Query psy7646
Match_columns 301
No_of_seqs 65 out of 67
Neff 2.7
Searched_HMMs 46136
Date Fri Aug 16 23:44:18 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy7646.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7646hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF05456 eIF_4EBP: Eukaryotic 40.5 9.2 0.0002 32.7 0.0 16 180-196 29-44 (116)
2 PF04964 Flp_Fap: Flp/Fap pili 15.5 35 0.00075 24.4 -0.9 9 100-108 7-15 (46)
3 PRK10828 putative oxidoreducta 11.5 91 0.002 26.6 0.4 21 207-228 29-49 (183)
4 PF13680 DUF4152: Protein of u 11.2 45 0.00098 31.3 -1.7 14 13-26 112-125 (227)
5 PF11230 DUF3029: Protein of u 11.0 2.2E+02 0.0049 29.9 3.0 66 161-241 350-419 (487)
6 PF13439 Glyco_transf_4: Glyco 8.6 1.3E+02 0.0028 22.9 0.2 10 167-176 165-174 (177)
7 KOG3816|consensus 8.4 7.6E+02 0.017 26.0 5.6 12 192-203 206-217 (526)
8 PLN03105 TCP24 transcription f 8.0 3.6E+02 0.0079 26.6 3.0 18 211-228 286-303 (324)
9 cd02140 Nitroreductase_4 Nitro 7.3 1.6E+02 0.0036 25.0 0.3 17 211-228 32-49 (192)
10 PRK05365 malonic semialdehyde 6.9 1.8E+02 0.0039 24.9 0.3 20 208-228 36-55 (195)
No 1
>PF05456 eIF_4EBP: Eukaryotic translation initiation factor 4E binding protein (EIF4EBP); InterPro: IPR008606 This family consists of several eukaryotic translation initiation factor 4E binding proteins (EIF4EBP1, -2 and -3). Translation initiation in eukaryotes is mediated by the cap structure (m7GpppN, where N is any nucleotide) present at the 5' end of all cellular mRNAs, except organellar. The cap is recognised by eukaryotic initiation factor 4F (eIF4F), which consists of three polypeptides, including eIF4E, the cap-binding protein subunit. The interaction of the cap with eIF4E facilitates the binding of the ribosome to the mRNA. eIF4E activity is regulated in part by translational repressors, 4E-BP1, 4E-BP2 and 4E-BP3 which bind to it and prevent its assembly into eIF4F [].; GO: 0008190 eukaryotic initiation factor 4E binding, 0045947 negative regulation of translational initiation; PDB: 2JGB_B 2V8Y_F 1WKW_B 3HXG_C 3U7X_D 3M94_C 3M93_C 2V8X_B 3HXI_C 2V8W_B ....
Probab=40.51 E-value=9.2 Score=32.67 Aligned_cols=16 Identities=56% Similarity=1.192 Sum_probs=0.0
Q ss_pred ccCCCCCCcccccCCCC
Q psy7646 180 KYSSGPGGVVCYSRTPG 196 (301)
Q Consensus 180 ~~~~~~~~~~~FnRTPG 196 (301)
.||++|||.| |+=|||
T Consensus 29 ~ystTPGGTl-fsTTPG 44 (116)
T PF05456_consen 29 DYSTTPGGTL-FSTTPG 44 (116)
T ss_dssp -----------------
T ss_pred hhccCCCCce-EEeccC
Confidence 5899999997 999999
No 2
>PF04964 Flp_Fap: Flp/Fap pilin component; InterPro: IPR007047 This entry is for the fimbriae associated protein Flp/Fap pilin component.
Probab=15.50 E-value=35 Score=24.38 Aligned_cols=9 Identities=44% Similarity=0.914 Sum_probs=7.5
Q ss_pred ceeeeeehh
Q psy7646 100 GVKMVEYVL 108 (301)
Q Consensus 100 GVsMVEYVL 108 (301)
|+.||||-|
T Consensus 7 GaTaiEYal 15 (46)
T PF04964_consen 7 GATAIEYAL 15 (46)
T ss_pred cchHHHHHH
Confidence 788999965
No 3
>PRK10828 putative oxidoreductase; Provisional
Probab=11.46 E-value=91 Score=26.60 Aligned_cols=21 Identities=33% Similarity=0.251 Sum_probs=15.7
Q ss_pred chhhhhhhhhcccCCCCCCCCC
Q psy7646 207 SELAAVQAAVHHSHQKPARFSD 228 (301)
Q Consensus 207 ~~~~~~~~~~~h~h~~p~~~s~ 228 (301)
...++.+|++|+| .+||+|--
T Consensus 29 ileaA~~APS~~N-~Qpw~fvv 49 (183)
T PRK10828 29 ILRAGMRAPDHGS-LQPWRFFV 49 (183)
T ss_pred HHHHHHhCcCcCC-ccceEEEE
Confidence 3456688898755 88999966
No 4
>PF13680 DUF4152: Protein of unknown function (DUF4152)
Probab=11.22 E-value=45 Score=31.32 Aligned_cols=14 Identities=36% Similarity=0.776 Sum_probs=10.9
Q ss_pred cccccCcccccccc
Q psy7646 13 TKQTIAPSAKKLWG 26 (301)
Q Consensus 13 ~~~~iap~aKKlWe 26 (301)
+...+-|-||||||
T Consensus 112 LskdlQPLAkkfWE 125 (227)
T PF13680_consen 112 LSKDLQPLAKKFWE 125 (227)
T ss_pred HHHHhHHHHHHHHH
Confidence 34557899999994
No 5
>PF11230 DUF3029: Protein of unknown function (DUF3029); InterPro: IPR016905 Members of this family are homologs to enzymes known to undergo activation by a radical SAM protein to create an active site glycyl radical. This family appears to be activated by the YjjW radical SAM protein, usually encoded by an adjacent gene.
Probab=10.96 E-value=2.2e+02 Score=29.86 Aligned_cols=66 Identities=26% Similarity=0.325 Sum_probs=41.5
Q ss_pred ccCCCcc-ccccCcccccccccCCCCCCcccccCCCCCCCCCCCCccchhhhhhhhhcccCCCCCCCCC--CCCcc-ccc
Q psy7646 161 QTNGMVP-VVQNGIDNEDKYKYSSGPGGVVCYSRTPGSRQPSPTDDGSELAAVQAAVHHSHQKPARFSD--SSDHG-VTQ 236 (301)
Q Consensus 161 ~~NG~~p-v~qNGiD~D~K~~~~~~~~~~~~FnRTPGsrQpSp~E~~~~~~~~~~~~~h~h~~p~~~s~--~~dH~-vsq 236 (301)
-++|..- --|-|||.| | .=|||-|=|=..|. ++..-.++...|.+.+|.--++ +.|-+ .+-
T Consensus 350 ~~~gr~lLHAQvGi~~D-~-------------~~TPG~RIp~G~EP-~~~~hl~~~A~~H~yfpsGi~DIf~~d~T~k~N 414 (487)
T PF11230_consen 350 GTGGRFLLHAQVGISSD-K-------------GVTPGVRIPYGEEP-DLVDHLQASAPFHKYFPSGIGDIFTFDETVKNN 414 (487)
T ss_pred ccCCEEEEEeccCcccc-C-------------CCCCCCcCcCCCCC-CHHHHHHHhcccccCCCCCcccccccchhhHhC
Confidence 4456530 026799999 6 46999999999888 5555555554444555655555 44544 456
Q ss_pred ccccc
Q psy7646 237 GMAMV 241 (301)
Q Consensus 237 pi~m~ 241 (301)
|.||+
T Consensus 415 P~A~l 419 (487)
T PF11230_consen 415 PEALL 419 (487)
T ss_pred HHHHH
Confidence 77776
No 6
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A.
Probab=8.58 E-value=1.3e+02 Score=22.95 Aligned_cols=10 Identities=50% Similarity=0.866 Sum_probs=3.7
Q ss_pred cccccCcccc
Q psy7646 167 PVVQNGIDNE 176 (301)
Q Consensus 167 pv~qNGiD~D 176 (301)
-|+.||||.|
T Consensus 165 ~vI~ngid~~ 174 (177)
T PF13439_consen 165 HVIYNGIDTD 174 (177)
T ss_dssp EE----B-CC
T ss_pred EEEECCccHH
Confidence 3689999998
No 7
>KOG3816|consensus
Probab=8.45 E-value=7.6e+02 Score=26.04 Aligned_cols=12 Identities=33% Similarity=0.659 Sum_probs=6.8
Q ss_pred cCCCCCCCCCCC
Q psy7646 192 SRTPGSRQPSPT 203 (301)
Q Consensus 192 nRTPGsrQpSp~ 203 (301)
-|||-+-|.-|.
T Consensus 206 ~r~P~~~~~G~S 217 (526)
T KOG3816|consen 206 CRPPNKPQKGPS 217 (526)
T ss_pred CCCCCCCCCCcc
Confidence 477766555443
No 8
>PLN03105 TCP24 transcription factor TCP24 (TEOSINTE BRANCHED1, CYCLOIDEA, AND PCF FAMILY 24); Provisional
Probab=7.98 E-value=3.6e+02 Score=26.63 Aligned_cols=18 Identities=33% Similarity=0.543 Sum_probs=13.5
Q ss_pred hhhhhhcccCCCCCCCCC
Q psy7646 211 AVQAAVHHSHQKPARFSD 228 (301)
Q Consensus 211 ~~~~~~~h~h~~p~~~s~ 228 (301)
...-.-||+||+|.-|.+
T Consensus 286 ~~p~~~hh~hq~p~~fdg 303 (324)
T PLN03105 286 TPPPLDHHNHQLPETFDG 303 (324)
T ss_pred CCCccccccccCCCCcCc
Confidence 333345999999999977
No 9
>cd02140 Nitroreductase_4 Nitroreductase-like family 4. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.
Probab=7.28 E-value=1.6e+02 Score=25.02 Aligned_cols=17 Identities=12% Similarity=0.075 Sum_probs=13.8
Q ss_pred h-hhhhhcccCCCCCCCCC
Q psy7646 211 A-VQAAVHHSHQKPARFSD 228 (301)
Q Consensus 211 ~-~~~~~~h~h~~p~~~s~ 228 (301)
+ ..|++|+| .+||+|--
T Consensus 32 A~~~APS~~N-~QPW~f~V 49 (192)
T cd02140 32 AVKHSPSSFN-SQSSRAVI 49 (192)
T ss_pred HHHhCCCCCC-CCCeEEEE
Confidence 5 58999877 89999954
No 10
>PRK05365 malonic semialdehyde reductase; Provisional
Probab=6.85 E-value=1.8e+02 Score=24.95 Aligned_cols=20 Identities=20% Similarity=0.042 Sum_probs=15.1
Q ss_pred hhhhhhhhhcccCCCCCCCCC
Q psy7646 208 ELAAVQAAVHHSHQKPARFSD 228 (301)
Q Consensus 208 ~~~~~~~~~~h~h~~p~~~s~ 228 (301)
...+..|++|+| .+||+|--
T Consensus 36 leaa~~APS~~N-~QPw~fvv 55 (195)
T PRK05365 36 YDLVKWGPTSAN-CSPARFVF 55 (195)
T ss_pred HHHHHhCCCcCC-CCCeEEEE
Confidence 345688888876 79999865
Done!