BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy7721
(160 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1UEH|A Chain A, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Triton X- 100, Magnesium And Sulfate
pdb|1UEH|B Chain B, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Triton X- 100, Magnesium And Sulfate
pdb|1V7U|A Chain A, Crystal Structure Of Undecaprenyl Pyrophosphate Synthase
With Farnesyl Pyrophosphate
pdb|1V7U|B Chain B, Crystal Structure Of Undecaprenyl Pyrophosphate Synthase
With Farnesyl Pyrophosphate
pdb|1X06|A Chain A, Crystal Structure Of Undecaprenyl Pyrophosphate Synthase
In Complex With Mg, Ipp And Fspp
pdb|1X07|A Chain A, Crystal Structure Of Undecaprenyl Pyrophosphate Synthase
In Complex With Mg And Ipp
pdb|2E98|A Chain A, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-629
pdb|2E98|B Chain B, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-629
pdb|2E99|A Chain A, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-608
pdb|2E99|B Chain B, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-608
pdb|2E9A|A Chain A, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-628
pdb|2E9A|B Chain B, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-628
pdb|2E9C|A Chain A, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-675
pdb|2E9C|B Chain B, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-675
pdb|2E9D|A Chain A, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-676
pdb|2E9D|B Chain B, E. Coli Undecaprenyl Pyrophosphate Synthase In Complex
With Bph-676
pdb|3QAS|B Chain B, Structure Of Undecaprenyl Diphosphate Synthase
pdb|3QAS|A Chain A, Structure Of Undecaprenyl Diphosphate Synthase
pdb|3TH8|A Chain A, Structure Of E. Coli Undecaprenyl Diphosphate Synthase
Complexed With Bph-1063
pdb|3TH8|B Chain B, Structure Of E. Coli Undecaprenyl Diphosphate Synthase
Complexed With Bph-1063
pdb|3SGT|B Chain B, Crystal Structure Of E. Coli Undecaprenyl Pyrophosphate
Synthase In Complex With Bph-1299
pdb|3SGT|A Chain A, Crystal Structure Of E. Coli Undecaprenyl Pyrophosphate
Synthase In Complex With Bph-1299
pdb|3SGV|B Chain B, Crystal Structure Of E. Coli Undecaprenyl Pyrophosphate
Synthase In Complex With Bph-1290
pdb|3SGV|A Chain A, Crystal Structure Of E. Coli Undecaprenyl Pyrophosphate
Synthase In Complex With Bph-1290
pdb|3SGX|A Chain A, Crystal Structure Of E. Coli Undecaprenyl Pyrophosphate
Synthase In Complex With Bph-1100
pdb|3SGX|B Chain B, Crystal Structure Of E. Coli Undecaprenyl Pyrophosphate
Synthase In Complex With Bph-1100
pdb|3SH0|B Chain B, Crystal Structure Of E. Coli Undecaprenyl Pyrophosphate
Synthase In Complex With Bph-1065
pdb|3SH0|A Chain A, Crystal Structure Of E. Coli Undecaprenyl Pyrophosphate
Synthase In Complex With Bph-1065
pdb|4H2J|A Chain A, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1354
pdb|4H2J|B Chain B, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1354
pdb|4H2M|A Chain A, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1408
pdb|4H2M|B Chain B, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1408
pdb|4H2O|B Chain B, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1248
pdb|4H2O|A Chain A, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1248
pdb|4H38|A Chain A, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1297
pdb|4H38|B Chain B, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1297
pdb|4H3A|A Chain A, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1330
pdb|4H3A|B Chain B, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-1330
pdb|4H3C|A Chain A, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-987
pdb|4H3C|B Chain B, Structure Of E. Coli Undecaprenyl Diphosphate Synthase In
Complex With Bph-987
Length = 253
Score = 28.5 bits (62), Expect = 1.8, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
Query: 82 IKEYPHAVGKNTVLVAALQARNNARVVFSGSLYFFSNEAFNSPVQK 127
I+ + H G +V A A NN + + +LY FS+E +N P Q+
Sbjct: 38 IRAFGHKAGAKSVRRAVSFAANNG--IEALTLYAFSSENWNRPAQE 81
>pdb|1X08|A Chain A, Crystal Structure Of D26a Mutant Upps In Complex With Mg,
Ipp And Fspp
pdb|1X09|A Chain A, Crystal Structure Of The D26a Mutant Upps In Complex With
Magnesium And Isopentenyl Pyrophosphate
Length = 253
Score = 28.1 bits (61), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
Query: 82 IKEYPHAVGKNTVLVAALQARNNARVVFSGSLYFFSNEAFNSPVQK 127
I+ + H G +V A A NN + + +LY FS+E +N P Q+
Sbjct: 38 IRAFGHKAGAKSVRRAVSFAANNG--IEALTLYAFSSENWNRPAQE 81
>pdb|1JP3|A Chain A, Structure Of E.Coli Undecaprenyl Pyrophosphate Synthase
pdb|1JP3|B Chain B, Structure Of E.Coli Undecaprenyl Pyrophosphate Synthase
Length = 253
Score = 28.1 bits (61), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)
Query: 82 IKEYPHAVGKNTVLVAALQARNNARVVFSGSLYFFSNEAFNSPVQK 127
I+ + H G +V A A NN + + +LY FS+E +N P Q+
Sbjct: 38 IRAFGHKAGAKSVRRAVSFAANNG--IEALTLYAFSSENWNRPAQE 81
>pdb|4AQ5|C Chain C, Gating Movement In Acetylcholine Receptor Analysed By
Time- Resolved Electron Cryo-Microscopy (Closed Class)
pdb|4AQ9|C Chain C, Gating Movement In Acetylcholine Receptor Analysed By
Time-Resolved Electron Cryo-Microscopy (Open Class)
Length = 522
Score = 27.7 bits (60), Expect = 2.9, Method: Composition-based stats.
Identities = 13/37 (35%), Positives = 18/37 (48%)
Query: 107 VVFSGSLYFFSNEAFNSPVQKAIGGKKFDKSSNEALC 143
V+ G+++ F FN P K G FD SS+ C
Sbjct: 485 VMVLGTIFIFVMGNFNRPPAKPFEGDPFDYSSDHPRC 521
>pdb|2W8D|A Chain A, Distinct And Essential Morphogenic Functions For Wall- And
Lipo-Teichoic Acids In Bacillus Subtilis
pdb|2W8D|B Chain B, Distinct And Essential Morphogenic Functions For Wall- And
Lipo-Teichoic Acids In Bacillus Subtilis
Length = 436
Score = 27.3 bits (59), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 16/44 (36%), Positives = 21/44 (47%)
Query: 116 FSNEAFNSPVQKAIGGKKFDKSSNEALCTSSLTKHSTVLSKKQL 159
F N F SP I GK +D + + L S + K L KK+L
Sbjct: 346 FRNGDFISPKYTKISGKYYDTKTGKELDESEVDKSEDSLVKKEL 389
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.130 0.361
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,439,327
Number of Sequences: 62578
Number of extensions: 164831
Number of successful extensions: 256
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 254
Number of HSP's gapped (non-prelim): 5
length of query: 160
length of database: 14,973,337
effective HSP length: 91
effective length of query: 69
effective length of database: 9,278,739
effective search space: 640232991
effective search space used: 640232991
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 47 (22.7 bits)