Diaphorina citri psyllid: psy7673

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-

MFPVKYPKLFGKSTPSGVLLCGPPGCGKTLLAKAVANEAGINFISVKGPELLNMYLGESERAVRQCFQRARNSQPCVIFFDEIDALCPKRSSLGDNNSSMRIVNQLLTEMDGFEGRGGVFLMAATNRPDIIDPAVMRPGRFDRILFVNLPNEQDRKEILLALTKQGKDPMMGEDVDFDKIAADERCEGFSGADLEQLVKEAREQAILEIVNSVENDDQAGIDDTEQVTIGFRHFDIALKRIKPSVSKADCKNYESLKQRYTTPGAIKEMMSKRPDLSGYEESELYRRSRIEKWSVWSVEGGLQTIVNTLGEHLSNKVEVKMDTTCTNLEFLEKGVKVTLNNDQHIEANHVVSALPAPKLGMLLHKQHPTLGNLLSSIEHVNVAVINLAYENIPMKQNAFGFLVPPREKLPILGVVFDSCCFEQADWTILTVMMGGAWYDTYFKGQSKEYILDIACRYVHEILDMPRTPHAQHVEILKACIPQYTLGHAARVKDIQGYIDTHQLPLYLTGSSYDGVGVNDVIALSKKAVESIKWQHWGAQAG

ccccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccEEEEccccHHcccHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccHHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEEccccHHHHHHHHHHHHcccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHccccccHHHHccccHHHHHHHHHHHHHHHcccccccccEEEEccccEEEEEccccccccccEEEccccHHHHHHHHccccHHHHHHccccEEEEEEEEEEEccccccccccCECccccccccccCEEEccccccccccEEEEEEEcccHHHHccccccHHHHHHHHHHHHHHHccccccccccHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHcHHHHHHcccccccccccc

MFPVKYPKLFGKSTPSGVLLCGPPGCGKTLLAKAVANEAGINFISVKGPELLNMYLGESERAVRQCFQRARNSQPCVIFFDEIDALCPK**********MRIVNQLLTEMDGFEGRGGVFLMAATNRPDIIDPAVMRPGRFDRILFVNLPNEQDRKEILLALTKQGKDPMMGEDVDFDKIAADERCEGFSGADLEQLVKEAREQAILEIVNSVENDDQAGIDDTEQVTIGFRHFDIALKRIKPSVSKADCKNYESLKQ*************************LYRRSRIEKWSVWSVEGGLQTIVNTLGEHLSNKVEVKMDTTCTNLEFLEKGVKVTLNNDQHIEANHVVSALPAPKLGMLLHKQHPTLGNLLSSIEHVNVAVINLAYENIPMKQNAFGFLVPPREKLPILGVVFDSCCFEQADWTILTVMMGGAWYDTYFKGQSKEYILDIACRYVHEILDMPRTPHAQHVEILKACIPQYTLGHAARVKDIQGYIDTHQLPLYLTGSSYDGVGVNDVIALSKKAVESIKWQHWGA***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Nuclear valosin-containing protein-like		confident	Q9DBY8
Uncharacterized AAA domain-containing protein C16E9.10c		confident	O14325
Ribosome biogenesis ATPase RIX7	Involved in ribosome biogenesis. Seems to be required for restructuring nucleoplasmic 60S pre-ribosomal particles to make them competent for nuclear export.	confident	Q07844

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0015630 [CC]	microtubule cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044427 [CC]	chromosomal part	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226, GO:0044422
GO:0030687 [CC]	preribosome, large subunit precursor	probable	GO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0008540 [CC]	proteasome regulatory particle, base subcomplex	probable	GO:0043234, GO:0005838, GO:0022624, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0000502, GO:0044424, GO:0032991
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006200 [BP]	ATP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0044430 [CC]	cytoskeletal part	probable	GO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0016887 [MF]	ATPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0009535 [CC]	chloroplast thylakoid membrane	probable	GO:0055035, GO:0034357, GO:0031976, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0009536, GO:0016020, GO:0044436, GO:0044435, GO:0044434, GO:0005737, GO:0044446, GO:0031984, GO:0042651, GO:0009507, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0046907 [BP]	intracellular transport	probable	GO:0009987, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0008233 [MF]	peptidase activity	probable	GO:0016787, GO:0003674, GO:0003824
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016235 [CC]	aggresome	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0016234, GO:0044424
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019222 [BP]	regulation of metabolic process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0030163 [BP]	protein catabolic process	probable	GO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0044085 [BP]	cellular component biogenesis	probable	GO:0008150, GO:0071840
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X8A, chain A
Confidence level:very confident
Coverage over the Query: 2-88,99-210,227-245
View the alignment between query and template
View the model in PyMOL

Template: 3HU3, chain A
Confidence level:very confident
Coverage over the Query: 4-244,265-271
View the alignment between query and template
View the model in PyMOL

Template: 3NKS, chain A
Confidence level:very confident
Coverage over the Query: 291-534
View the alignment between query and template
View the model in PyMOL