Diaphorina citri psyllid: psy7682

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380---

AKCLNEKRRREQENNYIEELAELISAASFAESMSSLAVKPDKCAILQETVNQCLNEKRRREQENNYIEELAELISAASFAESMSSLAVKPDKCAILQETVNQIRNIKQQETSSDAVQQGEVSSSKPTVITNEVLGPLLLEALEGFLFVVNPDGYVNFCTENIKSFIRYSRQEVLGKSVYNLIHHGDHARFHNCLVPSSHQVNAWTSDSGGQAGKRPSLTASTPNRTFNIRLLISSTHLTAGLSRAGGENGQDDSGDVSSEGGPCLMCVARRIPPTDKQLSAPIEQFTMKLDRSGTIIGMDTSGVSQTHTQYLNKAVACKTSATVWTCPNSPLTSTKLLLKALLLSICTDYALVQTDTCMYRSSPSCFGLQGASRTSLWQRIRL

ccccHHHHHHHHHcHHHHHHHHHcccccccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccEEEEcccccEEEEEccHHHHcccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccEEEEEEEccccccccccccccEEEEccccccEEEEECcccccccccccHHHHHHHccccEEEccccccccHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccEEEcc

*****************************************************************YIEELAELISAASFAESM**LAVKPDKCAILQETVNQIRNIK********************VITNEVLGPLLLEALEGFLFVVNPDGYVNFCTENIKSFIRYSRQEVLGKSVYNLIHHGDHARFHNCLVPS**Q**A**********************TFNIRLLISSTHLT************************CLMCVARRIPP********IEQFTMKLDRSGTIIGMDTSGVSQTHTQYLNKAVACKTSATVWTCPNSPLTSTKLLLKALLLSICTDYALVQTDTCMYRSSPSCFGLQGASRTSLWQRIRL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0030374 [MF]	ligand-dependent nuclear receptor transcription coactivator activity	probable	GO:0003674, GO:0003713, GO:0003712, GO:0000989, GO:0000988
GO:0005102 [MF]	receptor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008150 [BP]	biological_process	probable
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0031981 [CC]	nuclear lumen	probable	GO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3L, chain B
Confidence level:very confident
Coverage over the Query: 46-109,122-197,218-244,261-382
View the alignment between query and template
View the model in PyMOL

Template: 1AM9, chain A
Confidence level:confident
Coverage over the Query: 4-75
View the alignment between query and template
View the model in PyMOL