Q~~~~~~ni~~   59 (124)
T TIGR00004        44 GDIAEQAEQVLENLKA   59 (124)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            6899999999999854


No 17 
>TIGR03391 FeS_syn_CsdE cysteine desulfurase, sulfur acceptor subunit CsdE. Members of this protein family are CsdE, formerly called YgdK. This protein, found as a paralog to SufE in Escherichia coli, Yersinia pestis, Photorhabdus luminescens, and related species, works together and physically interacts with CsdA (a paralog of SufS). CsdA has cysteine desulfurase activity that is enhanced by this protein (CsdE), in which Cys-61 (numbered as in E. coli) is a sulfur acceptor site. This gene pair, although involved in FeS cluster biosynthesis, is not found next to other such genes as are its paralogs from the Suf or Isc systems.
Probab=33.79  E-value=63  Score=22.10  Aligned_cols=27  Identities=7%  Similarity=-0.004  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHhhccCChhhHHHHHHhc
Q psy7641          58 DQQIEVCRESVRRFQEDLNKFTYLSEL   84 (85)
Q Consensus        58 e~Q~~R~~~~l~~~~t~L~Ky~yL~~L   84 (85)
                      +.-.+.+.++|...++.-+||.||-.|
T Consensus         9 ~~~~~~i~~~f~~~~dwe~ry~~lI~l   35 (138)
T TIGR03391         9 EITAADLIATFAACRQWEDRYRQLILL   35 (138)
T ss_pred             chHHHHHHHHHHhCCCHHHHHHHHHHH
Confidence            344567889999999999999999754


No 18 
>PF00373 FERM_M:  FERM central domain;  InterPro: IPR019748 The FERM domain (F for 4.1 protein, E for ezrin, R for radixin and M for moesin) is a widespread protein module involved in localising proteins to the plasma membrane []. FERM domains are found in a number of cytoskeletal-associated proteins that associate with various proteins at the interface between the plasma membrane and the cytoskeleton. The FERM domain is located at the N terminus of the majority of FERM-containing proteins [, ], which includes:    Band 4.1, which links the spectrin-actin cytoskeleton of erythrocytes to the plasma membrane. Ezrin, a component of the undercoat of the microvilli plasma membrane. Moesin, which is probably involved in binding major cytoskeletal structures to the plasma membrane. Radixin, which is involved in the binding of the barbed end of actin filaments to the plasma membrane in the undercoat of the cell- to-cell adherens junction. Talin, a cytoskeletal protein concentrated in regions of cell-substratum contact and, in lymphocytes, of cell-cell contacts. Filopodin, a slime mold protein that binds actin and which is involved in the control of cell motility and chemotaxis. Merlin (or schwannomin). Protein NBL4. Unconventional myosins X, VIIa and XV, which are mutated in congenital deafness. Focal-adhesion kinases (FAKs), cytoplasmic protein tyrosine kinases involved in signalling through integrins. Janus tyrosine kinases (JAKs), cytoplasmic tyrosine kinases that are non-covalently associated with the cytoplasmic tails of receptors for cytokines or polypeptidic hormones. Non-receptor tyrosine-protein kinase TYK2. Protein-tyrosine phosphatases PTPN3 and PTPN4, enzyme that appear to act at junctions between the membrane and the cytoskeleton. Protein-tyrosine phosphatases PTPN14 and PTP-D1, PTP-RL10 and PTP2E.  Caenorhabditis elegans protein phosphatase ptp-1.   Ezrin, moesin, and radixin are highly related proteins (ERM protein family), but the other proteins in which the FERM domain is found do not share any region of similarity outside of this domain. ERM proteins are made of three domains, the FERM domain, a central helical domain and a C-terminal tail domain, which binds F-actin. The amino-acid sequence of the FERM domain is highly conserved among ERM proteins and is responsible for membrane association by direct binding to the cytoplasmic domain or tail of integral membrane proteins. ERM proteins are regulated by an intramolecular association of the FERM and C-terminal tail domains that masks their binding sites for other molecules. For cytoskeleton-membrane cross-linking, the dormant molecules becomes activated and the FERM domain attaches to the membrane by binding specific membrane proteins, while the last 34 residues of the tail bind actin filaments. Aside from binding to membranes, the activated FERM domain of ERM proteins can also bind the guanine nucleotide dissociation inhibitor of Rho GTPase (RhoDGI), which suggests that in addition to functioning as a cross-linker, ERM proteins may influence Rho signalling pathways. The crystal structure of the FERM domain reveals that it is composed of three structural modules (F1, F2, and F3) that together form a compact clover-shaped structure []. The FERM domain has also been called the amino-terminal domain, the 30kDa domain, 4.1N30, the membrane-cytoskeletal-linking domain, the ERM-like domain, the ezrin-like domain of the band 4.1 superfamily, the conserved N-terminal region, and the membrane attachment domain [].; PDB: 4DXA_B 2EMS_A 2ZPY_A 1J19_A 2D10_B 2D11_B 1GC6_A 2D2Q_A 2EMT_A 2YVC_A ....
Probab=33.75  E-value=43  Score=20.83  Aligned_cols=33  Identities=15%  Similarity=0.188  Sum_probs=24.5

Q ss_pred             CcccCHHHHHHHHHHHhhccCChhhHHHHHHhc
Q psy7641          52 PTIKNQDQQIEVCRESVRRFQEDLNKFTYLSEL   84 (85)
Q Consensus        52 p~v~tle~Q~~R~~~~l~~~~t~L~Ky~yL~~L   84 (85)
                      .....++.++.+.+++++..+..-.|..||.-+
T Consensus        83 ~~~~~~~~~I~~~~~~l~~~s~~~a~~~fl~~~  115 (126)
T PF00373_consen   83 MKQKEWEKRILEQHKKLRGMSPEEAKLQFLQIC  115 (126)
T ss_dssp             STHHHHHHHHHHHHHHTTT--HHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHH
Confidence            455567788888999999888888999998754


No 19 
>PF02731 SKIP_SNW:  SKIP/SNW domain;  InterPro: IPR004015  SKIP (SKI-interacting protein) is an essential spliceosomal component and transcriptional coregulator, which may provide regulatory coupling of transcription initiation and splicing []. SKIP was identified in a yeast 2-hybrid screen, where it was shown to interact with both the cellular and viral forms of SKI through the highly conserved region on SKIP known as the SNW domain []. SKIP is now known to interact with a number of other proteins as well. SKIP potentiates the activity of important transcription factors, such as vitamin D receptor, CBF1 (RBP-Jkappa), Smad2/3, and MyoD. It works with Ski in overcoming pRb-mediated cell cycle arrest, and it is targeted by the viral transactivators EBNA2 and E7 []. This entry represents the SNW domain.; GO: 0000398 nuclear mRNA splicing, via spliceosome, 0005681 spliceosomal complex
Probab=33.65  E-value=30  Score=24.61  Aligned_cols=42  Identities=21%  Similarity=0.353  Sum_probs=29.1

Q ss_pred             hhhhhCC-CCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhccCChhhHHHH
Q psy7641          25 HSILRQS-MGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFTY   80 (85)
Q Consensus        25 ~~~l~~p-KGtaFt~eER~~lgl~GLLPp~v~tle~Q~~R~~~~l~~~~t~L~Ky~y   80 (85)
                      ..|+++| +-  .|.+|++...    +||+|.+        |.+=..+.-||||-+-
T Consensus        50 ~PVlhsp~rK--lT~eeq~~Wk----IPp~ISN--------WKN~kGytIpLDKRla   92 (158)
T PF02731_consen   50 APVLHSPPRK--LTKEEQQKWK----IPPCISN--------WKNPKGYTIPLDKRLA   92 (158)
T ss_pred             CccccCCccc--CCHHHHhccc----CCCcccc--------ccCCCCCccCHHHHHh
Confidence            4556666 43  3788888754    6999988        7777777777776553


No 20 
>cd08041 OBF_kDNA_ligase_like The Oligonucleotide/oligosaccharide binding (OB)-fold domain of kDNA ligase-like ATP-dependent DNA ligases is a DNA-binding module that is part of the catalytic core unit. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation using nicked nucleic acid substrates with the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. DNA ligases play a vital role in the diverse processes of DNA replication, recombination and repair. ATP-dependent ligases are present in many organisms such as viruses, bacteriohages, eukarya, archaea and bacteria. The mitochondrial DNA of parasitic protozoan is highly unusual. It is termed the kinetoplast DNA (kDNA) and consists of circular DNA molecules (maxicircles) and several thousand smaller circular molecules (minicircles). This group is composed of kDNA ligase, Chlorella virus DNA ligase, and similar proteins. kDNA ligase and Chlorella virus DNA ligase are the smallest known ATP-de
Probab=32.35  E-value=29  Score=20.90  Aligned_cols=14  Identities=29%  Similarity=0.425  Sum_probs=12.3

Q ss_pred             CCCCCCHHHHhhcc
Q psy7641          32 MGLAFSLRERQQLG   45 (85)
Q Consensus        32 KGtaFt~eER~~lg   45 (85)
                      =|++||.++|+++.
T Consensus        36 vgtG~t~~~r~~~~   49 (77)
T cd08041          36 IGSGFSDEQRRNPP   49 (77)
T ss_pred             EcCCCCHHHHhcCC
Confidence            48999999999875


No 21 
>cd06156 eu_AANH_C_2 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains. This CD contains the second of these domains. The YjgF-YER057c-UK114 protein family is a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=30.00  E-value=65  Score=20.94  Aligned_cols=16  Identities=13%  Similarity=0.084  Sum_probs=14.0

Q ss_pred             cCHHHHHHHHHHHhhc
Q psy7641          55 KNQDQQIEVCRESVRR   70 (85)
Q Consensus        55 ~tle~Q~~R~~~~l~~   70 (85)
                      .+++.|.++|++++..
T Consensus        29 ~~~~~Q~~qal~Ni~~   44 (118)
T cd06156          29 GGITLQAVLSLQHLER   44 (118)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            5899999999999864


No 22 
>cd07971 OBF_DNA_ligase_LigD The Oligonucleotide/oligosaccharide binding (OB)-fold domain of ATP-dependent DNA ligase LigD is a DNA-binding module that is part of the catalytic core unit. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation using nicked nucleic acid substrates with the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. DNA ligases play a vital role in the diverse processes of DNA replication, recombination and repair. ATP-dependent ligases are present in many organisms such as viruses, bacteriohages, eukarya, archaea and bacteria. Bacterial DNA ligases are divided into two broad classes: NAD-dependent and ATP-dependent. All bacterial species have a NAD-dependent DNA ligase (LigA). Some bacterial genomes contain multiple genes for DNA ligases that are predicted to use ATP as their cofactor, including Mycobacterium tuberculosis LigB, LigC, and LigD. This group is composed of Mycobacterium tuberculosis LigD and similar ba
Probab=29.95  E-value=31  Score=22.14  Aligned_cols=13  Identities=31%  Similarity=0.506  Sum_probs=11.6

Q ss_pred             CCCCCCHHHHhhc
Q psy7641          32 MGLAFSLRERQQL   44 (85)
Q Consensus        32 KGtaFt~eER~~l   44 (85)
                      =|++||.+++++|
T Consensus        39 vgtG~s~~~~~~l   51 (115)
T cd07971          39 VGTGFSAATLREL   51 (115)
T ss_pred             EcCCCCHHHHHHH
Confidence            5899999999876


No 23 
>PF15225 IL32:  Interleukin 32
Probab=29.26  E-value=50  Score=21.78  Aligned_cols=37  Identities=14%  Similarity=0.242  Sum_probs=26.1

Q ss_pred             CCCHHHHhhcccCCCCC--CcccCHHHH--------HHHHHHHhhcc
Q psy7641          35 AFSLRERQQLGIHGLMP--PTIKNQDQQ--------IEVCRESVRRF   71 (85)
Q Consensus        35 aFt~eER~~lgl~GLLP--p~v~tle~Q--------~~R~~~~l~~~   71 (85)
                      ..-.+||+.|..+|-=|  |.+++-+.+        ..+++..|.+.
T Consensus         4 PLLeeeRd~LR~RgnRspvp~~EDp~te~~eP~Esf~dkvmR~Fqam   50 (104)
T PF15225_consen    4 PLLEEERDELRCRGNRSPVPDVEDPATEVWEPGESFCDKVMRWFQAM   50 (104)
T ss_pred             cccHHHHHHHHhccCCCCCCCCCCcccccCCcchhHHHHHHHHHHHH
Confidence            44578999999999887  455655555        56777766554


No 24 
>cd08040 OBF_DNA_ligase_family The Oligonucleotide/oligosaccharide binding (OB)-fold domain is a DNA-binding module that is part of the catalytic core unit of ATP dependent DNA ligases. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation using nicked nucleic acid substrates with the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. DNA ligases play a vital role in the diverse processes of DNA replication, recombination and repair. ATP dependent DNA ligases have a highly modular architecture consisting of a unique arrangement of two or more discrete domains including a DNA-binding domain, an adenylation (nucleotidyltransferase (NTase)) domain, and an oligonucleotide/oligosaccharide binding (OB)-fold domain. The adenylation and C-terminal OB-fold domains comprise a catalytic core unit that is common to most members of the ATP-dependent DNA ligase family. The catalytic core unit contains six conserved sequence motifs (I, III, IIIa, IV, 
Probab=28.88  E-value=34  Score=21.66  Aligned_cols=13  Identities=46%  Similarity=0.764  Sum_probs=11.7

Q ss_pred             CCCCCCHHHHhhc
Q psy7641          32 MGLAFSLRERQQL   44 (85)
Q Consensus        32 KGtaFt~eER~~l   44 (85)
                      -|++||.+++++|
T Consensus        40 vgtGf~~~~~~~l   52 (108)
T cd08040          40 VGTGFSADERRDL   52 (108)
T ss_pred             EcCCCCHHHHHHH
Confidence            6899999999886


No 25 
>cd06155 eu_AANH_C_1 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains. This CD contains the first of these domains. The YjgF-YER057c-UK114 protein family is a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=27.61  E-value=81  Score=19.64  Aligned_cols=17  Identities=18%  Similarity=0.227  Sum_probs=14.5

Q ss_pred             ccCHHHHHHHHHHHhhc
Q psy7641          54 IKNQDQQIEVCRESVRR   70 (85)
Q Consensus        54 v~tle~Q~~R~~~~l~~   70 (85)
                      -.++++|.++++++++.
T Consensus        21 ~~d~~~Q~~~v~~ni~~   37 (101)
T cd06155          21 DETVEEQMESIFSKLRE   37 (101)
T ss_pred             CCCHHHHHHHHHHHHHH
Confidence            36899999999999864


No 26 
>cd00448 YjgF_YER057c_UK114_family YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=27.24  E-value=86  Score=18.84  Aligned_cols=17  Identities=12%  Similarity=0.091  Sum_probs=14.2

Q ss_pred             ccCHHHHHHHHHHHhhc
Q psy7641          54 IKNQDQQIEVCRESVRR   70 (85)
Q Consensus        54 v~tle~Q~~R~~~~l~~   70 (85)
                      ..++++|++.++.++..
T Consensus        27 ~~~~~~Q~~~~~~ni~~   43 (107)
T cd00448          27 PGDIEAQTRQALENLEA   43 (107)
T ss_pred             CCCHHHHHHHHHHHHHH
Confidence            47899999999988754


No 27 
>KOG4117|consensus
Probab=26.75  E-value=44  Score=20.76  Aligned_cols=28  Identities=18%  Similarity=0.121  Sum_probs=23.5

Q ss_pred             CcccCHHHHHHHHHHHhhccCChhhHHH
Q psy7641          52 PTIKNQDQQIEVCRESVRRFQEDLNKFT   79 (85)
Q Consensus        52 p~v~tle~Q~~R~~~~l~~~~t~L~Ky~   79 (85)
                      .++.|+..|+-+-...+.+.-+||+|.+
T Consensus        30 DkFQtMSDQII~RiDDM~~riDDLEKnI   57 (73)
T KOG4117|consen   30 DKFQTMSDQIIGRIDDMSSRIDDLEKNI   57 (73)
T ss_pred             HHHHHHHHHHHHHHhhhhhhhHHHHHHH
Confidence            3567788888888888889999999987


No 28 
>cd06154 YjgF_YER057c_UK114_like_6 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=24.65  E-value=78  Score=20.27  Aligned_cols=16  Identities=19%  Similarity=0.310  Sum_probs=14.0

Q ss_pred             cCHHHHHHHHHHHhhc
Q psy7641          55 KNQDQQIEVCRESVRR   70 (85)
Q Consensus        55 ~tle~Q~~R~~~~l~~   70 (85)
                      .++++|++.++.++..
T Consensus        40 ~d~~~Q~~~~~~ni~~   55 (119)
T cd06154          40 GDAYEQTRQCLEIIEA   55 (119)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            5899999999999864


No 29 
>PF09776 Mitoc_L55:  Mitochondrial ribosomal protein L55;  InterPro: IPR018615  Members of this family are involved in mitochondrial biogenesis and G2/M phase cell cycle progression. They form a component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins. 
Probab=23.55  E-value=90  Score=21.13  Aligned_cols=47  Identities=15%  Similarity=0.096  Sum_probs=34.3

Q ss_pred             eeecccCCCCCcceecccchhhhhhCC-CCCCCCHHHHhhcccCCCCCC
Q psy7641           5 YQLGIEDEQGFPSSQVNLRLHSILRQS-MGLAFSLRERQQLGIHGLMPP   52 (85)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~g~~~l~~p-KGtaFt~eER~~lgl~GLLPp   52 (85)
                      |..-.+.+||..+.+.-.-...++.-| .=...|+|||++. +.-.-|.
T Consensus        45 Ypv~lV~pDGSTI~Iry~EPR~ii~mPlDl~~LSeeERk~r-l~kR~pk   92 (116)
T PF09776_consen   45 YPVLLVRPDGSTINIRYHEPRRIIKMPLDLDTLSEEERKAR-LRKRKPK   92 (116)
T ss_pred             ccEEEEecCCCEEEEeccChHHHhccccCcccCCHHHHHHH-HHHhCCc
Confidence            566677888988888777777888888 6667889998764 4444553


No 30 
>PF04679 DNA_ligase_A_C:  ATP dependent DNA ligase C terminal region        ;  InterPro: IPR012309 DNA ligase (polydeoxyribonucleotide synthase) is the enzyme that joins two DNA fragments by catalysing the formation of an internucleotide ester bond between phosphate and deoxyribose. It is active during DNA replication, DNA repair and DNA recombination. There are two forms of DNA ligase, one requires ATP (6.5.1.1 from EC), the other NAD (6.5.1.2 from EC), the latter being restricted to eubacteria. Eukaryotic, archaebacterial, viral and some eubacterial DNA ligases are ATP-dependent. The first step in the ligation reaction is the formation of a covalent enzyme-AMP complex. The co-factor ATP is cleaved to pyrophosphate and AMP, with the AMP being covalently joined to a highly conserved lysine residue in the active site of the ligase. The activated AMP residue is then transferred to the 5'phosphate of the nick, before the nick is sealed by phosphodiester-bond formation and AMP elimination [,]. Vertebrate cells encode three well-characterised DNA ligases (DNA ligases I, III and IV), all of which are related in structure and sequence. With the exception of the atypically small PBCV-1 viral enzyme, two regions of primary sequence are common to all members of the family. The catalytic region comprises six conserved sequence motifs (I, III, IIIa, IV, V-VI), motif I includes the lysine residue that is adenylated in the first step of the ligation reaction. The function of the second, less well-conserved region is unknown. When folded, each protein comprises of two distinct sub-domains: a large amino-terminal sub-domain ('domain 1') and a smaller carboxy-terminal sub-domain ('domain 2'). The ATP-binding site of the enzyme lies in the cleft between the two sub-domains. Domain 1 consists of two antiparallel beta sheets flanked by alpha helices, whereas domain 2 consists of a five-stranded beta barrel and a single alpha helix, which form the oligonucleotide-binding fold [, ].  This region is found in many but not all ATP-dependent DNA ligase enzymes (6.5.1.1 from EC). It is thought to constitute part of the catalytic core of ATP dependent DNA ligase []. ; GO: 0003910 DNA ligase (ATP) activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 3RR5_A 2CFM_A 1X9N_A 1VS0_B 3GDE_A 2HIX_A 2HIV_A 3L2P_A 4EQ5_A.
Probab=23.03  E-value=44  Score=20.73  Aligned_cols=13  Identities=38%  Similarity=0.554  Sum_probs=8.2

Q ss_pred             CCCCCCHHHHhhc
Q psy7641          32 MGLAFSLRERQQL   44 (85)
Q Consensus        32 KGtaFt~eER~~l   44 (85)
                      =|++||.+++++|
T Consensus        26 vgtG~~~~~~~~l   38 (97)
T PF04679_consen   26 VGTGFSDEELREL   38 (97)
T ss_dssp             E-SS--HHHHHHH
T ss_pred             ECCCCCHHHHHHH
Confidence            5889999998876


No 31 
>cd06152 YjgF_YER057c_UK114_like_4 YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=21.97  E-value=1.1e+02  Score=19.65  Aligned_cols=16  Identities=13%  Similarity=0.327  Sum_probs=13.8

Q ss_pred             cCHHHHHHHHHHHhhc
Q psy7641          55 KNQDQQIEVCRESVRR   70 (85)
Q Consensus        55 ~tle~Q~~R~~~~l~~   70 (85)
                      .++++|++.|+++++.
T Consensus        30 ~d~~~Q~~~~~~Nl~~   45 (114)
T cd06152          30 EDLEEEIDQAFDNVEL   45 (114)
T ss_pred             cCHHHHHHHHHHHHHH
Confidence            4899999999999864


No 32 
>KOG0969|consensus
Probab=21.52  E-value=55  Score=29.30  Aligned_cols=48  Identities=15%  Similarity=0.298  Sum_probs=40.9

Q ss_pred             hhCCCCCCCCHHHHhhcccCCCCCCcccCHHHHHHHHHHHhhccCChhhHHH
Q psy7641          28 LRQSMGLAFSLRERQQLGIHGLMPPTIKNQDQQIEVCRESVRRFQEDLNKFT   79 (85)
Q Consensus        28 l~~pKGtaFt~eER~~lgl~GLLPp~v~tle~Q~~R~~~~l~~~~t~L~Ky~   79 (85)
                      .+.|.|--|-..++++    ||||...+++=.--+|+.+.++...+|+.|-+
T Consensus       602 ~~TP~g~yFv~~~~rk----GlLP~ILe~ll~aRKraK~dlk~ekDp~kr~v  649 (1066)
T KOG0969|consen  602 TRTPTGDYFVKTEVRK----GLLPEILEDLLTARKRAKADLKKEKDPFKRAV  649 (1066)
T ss_pred             eECCCCCeeeehhhhc----cccHHHHHHHHHHHHHHHHHHHhccCHHHHhh
Confidence            4455788888888875    99999999999999999999999999987754


No 33 
>cd06151 YjgF_YER057c_UK114_like_3 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=20.39  E-value=87  Score=20.30  Aligned_cols=16  Identities=6%  Similarity=0.092  Sum_probs=14.0

Q ss_pred             cCHHHHHHHHHHHhhc
Q psy7641          55 KNQDQQIEVCRESVRR   70 (85)
Q Consensus        55 ~tle~Q~~R~~~~l~~   70 (85)
                      .++++|+.+|+++++.
T Consensus        37 ~d~~~Q~~~~l~ni~~   52 (126)
T cd06151          37 GDTETQTISVLKRIET   52 (126)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            5899999999999864


Done!