Query         psy7646
Match_columns 301
No_of_seqs    65 out of 67
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 23:44:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7646.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7646hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05456 eIF_4EBP:  Eukaryotic   40.5     9.2  0.0002   32.7   0.0   16  180-196    29-44  (116)
  2 PF04964 Flp_Fap:  Flp/Fap pili  15.5      35 0.00075   24.4  -0.9    9  100-108     7-15  (46)
  3 PRK10828 putative oxidoreducta  11.5      91   0.002   26.6   0.4   21  207-228    29-49  (183)
  4 PF13680 DUF4152:  Protein of u  11.2      45 0.00098   31.3  -1.7   14   13-26    112-125 (227)
  5 PF11230 DUF3029:  Protein of u  11.0 2.2E+02  0.0049   29.9   3.0   66  161-241   350-419 (487)
  6 PF13439 Glyco_transf_4:  Glyco   8.6 1.3E+02  0.0028   22.9   0.2   10  167-176   165-174 (177)
  7 KOG3816|consensus                8.4 7.6E+02   0.017   26.0   5.6   12  192-203   206-217 (526)
  8 PLN03105 TCP24 transcription f   8.0 3.6E+02  0.0079   26.6   3.0   18  211-228   286-303 (324)
  9 cd02140 Nitroreductase_4 Nitro   7.3 1.6E+02  0.0036   25.0   0.3   17  211-228    32-49  (192)
 10 PRK05365 malonic semialdehyde    6.9 1.8E+02  0.0039   24.9   0.3   20  208-228    36-55  (195)

No 1  
>PF05456 eIF_4EBP:  Eukaryotic translation initiation factor 4E binding protein (EIF4EBP);  InterPro: IPR008606 This family consists of several eukaryotic translation initiation factor 4E binding proteins (EIF4EBP1, -2 and -3). Translation initiation in eukaryotes is mediated by the cap structure (m7GpppN, where N is any nucleotide) present at the 5' end of all cellular mRNAs, except organellar. The cap is recognised by eukaryotic initiation factor 4F (eIF4F), which consists of three polypeptides, including eIF4E, the cap-binding protein subunit. The interaction of the cap with eIF4E facilitates the binding of the ribosome to the mRNA. eIF4E activity is regulated in part by translational repressors, 4E-BP1, 4E-BP2 and 4E-BP3 which bind to it and prevent its assembly into eIF4F [].; GO: 0008190 eukaryotic initiation factor 4E binding, 0045947 negative regulation of translational initiation; PDB: 2JGB_B 2V8Y_F 1WKW_B 3HXG_C 3U7X_D 3M94_C 3M93_C 2V8X_B 3HXI_C 2V8W_B ....
Probab=40.51  E-value=9.2  Score=32.67  Aligned_cols=16  Identities=56%  Similarity=1.192  Sum_probs=0.0

Q ss_pred             ccCCCCCCcccccCCCC
Q psy7646         180 KYSSGPGGVVCYSRTPG  196 (301)
Q Consensus       180 ~~~~~~~~~~~FnRTPG  196 (301)
                      .||++|||.| |+=|||
T Consensus        29 ~ystTPGGTl-fsTTPG   44 (116)
T PF05456_consen   29 DYSTTPGGTL-FSTTPG   44 (116)
T ss_dssp             -----------------
T ss_pred             hhccCCCCce-EEeccC
Confidence            5899999997 999999


No 2  
>PF04964 Flp_Fap:  Flp/Fap pilin component;  InterPro: IPR007047  This entry is for the fimbriae associated protein Flp/Fap pilin component.
Probab=15.50  E-value=35  Score=24.38  Aligned_cols=9  Identities=44%  Similarity=0.914  Sum_probs=7.5

Q ss_pred             ceeeeeehh
Q psy7646         100 GVKMVEYVL  108 (301)
Q Consensus       100 GVsMVEYVL  108 (301)
                      |+.||||-|
T Consensus         7 GaTaiEYal   15 (46)
T PF04964_consen    7 GATAIEYAL   15 (46)
T ss_pred             cchHHHHHH
Confidence            788999965


No 3  
>PRK10828 putative oxidoreductase; Provisional
Probab=11.46  E-value=91  Score=26.60  Aligned_cols=21  Identities=33%  Similarity=0.251  Sum_probs=15.7

Q ss_pred             chhhhhhhhhcccCCCCCCCCC
Q psy7646         207 SELAAVQAAVHHSHQKPARFSD  228 (301)
Q Consensus       207 ~~~~~~~~~~~h~h~~p~~~s~  228 (301)
                      ...++.+|++|+| .+||+|--
T Consensus        29 ileaA~~APS~~N-~Qpw~fvv   49 (183)
T PRK10828         29 ILRAGMRAPDHGS-LQPWRFFV   49 (183)
T ss_pred             HHHHHHhCcCcCC-ccceEEEE
Confidence            3456688898755 88999966


No 4  
>PF13680 DUF4152:  Protein of unknown function (DUF4152)
Probab=11.22  E-value=45  Score=31.32  Aligned_cols=14  Identities=36%  Similarity=0.776  Sum_probs=10.9

Q ss_pred             cccccCcccccccc
Q psy7646          13 TKQTIAPSAKKLWG   26 (301)
Q Consensus        13 ~~~~iap~aKKlWe   26 (301)
                      +...+-|-||||||
T Consensus       112 LskdlQPLAkkfWE  125 (227)
T PF13680_consen  112 LSKDLQPLAKKFWE  125 (227)
T ss_pred             HHHHhHHHHHHHHH
Confidence            34557899999994


No 5  
>PF11230 DUF3029:  Protein of unknown function (DUF3029);  InterPro: IPR016905  Members of this family are homologs to enzymes known to undergo activation by a radical SAM protein to create an active site glycyl radical. This family appears to be activated by the YjjW radical SAM protein, usually encoded by an adjacent gene. 
Probab=10.96  E-value=2.2e+02  Score=29.86  Aligned_cols=66  Identities=26%  Similarity=0.325  Sum_probs=41.5

Q ss_pred             ccCCCcc-ccccCcccccccccCCCCCCcccccCCCCCCCCCCCCccchhhhhhhhhcccCCCCCCCCC--CCCcc-ccc
Q psy7646         161 QTNGMVP-VVQNGIDNEDKYKYSSGPGGVVCYSRTPGSRQPSPTDDGSELAAVQAAVHHSHQKPARFSD--SSDHG-VTQ  236 (301)
Q Consensus       161 ~~NG~~p-v~qNGiD~D~K~~~~~~~~~~~~FnRTPGsrQpSp~E~~~~~~~~~~~~~h~h~~p~~~s~--~~dH~-vsq  236 (301)
                      -++|..- --|-|||.| |             .=|||-|=|=..|. ++..-.++...|.+.+|.--++  +.|-+ .+-
T Consensus       350 ~~~gr~lLHAQvGi~~D-~-------------~~TPG~RIp~G~EP-~~~~hl~~~A~~H~yfpsGi~DIf~~d~T~k~N  414 (487)
T PF11230_consen  350 GTGGRFLLHAQVGISSD-K-------------GVTPGVRIPYGEEP-DLVDHLQASAPFHKYFPSGIGDIFTFDETVKNN  414 (487)
T ss_pred             ccCCEEEEEeccCcccc-C-------------CCCCCCcCcCCCCC-CHHHHHHHhcccccCCCCCcccccccchhhHhC
Confidence            4456530 026799999 6             46999999999888 5555555554444555655555  44544 456


Q ss_pred             ccccc
Q psy7646         237 GMAMV  241 (301)
Q Consensus       237 pi~m~  241 (301)
                      |.||+
T Consensus       415 P~A~l  419 (487)
T PF11230_consen  415 PEALL  419 (487)
T ss_pred             HHHHH
Confidence            77776


No 6  
>PF13439 Glyco_transf_4:  Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A.
Probab=8.58  E-value=1.3e+02  Score=22.95  Aligned_cols=10  Identities=50%  Similarity=0.866  Sum_probs=3.7

Q ss_pred             cccccCcccc
Q psy7646         167 PVVQNGIDNE  176 (301)
Q Consensus       167 pv~qNGiD~D  176 (301)
                      -|+.||||.|
T Consensus       165 ~vI~ngid~~  174 (177)
T PF13439_consen  165 HVIYNGIDTD  174 (177)
T ss_dssp             EE----B-CC
T ss_pred             EEEECCccHH
Confidence            3689999998


No 7  
>KOG3816|consensus
Probab=8.45  E-value=7.6e+02  Score=26.04  Aligned_cols=12  Identities=33%  Similarity=0.659  Sum_probs=6.8

Q ss_pred             cCCCCCCCCCCC
Q psy7646         192 SRTPGSRQPSPT  203 (301)
Q Consensus       192 nRTPGsrQpSp~  203 (301)
                      -|||-+-|.-|.
T Consensus       206 ~r~P~~~~~G~S  217 (526)
T KOG3816|consen  206 CRPPNKPQKGPS  217 (526)
T ss_pred             CCCCCCCCCCcc
Confidence            477766555443


No 8  
>PLN03105 TCP24 transcription factor TCP24 (TEOSINTE BRANCHED1, CYCLOIDEA, AND PCF FAMILY 24); Provisional
Probab=7.98  E-value=3.6e+02  Score=26.63  Aligned_cols=18  Identities=33%  Similarity=0.543  Sum_probs=13.5

Q ss_pred             hhhhhhcccCCCCCCCCC
Q psy7646         211 AVQAAVHHSHQKPARFSD  228 (301)
Q Consensus       211 ~~~~~~~h~h~~p~~~s~  228 (301)
                      ...-.-||+||+|.-|.+
T Consensus       286 ~~p~~~hh~hq~p~~fdg  303 (324)
T PLN03105        286 TPPPLDHHNHQLPETFDG  303 (324)
T ss_pred             CCCccccccccCCCCcCc
Confidence            333345999999999977


No 9  
>cd02140 Nitroreductase_4 Nitroreductase-like family 4.  A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor.  The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.
Probab=7.28  E-value=1.6e+02  Score=25.02  Aligned_cols=17  Identities=12%  Similarity=0.075  Sum_probs=13.8

Q ss_pred             h-hhhhhcccCCCCCCCCC
Q psy7646         211 A-VQAAVHHSHQKPARFSD  228 (301)
Q Consensus       211 ~-~~~~~~h~h~~p~~~s~  228 (301)
                      + ..|++|+| .+||+|--
T Consensus        32 A~~~APS~~N-~QPW~f~V   49 (192)
T cd02140          32 AVKHSPSSFN-SQSSRAVI   49 (192)
T ss_pred             HHHhCCCCCC-CCCeEEEE
Confidence            5 58999877 89999954


No 10 
>PRK05365 malonic semialdehyde reductase; Provisional
Probab=6.85  E-value=1.8e+02  Score=24.95  Aligned_cols=20  Identities=20%  Similarity=0.042  Sum_probs=15.1

Q ss_pred             hhhhhhhhhcccCCCCCCCCC
Q psy7646         208 ELAAVQAAVHHSHQKPARFSD  228 (301)
Q Consensus       208 ~~~~~~~~~~h~h~~p~~~s~  228 (301)
                      ...+..|++|+| .+||+|--
T Consensus        36 leaa~~APS~~N-~QPw~fvv   55 (195)
T PRK05365         36 YDLVKWGPTSAN-CSPARFVF   55 (195)
T ss_pred             HHHHHhCCCcCC-CCCeEEEE
Confidence            345688888876 79999865


Done!