Query         psy7728
Match_columns 65
No_of_seqs    154 out of 1003
Neff          8.1 
Searched_HMMs 46136
Date          Fri Aug 16 17:17:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7728.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7728hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05885 Ig2_Necl-4 Second immu  99.2 2.5E-11 5.4E-16   65.3   4.4   28   38-65      1-28  (80)
  2 cd05755 Ig2_ICAM-1_like Second  99.1 1.7E-10 3.6E-15   64.4   5.7   33   32-64     12-46  (100)
  3 cd05883 Ig2_Necl-2 Second immu  99.1 9.9E-11 2.1E-15   63.3   4.6   28   38-65      1-28  (82)
  4 cd05772 IgC_SIRP Signal-regula  99.1 1.9E-10 4.1E-15   65.0   4.9   49   12-64      1-50  (111)
  5 cd04975 Ig4_SCFR_like Fourth i  98.9 5.9E-09 1.3E-13   57.9   5.2   36   29-64     11-46  (101)
  6 cd05884 Ig2_Necl-3 Second immu  98.8 6.5E-09 1.4E-13   55.9   4.5   27   39-65      2-28  (83)
  7 cd05761 Ig2_Necl-1-4_like Seco  98.8   7E-09 1.5E-13   55.3   4.6   27   39-65      2-28  (82)
  8 cd07705 Ig2_Necl-1 Second immu  98.8 7.6E-09 1.6E-13   55.5   4.5   27   39-65      2-28  (83)
  9 cd05749 Ig2_Tyro3_like Second   98.8 1.9E-08 4.2E-13   53.8   5.2   33   31-64      8-41  (81)
 10 cd05737 Ig_Myomesin_like_C C-t  98.8 2.1E-08 4.5E-13   54.2   5.3   34   30-64     10-43  (92)
 11 cd05724 Ig2_Robo Second immuno  98.8 2.8E-08 6.1E-13   52.4   5.5   34   31-64      6-39  (86)
 12 cd07693 Ig1_Robo First immunog  98.8 2.6E-08 5.6E-13   53.4   5.4   34   30-64     10-43  (100)
 13 cd05771 IgC_Tapasin_R Tapasin-  98.8 7.1E-08 1.5E-12   55.5   7.1   53    5-62     27-80  (139)
 14 cd05759 Ig2_KIRREL3-like Secon  98.8 2.2E-08 4.8E-13   52.9   4.5   26   39-64      2-27  (82)
 15 cd05745 Ig3_Peroxidasin Third   98.7 1.9E-08 4.2E-13   52.3   3.9   29   35-64      1-29  (74)
 16 cd05857 Ig2_FGFR Second immuno  98.7 3.7E-08 8.1E-13   52.0   5.0   32   32-64      5-36  (85)
 17 PF08205 C2-set_2:  CD80-like C  98.7 1.9E-08 4.2E-13   53.7   3.6   28   36-63     14-41  (89)
 18 cd05740 Ig_CEACAM_D4 Fourth im  98.7 6.3E-08 1.4E-12   52.6   5.7   42   20-63      2-43  (91)
 19 cd05752 Ig1_FcgammaR_like Frst  98.7 5.1E-08 1.1E-12   51.7   5.2   32   32-63     11-42  (78)
 20 cd05730 Ig3_NCAM-1_like Third   98.7   6E-08 1.3E-12   52.4   5.4   34   30-64     12-45  (95)
 21 cd05739 Ig3_RPTP_IIa_LAR_like   98.7 4.8E-08   1E-12   50.6   4.2   28   36-64      1-28  (69)
 22 cd05867 Ig4_L1-CAM_like Fourth  98.7 4.4E-08 9.6E-13   51.1   4.1   28   36-64      1-28  (76)
 23 cd05851 Ig3_Contactin-1 Third   98.7 6.8E-08 1.5E-12   52.0   4.8   32   31-63     11-42  (88)
 24 cd05894 Ig_C5_MyBP-C C5 immuno  98.6   1E-07 2.3E-12   51.1   5.3   34   30-64      4-37  (86)
 25 cd05747 Ig5_Titin_like M5, fif  98.6 1.2E-07 2.5E-12   51.1   5.4   34   30-64     12-45  (92)
 26 cd05722 Ig1_Neogenin First imm  98.6 1.1E-07 2.4E-12   51.4   5.2   33   31-64      9-41  (95)
 27 cd05762 Ig8_MLCK Eighth immuno  98.6 1.1E-07 2.3E-12   52.3   5.1   34   30-64      9-42  (98)
 28 cd05868 Ig4_NrCAM Fourth immun  98.6 6.9E-08 1.5E-12   50.6   4.0   28   36-64      1-28  (76)
 29 cd05848 Ig1_Contactin-5 First   98.6 7.7E-08 1.7E-12   52.4   4.1   30   34-64     17-46  (94)
 30 cd05891 Ig_M-protein_C C-termi  98.6 1.5E-07 3.3E-12   51.0   5.0   34   30-64     10-43  (92)
 31 cd04972 Ig_TrkABC_d4 Fourth do  98.6 1.5E-07 3.3E-12   50.5   4.9   31   32-63     11-41  (90)
 32 cd05728 Ig4_Contactin-2-like F  98.6 1.7E-07 3.6E-12   50.0   4.7   33   31-64      9-41  (85)
 33 cd04978 Ig4_L1-NrCAM_like Four  98.5 1.7E-07 3.6E-12   48.5   4.1   28   36-64      1-28  (76)
 34 PF07679 I-set:  Immunoglobulin  98.5 4.2E-07 9.2E-12   48.1   5.7   34   30-64      9-42  (90)
 35 cd05850 Ig1_Contactin-2 First   98.5 1.8E-07   4E-12   50.8   4.1   29   35-64     18-46  (94)
 36 PF13895 Ig_2:  Immunoglobulin   98.5 5.9E-07 1.3E-11   46.1   5.8   32   32-64     10-41  (80)
 37 cd04973 Ig1_FGFR First immunog  98.5 3.1E-07 6.7E-12   48.4   4.6   32   31-64      4-35  (79)
 38 cd05863 Ig2_VEGFR-3 Second imm  98.5 1.5E-07 3.3E-12   48.8   3.1   25   39-64      1-25  (67)
 39 cd05859 Ig4_PDGFR-alpha Fourth  98.5 3.4E-07 7.3E-12   50.7   4.7   33   31-64     13-45  (101)
 40 cd05732 Ig5_NCAM-1_like Fifth   98.5 3.7E-07 8.1E-12   49.1   4.7   32   31-63     11-42  (96)
 41 cd05869 Ig5_NCAM-1 Fifth immun  98.5 7.6E-07 1.7E-11   48.4   5.5   30   33-63     14-43  (97)
 42 cd05750 Ig_Pro_neuregulin Immu  98.5 2.4E-07 5.2E-12   47.7   3.3   26   39-64      1-26  (75)
 43 cd05856 Ig2_FGFRL1-like Second  98.4   3E-07 6.6E-12   47.8   3.6   32   31-63      4-35  (82)
 44 cd04968 Ig3_Contactin_like Thi  98.4   5E-07 1.1E-11   48.2   4.2   32   31-63     11-42  (88)
 45 cd05754 Ig3_Perlecan_like Thir  98.4 7.9E-07 1.7E-11   47.1   4.9   33   31-63     11-43  (85)
 46 cd05892 Ig_Myotilin_C C-termin  98.4 3.7E-07 8.1E-12   48.1   3.4   25   39-64      1-25  (75)
 47 cd05873 Ig_Sema4D_like Immunog  98.4 1.2E-06 2.6E-11   47.6   5.5   33   30-64      5-37  (87)
 48 cd05870 Ig5_NCAM-2 Fifth immun  98.4 1.4E-06 3.1E-11   47.4   5.7   28   31-59     11-38  (98)
 49 cd04969 Ig5_Contactin_like Fif  98.4 6.4E-07 1.4E-11   46.3   4.1   28   36-64      1-28  (73)
 50 cd05874 Ig6_NrCAM Sixth immuno  98.4 4.4E-07 9.6E-12   47.8   3.5   24   39-63      1-24  (77)
 51 cd07704 Ig2_Nectin-3-4_like Se  98.4 6.1E-07 1.3E-11   49.8   4.1   30   30-59     10-40  (97)
 52 cd05852 Ig5_Contactin-1 Fifth   98.4 5.6E-07 1.2E-11   47.0   3.7   27   36-63      1-27  (73)
 53 cd05773 Ig8_hNephrin_like Eigh  98.4 1.1E-06 2.4E-11   49.1   5.1   29   35-64     22-50  (109)
 54 cd05753 Ig2_FcgammaR_like Seco  98.4 7.9E-07 1.7E-11   47.5   4.4   32   32-63     10-41  (83)
 55 cd05758 Ig5_KIRREL3-like Fifth  98.4 2.3E-06   5E-11   46.6   6.2   33   31-64     11-44  (98)
 56 cd00098 IgC Immunoglobulin Con  98.4 7.5E-07 1.6E-11   47.7   4.1   31   34-64     11-42  (95)
 57 cd05760 Ig2_PTK7 Second immuno  98.4   5E-07 1.1E-11   47.3   3.3   25   39-64      1-25  (77)
 58 cd05766 IgC_MHC_II_beta Class   98.4 1.4E-06 2.9E-11   47.8   5.1   32   33-64     11-43  (94)
 59 cd05723 Ig4_Neogenin Fourth im  98.3 7.9E-07 1.7E-11   45.9   3.7   26   38-64      1-26  (71)
 60 cd05733 Ig6_L1-CAM_like Sixth   98.3 6.1E-07 1.3E-11   47.0   3.3   24   39-63      1-24  (77)
 61 cd05865 Ig1_NCAM-1 First immun  98.3 9.8E-07 2.1E-11   48.4   4.2   31   32-63     11-43  (96)
 62 cd05849 Ig1_Contactin-1 First   98.3 1.3E-06 2.8E-11   47.5   4.5   28   36-64     19-46  (93)
 63 cd05744 Ig_Myotilin_C_like Imm  98.3 8.3E-07 1.8E-11   46.4   3.5   25   39-64      1-25  (75)
 64 PHA02785 IL-beta-binding prote  98.3 5.4E-06 1.2E-10   53.9   8.0   53    9-64    211-265 (326)
 65 cd05743 Ig_Perlecan_D2_like Im  98.3   1E-06 2.2E-11   46.1   3.8   27   36-63      1-27  (78)
 66 cd05893 Ig_Palladin_C C-termin  98.3 7.8E-07 1.7E-11   46.7   3.3   25   39-64      1-25  (75)
 67 cd05895 Ig_Pro_neuregulin-1 Im  98.3   7E-07 1.5E-11   46.4   3.0   26   39-64      1-26  (76)
 68 cd05756 Ig1_IL1R_like First im  98.3 8.9E-07 1.9E-11   48.4   3.4   32   31-62      9-44  (94)
 69 cd04979 Ig_Semaphorin_C Immuno  98.3   2E-06 4.3E-11   46.0   4.7   31   31-63      6-36  (89)
 70 cd05875 Ig6_hNeurofascin_like   98.3 1.1E-06 2.3E-11   46.3   3.5   24   39-63      1-24  (77)
 71 PHA02826 IL-1 receptor-like pr  98.3 5.1E-06 1.1E-10   51.9   6.7   33   32-64    140-176 (227)
 72 cd05727 Ig2_Contactin-2-like S  98.3 1.7E-06 3.6E-11   47.9   3.9   33   31-63     13-45  (96)
 73 cd05729 Ig2_FGFR_like Second i  98.3 4.7E-06   1E-10   43.3   5.5   32   31-63      4-35  (85)
 74 cd05768 IgC_CH4 CH4 domain (fo  98.3 2.6E-06 5.6E-11   47.3   4.6   31   34-64     14-45  (102)
 75 cd04967 Ig1_Contactin First Ig  98.3 2.1E-06 4.5E-11   46.1   4.1   29   34-63     17-45  (91)
 76 smart00407 IGc1 Immunoglobulin  98.2   2E-06 4.3E-11   45.0   3.9   25   39-63      2-27  (75)
 77 cd04976 Ig2_VEGFR Second immun  98.2 1.3E-06 2.8E-11   45.2   3.1   25   39-64      1-25  (71)
 78 cd05735 Ig8_DSCAM Eight immuno  98.2 2.5E-06 5.5E-11   45.8   4.3   27   36-63      1-27  (88)
 79 cd05864 Ig2_VEGFR-2 Second imm  98.2 1.7E-06 3.8E-11   45.0   3.0   24   40-64      2-25  (70)
 80 cd05738 Ig2_RPTP_IIa_LAR_like   98.2   2E-06 4.3E-11   44.7   3.1   25   39-64      1-25  (74)
 81 cd05748 Ig_Titin_like Immunogl  98.2 3.1E-06 6.7E-11   43.6   3.8   25   38-63      1-25  (74)
 82 smart00408 IGc2 Immunoglobulin  98.2 4.8E-06   1E-10   40.2   4.3   29   35-64      1-29  (63)
 83 cd05746 Ig4_Peroxidasin Fourth  98.2 1.6E-06 3.6E-11   44.4   2.7   25   39-64      1-25  (69)
 84 cd05769 IgC_TCR_beta T cell re  98.2 3.9E-06 8.4E-11   47.7   4.4   31   34-64     16-47  (115)
 85 cd05726 Ig4_Robo Fhird immunog  98.2 2.7E-06 5.7E-11   45.6   3.5   26   36-62      1-26  (90)
 86 cd07689 Ig2_VCAM-1 Second immu  98.2 3.7E-06 8.1E-11   46.9   4.1   32   32-63     11-44  (99)
 87 cd07699 IgC_L Immunoglobulin C  98.2 3.6E-06 7.8E-11   46.5   3.9   32   33-64     14-46  (100)
 88 cd05876 Ig3_L1-CAM Third immun  98.1 2.2E-06 4.7E-11   44.2   2.4   24   39-63      1-24  (71)
 89 cd07702 Ig2_VEGFR-1 Second imm  98.1 3.3E-06 7.1E-11   44.3   3.0   25   39-64      1-25  (72)
 90 cd04977 Ig1_NCAM-1_like First   98.1 6.8E-06 1.5E-10   44.4   4.2   31   31-63     10-41  (92)
 91 cd05765 Ig_3 Subgroup of the i  98.1 5.3E-06 1.1E-10   43.1   3.5   24   36-60      1-24  (81)
 92 cd05855 Ig_TrkB_d5 Fifth domai  98.1 4.8E-06   1E-10   44.5   3.2   23   41-64      3-25  (79)
 93 cd04974 Ig3_FGFR Third immunog  98.1 6.4E-06 1.4E-10   44.3   3.6   24   36-60      1-24  (90)
 94 cd07703 Ig2_Nectin-2_like Seco  98.1 9.3E-06   2E-10   44.8   4.2   21   39-59     18-38  (95)
 95 cd05719 Ig2_PVR_like Second im  98.0 7.8E-06 1.7E-10   45.0   3.6   22   38-59     17-38  (95)
 96 cd05731 Ig3_L1-CAM_like Third   98.0 6.6E-06 1.4E-10   41.8   3.1   24   39-63      1-24  (71)
 97 cd04971 Ig_TrKABC_d5 Fifth dom  98.0 7.1E-06 1.5E-10   43.7   3.2   23   41-64      3-25  (81)
 98 KOG4221|consensus               98.0 2.1E-05 4.5E-10   58.5   6.3   61    3-64    218-279 (1381)
 99 cd05764 Ig_2 Subgroup of the i  98.0 1.5E-05 3.2E-10   41.0   4.2   27   36-63      1-28  (74)
100 cd05854 Ig6_Contactin-2 Sixth   98.0 1.5E-05 3.3E-10   42.5   4.3   26   37-63      1-28  (85)
101 cd07698 IgC_MHC_I_alpha3 Class  98.0 1.8E-05 3.8E-10   42.9   4.6   27   36-62     14-41  (93)
102 KOG3515|consensus               98.0 6.1E-06 1.3E-10   58.8   3.3   49   13-63      1-49  (741)
103 cd05725 Ig3_Robo Third immunog  98.0 9.8E-06 2.1E-10   41.3   3.2   24   39-63      1-24  (69)
104 cd05866 Ig1_NCAM-2 First immun  98.0 1.7E-05 3.6E-10   43.3   4.2   31   31-63     10-41  (92)
105 cd05858 Ig3_FGFR-2 Third immun  98.0 1.7E-05 3.6E-10   42.5   4.1   23   36-59      1-23  (90)
106 cd05757 Ig2_IL1R_like Second i  98.0 9.2E-06   2E-10   44.3   3.0   33   32-64      6-42  (92)
107 cd05882 Ig1_Necl-1 First (N-te  97.9 2.1E-05 4.5E-10   43.1   4.2   31   31-62      7-37  (95)
108 cd05845 Ig2_L1-CAM_like Second  97.9 2.3E-05 4.9E-10   43.3   4.1   33   29-61     11-43  (95)
109 cd05763 Ig_1 Subgroup of the i  97.9 1.2E-05 2.6E-10   41.6   2.8   21   40-61      2-22  (75)
110 cd04970 Ig6_Contactin_like Six  97.9 2.7E-05 5.9E-10   41.2   4.3   27   37-64      1-29  (85)
111 PF00047 ig:  Immunoglobulin do  97.9 2.1E-05 4.5E-10   39.2   3.6   27   36-62      1-27  (64)
112 KOG3513|consensus               97.9 4.3E-05 9.3E-10   56.2   6.1   56    3-64    318-373 (1051)
113 cd05736 Ig2_Follistatin_like S  97.9   2E-05 4.3E-10   40.8   3.2   24   40-64      2-25  (76)
114 cd05853 Ig6_Contactin-4 Sixth   97.9 4.4E-05 9.6E-10   41.2   4.4   28   37-64      1-29  (85)
115 cd05847 IgC_CH2_IgE CH2 domain  97.8 4.3E-05 9.4E-10   41.9   4.2   29   35-63     13-42  (94)
116 cd05751 Ig1_LILRB1_like First   97.8 6.5E-05 1.4E-09   40.4   4.8   38   20-62      3-40  (91)
117 PF07654 C1-set:  Immunoglobuli  97.8 3.7E-05   8E-10   40.7   3.6   31   34-64      6-37  (83)
118 cd07690 Ig1_CD4 First immunogl  97.8  0.0001 2.2E-09   40.5   5.4   30   31-61      2-31  (94)
119 cd07701 Ig1_Necl-3 First (N-te  97.8 6.3E-05 1.4E-09   41.0   4.3   29   30-59      6-34  (95)
120 smart00409 IG Immunoglobulin.   97.8 0.00015 3.2E-09   36.5   5.4   32   31-63      4-36  (86)
121 smart00410 IG_like Immunoglobu  97.8 0.00015 3.2E-09   36.5   5.4   32   31-63      4-36  (86)
122 cd05742 Ig1_VEGFR_like First i  97.8 4.2E-05 9.2E-10   40.3   3.3   28   36-63      1-29  (84)
123 cd05770 IgC_beta2m Class I maj  97.7 5.5E-05 1.2E-09   41.5   3.7   32   33-64     12-44  (93)
124 cd05767 IgC_MHC_II_alpha Class  97.7 9.2E-05   2E-09   40.6   4.5   31   34-64     13-44  (94)
125 cd05898 Ig5_KIRREL3 Fifth immu  97.7 0.00023   5E-09   39.4   5.7   33   31-63     11-43  (98)
126 cd07697 IgC_TCR_gamma T cell r  97.7 7.9E-05 1.7E-09   41.1   3.6   30   35-64     15-45  (96)
127 cd07696 IgC_CH3 CH3 domain (th  97.7 0.00012 2.7E-09   40.2   4.3   30   33-62     11-42  (96)
128 cd05734 Ig7_DSCAM Seventh immu  97.6 4.6E-05   1E-09   39.7   2.3   21   39-60      1-21  (79)
129 cd05861 Ig1_PDGFR-alphabeta Fr  97.6 0.00015 3.3E-09   38.5   3.9   25   36-61      1-25  (84)
130 cd05871 Ig_Semaphorin_classIII  97.6 0.00019 4.1E-09   38.9   4.2   28   30-59      5-32  (91)
131 KOG4221|consensus               97.6 0.00021 4.6E-09   53.4   5.6   51    7-63    319-369 (1381)
132 cd05872 Ig_Sema4B_like Immunog  97.6 0.00016 3.4E-09   39.1   3.9   32   31-64      6-37  (85)
133 cd05899 IgV_TCR_beta Immunoglo  97.5 0.00029 6.3E-09   38.8   4.6   29   30-60      7-35  (110)
134 cd05711 Ig_FcalphaRI Immunoglo  97.5  0.0005 1.1E-08   37.3   5.2   38   20-62      2-39  (94)
135 KOG4194|consensus               97.4 0.00021 4.6E-09   50.9   4.2   56    3-63    693-748 (873)
136 cd04985 IgC_CH1 CH1 domain (fi  97.4 0.00032   7E-09   38.4   4.0   28   35-62     15-43  (95)
137 cd04983 IgV_TCR_alpha_like Imm  97.4 0.00063 1.4E-08   37.1   4.7   30   30-60      7-36  (109)
138 KOG4194|consensus               97.4 0.00041 8.9E-09   49.4   4.7   54    2-61    598-651 (873)
139 cd04980 IgV_L_kappa Immunoglob  97.4 0.00065 1.4E-08   37.2   4.7   30   30-59      9-38  (106)
140 cd05717 Ig1_Necl-1-3_like Firs  97.3 0.00068 1.5E-08   36.4   4.6   28   30-58      6-33  (95)
141 PHA03270 envelope glycoprotein  97.2  0.0008 1.7E-08   45.9   4.9   53    4-63    209-263 (466)
142 cd04982 IgV_TCR_gamma Immunogl  97.2  0.0014   3E-08   36.3   5.0   30   30-59      7-37  (116)
143 cd07700 IgV_CD8_beta Immunoglo  97.2   0.001 2.2E-08   36.7   4.1   29   32-60      2-30  (107)
144 PF13927 Ig_3:  Immunoglobulin   97.1 0.00092   2E-08   33.3   3.7   19   39-57     18-36  (75)
145 cd05897 Ig2_IL1R2_like Second   97.0 0.00052 1.1E-08   37.8   2.2   33   32-64      6-42  (95)
146 cd07706 IgV_TCR_delta Immunogl  97.0  0.0024 5.1E-08   35.5   4.8   30   30-59      8-37  (116)
147 cd00099 IgV Immunoglobulin var  97.0  0.0016 3.6E-08   35.0   3.9   29   32-60      2-30  (105)
148 cd05860 Ig4_SCFR Fourth immuno  97.0  0.0022 4.8E-08   35.9   4.3   34   29-63     11-45  (101)
149 PHA03269 envelope glycoprotein  96.9  0.0023   5E-08   44.4   4.9   51    7-64    320-372 (566)
150 cd04984 IgV_L_lambda Immunoglo  96.9  0.0016 3.4E-08   35.2   3.4   29   32-60      2-31  (98)
151 PHA03271 envelope glycoprotein  96.9  0.0031 6.7E-08   43.1   5.3   50    9-64    239-290 (490)
152 KOG3513|consensus               96.9   0.003 6.4E-08   47.0   5.5   54    3-61    220-280 (1051)
153 PHA03273 envelope glycoprotein  96.9  0.0032 6.9E-08   43.3   5.2   49    9-64    230-280 (486)
154 cd04986 IgC_CH2 CH2 domain (se  96.8  0.0023 5.1E-08   35.5   3.7   29   34-62     17-47  (99)
155 cd07692 Ig_CD3_epsilon Immunog  96.8 0.00091   2E-08   34.7   1.8   28   34-65      5-32  (65)
156 cd07694 Ig2_CD4 Second immunog  96.7  0.0028 6.2E-08   34.7   3.5   30   32-61     10-40  (88)
157 cd05716 Ig_pIgR Immunoglobulin  96.6  0.0049 1.1E-07   33.1   3.9   30   31-60      2-31  (98)
158 cd05896 Ig1_IL1RAPL-1_like Fir  96.5  0.0045 9.7E-08   34.8   3.5   32   30-61      9-50  (104)
159 cd05881 Ig1_Necl-2 First (N-te  96.5  0.0084 1.8E-07   32.9   4.5   30   31-61      7-36  (95)
160 KOG3515|consensus               96.5   0.002 4.3E-08   46.4   2.3   47   15-63    202-248 (741)
161 cd00096 Ig Immunoglobulin doma  96.4  0.0073 1.6E-07   28.4   3.6   24   39-63      1-24  (74)
162 PHA02785 IL-beta-binding prote  96.4  0.0035 7.5E-08   40.9   2.8   30   32-61     37-70  (326)
163 cd05890 Ig2_Nectin-1_like Seco  96.4  0.0052 1.1E-07   34.2   3.1   19   40-58     24-42  (98)
164 cd05715 Ig_P0-like Immunoglobu  96.3   0.014 2.9E-07   32.5   4.8   30   30-59      7-39  (116)
165 PF06832 BiPBP_C:  Penicillin-B  96.2    0.05 1.1E-06   29.1   6.5   45   10-63     10-54  (89)
166 PHA02987 Ig domain OX-2-like p  96.2   0.013 2.8E-07   36.1   4.5   32   30-61     24-55  (189)
167 cd05741 Ig_CEACAM_D1_like Firs  96.2  0.0062 1.3E-07   32.1   2.8   25   36-61      1-25  (92)
168 cd05862 Ig1_VEGFR First immuno  96.2   0.012 2.5E-07   31.3   3.8   27   36-62      1-28  (86)
169 cd04981 IgV_H Immunoglobulin (  96.1   0.021 4.5E-07   32.1   4.6   29   31-59      7-36  (117)
170 PF07686 V-set:  Immunoglobulin  96.0   0.022 4.7E-07   30.4   4.4   30   30-59     10-39  (114)
171 cd05720 Ig_CD8_alpha Immunoglo  96.0   0.015 3.2E-07   32.0   3.7   28   32-60      2-29  (104)
172 cd05880 Ig_EVA1 Immunoglobulin  95.9   0.028 6.1E-07   31.4   4.8   29   30-58      7-38  (115)
173 KOG4222|consensus               95.9   0.016 3.6E-07   43.6   4.6   56    1-62    300-355 (1281)
174 cd05877 Ig_LP_like Immunoglobu  95.9   0.019 4.1E-07   31.2   3.8   26   35-60      1-31  (106)
175 cd05774 Ig_CEACAM_D1 First imm  95.9   0.022 4.8E-07   31.7   4.1   27   32-59      9-35  (105)
176 PHA02826 IL-1 receptor-like pr  95.8    0.02 4.2E-07   35.9   4.0   33   30-62     31-73  (227)
177 cd05775 Ig_SLAM-CD84_like_N N-  95.5   0.014   3E-07   31.7   2.2   27   35-61      3-29  (97)
178 cd05712 Ig_Siglec_N Immunoglob  95.0     0.1 2.2E-06   29.1   5.0   32   29-60      7-43  (119)
179 cd05718 Ig1_PVR_like First imm  94.8   0.039 8.5E-07   29.3   2.8   24   37-60      1-26  (98)
180 cd05846 Ig1_MRC-OX-2_like Firs  94.7   0.059 1.3E-06   29.0   3.4   24   36-59      1-24  (97)
181 KOG4222|consensus               94.3   0.047   1E-06   41.3   3.0   56    5-64    119-174 (1281)
182 cd05714 Ig_CSPGs_LP Immunoglob  94.3    0.11 2.3E-06   28.2   3.8   24   36-59      2-30  (106)
183 cd07691 Ig_CD3_gamma_delta Imm  94.1   0.055 1.2E-06   28.4   2.3   19   37-60      7-25  (69)
184 cd05900 Ig_Aggrecan Immunoglob  94.1    0.11 2.4E-06   29.2   3.7   24   36-59      2-36  (112)
185 cd05878 Ig_Aggrecan_like Immun  94.1    0.12 2.5E-06   28.7   3.7   24   36-59      2-34  (110)
186 cd05713 Ig_MOG_like Immunoglob  93.8    0.17 3.6E-06   27.0   4.0   25   36-60      1-27  (100)
187 cd05879 Ig_P0 Immunoglobulin (  93.6    0.28 6.1E-06   27.7   4.7   26   31-56      8-36  (116)
188 cd05721 IgV_CTLA-4 Immunoglobu  93.0    0.36 7.9E-06   27.6   4.6   29   31-59      8-38  (115)
189 PF06328 Lep_receptor_Ig:  Ig-l  92.4    0.68 1.5E-05   25.1   5.0   33   32-64     14-50  (89)
190 PHA03052 Hypothetical protein;  91.9    0.81 1.8E-05   24.0   4.6   33   31-63      7-41  (69)
191 smart00406 IGv Immunoglobulin   91.8    0.37   8E-06   24.1   3.4   23   38-60      1-24  (81)
192 PHA02865 MHC-like TNF binding   91.2    0.23   5E-06   33.2   2.7   22   38-59    216-238 (338)
193 PF09085 Adhes-Ig_like:  Adhesi  90.6    0.33 7.1E-06   27.3   2.5   34   32-65     12-49  (110)
194 PF11049 KSHV_K1:  Glycoprotein  89.7    0.19 4.1E-06   26.3   1.1   21   40-63      2-22  (71)
195 cd05889 Ig1_DNAM-1_like First   88.1    0.93   2E-05   24.8   3.2   23   37-59      1-23  (96)
196 cd05887 Ig1_Nectin-3_like Firs  86.5     1.3 2.9E-05   24.2   3.2   23   37-59      1-23  (96)
197 PHA03112 IL-18 binding protein  85.2       2 4.2E-05   25.5   3.6   30   31-60     33-63  (141)
198 KOG1480|consensus               83.8    0.29 6.4E-06   36.0  -0.3   32   32-63    140-171 (909)
199 PF02440 Adeno_E3_CR1:  Adenovi  83.1     1.9 4.1E-05   22.1   2.7   20   33-57      2-21  (63)
200 cd05888 Ig1_Nectin-4_like Frst  83.0     3.1 6.7E-05   22.4   3.7   22   38-59      2-25  (100)
201 cd05902 Ig_Neurocan Immunoglob  80.1     4.4 9.5E-05   22.6   3.7   24   36-59      2-31  (110)
202 PF04668 Tsg:  Twisted gastrula  80.0    0.47   1E-05   27.8  -0.3   11   50-60     98-108 (132)
203 PHA03376 BARF1; Provisional     78.6     3.2 6.9E-05   26.2   3.0   29   31-59     21-51  (221)
204 PHA03376 BARF1; Provisional     77.5     2.4 5.2E-05   26.7   2.3   24   36-60    139-162 (221)
205 PF08204 V-set_CD47:  CD47 immu  73.8     4.3 9.4E-05   23.7   2.6   30   34-63     25-58  (130)
206 cd05901 Ig_Versican Immunoglob  66.3      14 0.00031   21.0   3.6   24   36-59      2-35  (117)
207 PF08239 SH3_3:  Bacterial SH3   55.9      21 0.00046   16.6   5.3   36   11-58      3-38  (55)
208 cd05886 Ig1_Nectin-1_like Firs  55.6      28  0.0006   18.9   3.5   22   38-59      2-26  (99)
209 PHA02982 hypothetical protein;  50.3      14  0.0003   23.7   1.9   29   32-60     35-63  (251)
210 TIGR02073 PBP_1c penicillin-bi  45.3 1.1E+02  0.0024   22.5   6.0   25   37-63    665-689 (727)
211 PF02124 Marek_A:  Marek's dise  40.7      90  0.0019   19.7   4.4   47    3-62     69-116 (211)
212 PF03921 ICAM_N:  Intercellular  37.9      61  0.0013   17.7   3.0   25   31-56     13-37  (91)
213 PRK14051 negative regulator Gr  37.8      50  0.0011   18.9   2.7   16   33-48     80-95  (123)
214 KOG1026|consensus               34.6      38 0.00083   25.4   2.3   31   32-63    203-233 (774)
215 PHA03298 envelope glycoprotein  34.6      29 0.00064   20.6   1.5   13   50-62     94-106 (167)
216 PHA00008 J DNA packaging prote  34.2      36 0.00078   14.3   1.3   15   49-63     11-25  (26)
217 PF07467 BLIP:  Beta-lactamase   33.3 1.1E+02  0.0024   19.0   3.8   30   33-62    145-175 (183)
218 COG3822 ABC-type sugar transpo  31.4   1E+02  0.0022   19.5   3.5   25   28-60    152-176 (225)
219 PF00801 PKD:  PKD domain;  Int  30.3      70  0.0015   15.6   2.3   28   32-60      7-34  (69)
220 COG4953 PbpC Membrane carboxyp  30.2 1.5E+02  0.0032   22.3   4.6   24   39-64    672-695 (733)
221 PRK11240 penicillin-binding pr  28.5 2.6E+02  0.0056   21.0   6.0   24   38-63    713-736 (772)
222 TIGR03000 plancto_dom_1 Planct  26.8 1.1E+02  0.0024   16.2   2.8   31    9-42     44-74  (75)
223 PF14041 Lipoprotein_21:  LppP/  26.7 1.1E+02  0.0024   16.2   3.7   13   50-62     24-36  (89)
224 cd02175 GH16_lichenase lichena  26.3      71  0.0015   19.4   2.3   13   51-63    149-161 (212)
225 TIGR02934 nifT_nitrog probable  25.8 1.1E+02  0.0024   15.9   3.0   20    1-21      4-23  (67)
226 COG4118 Phd Antitoxin of toxin  25.5      43 0.00093   18.0   1.1   21   32-55     20-40  (84)
227 PF10430 Ig_Tie2_1:  Tie-2 Ig-l  25.1 1.3E+02  0.0028   16.7   2.9   26   33-58     12-37  (96)
228 PHA03042 CD47-like protein; Pr  24.7 1.2E+02  0.0026   20.1   3.1   28   34-63     29-62  (286)
229 PF12158 DUF3592:  Protein of u  24.6      62  0.0013   18.0   1.7   16    7-22     94-109 (148)
230 PF09186 DUF1949:  Domain of un  24.1      75  0.0016   14.6   1.7   16    4-19     26-41  (56)
231 PRK13244 protease inhibitor pr  23.7 1.1E+02  0.0023   18.3   2.5   10   38-47     61-70  (145)
232 PF15531 Toxin_51:  Putative to  23.1      52  0.0011   19.2   1.1   15   48-62    113-127 (128)
233 cd00146 PKD polycystic kidney   23.0 1.1E+02  0.0025   15.1   3.6   25   36-60     14-38  (81)
234 PF00722 Glyco_hydro_16:  Glyco  22.9      95  0.0021   18.0   2.3   13   51-63    129-141 (185)
235 PF01200 Ribosomal_S28e:  Ribos  22.8   1E+02  0.0022   16.1   2.1   10   32-41     49-58  (69)
236 cd08023 GH16_laminarinase_like  22.7      92   0.002   19.0   2.3   13   51-63    169-181 (235)
237 PF10856 DUF2678:  Protein of u  22.4      34 0.00074   19.7   0.3    9   53-61     78-86  (118)
238 COG2132 SufI Putative multicop  22.2   2E+02  0.0043   19.7   4.0   28   28-57     63-91  (451)
239 cd00413 Glyco_hydrolase_16 gly  22.1      96  0.0021   18.4   2.3   12   52-63    154-165 (210)
240 PF03712 Cu2_monoox_C:  Copper   22.1 1.6E+02  0.0035   17.2   3.1   19   30-48     86-104 (156)
241 cd02183 GH16_fungal_CRH1_trans  21.3   1E+02  0.0022   19.0   2.2   13   51-63    126-138 (203)
242 PF11515 Cul7:  Mouse developme  21.2 1.1E+02  0.0024   16.4   2.1   31   32-62     32-64  (78)
243 PF01681 C6:  C6 domain;  Inter  20.7 1.5E+02  0.0033   15.6   2.9   20   38-64     68-88  (92)
244 cd04457 S1_S28E S1_S28E: S28E,  20.5 1.4E+02  0.0031   15.2   3.7   10   32-41     40-49  (60)
245 PRK10380 hypothetical protein;  20.4 1.4E+02   0.003   15.2   2.2   13   46-58     17-29  (63)

No 1  
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=99.21  E-value=2.5e-11  Score=65.31  Aligned_cols=28  Identities=50%  Similarity=0.903  Sum_probs=25.7

Q ss_pred             cEEEEEEecCCCCCceEEEEECCEEccC
Q psy7728          38 EITLECLVKNAKPAAKIVWYRGNTELKL   65 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~~i~W~~~~~~l~~   65 (65)
                      .++|+|.+.+|+|+|.|+||||+++|.+
T Consensus         1 ~~~L~C~s~~skP~a~i~W~k~~~~l~~   28 (80)
T cd05885           1 EVELTCLSPRSKPAATLRWYRDRKELKG   28 (80)
T ss_pred             CEEEEEeCCCccCCCeEEEEECCEECCC
Confidence            3689999999999999999999999864


No 2  
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=99.14  E-value=1.7e-10  Score=64.39  Aligned_cols=33  Identities=30%  Similarity=0.447  Sum_probs=30.5

Q ss_pred             EeecCCcEEEEEEecCCCCCce--EEEEECCEEcc
Q psy7728          32 EIRENQEITLECLVKNAKPAAK--IVWYRGNTELK   64 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~--i~W~~~~~~l~   64 (65)
                      .+.+|+.++|+|++.+++|++.  |+|||+++++.
T Consensus        12 ~~~eG~~~tL~C~v~g~~P~a~L~i~W~rG~~~l~   46 (100)
T cd05755          12 WQPVGKNYTLQCDVPGVAPRQNLTVVLLRGNETLS   46 (100)
T ss_pred             cccCCCcEEEEEEEcCcCCCCcEEEEEeeCCEEcc
Confidence            5789999999999999999998  69999999875


No 3  
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=99.14  E-value=9.9e-11  Score=63.26  Aligned_cols=28  Identities=50%  Similarity=0.899  Sum_probs=25.7

Q ss_pred             cEEEEEEecCCCCCceEEEEECCEEccC
Q psy7728          38 EITLECLVKNAKPAAKIVWYRGNTELKL   65 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~~i~W~~~~~~l~~   65 (65)
                      .++|+|.+.+++|+|.|+||||++++.|
T Consensus         1 ~~~L~C~s~gSkP~A~I~W~k~~~~l~~   28 (82)
T cd05883           1 EIELNCTAMASKPAATIRWFKGNKELTG   28 (82)
T ss_pred             CEEEEEEecCCCCCCEEEEEECCEECcC
Confidence            3689999999999999999999999865


No 4  
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=99.10  E-value=1.9e-10  Score=65.01  Aligned_cols=49  Identities=20%  Similarity=0.396  Sum_probs=41.0

Q ss_pred             EEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCC-ceEEEEECCEEcc
Q psy7728          12 YQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPA-AKIVWYRGNTELK   64 (65)
Q Consensus        12 ~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~-~~i~W~~~~~~l~   64 (65)
                      .|+++|+.|.|.+...    ....|+.++|.|.+.+++|+ ..|+|+|||+++.
T Consensus         1 ~v~~~P~~p~i~~~~~----~~~~g~~~tL~C~a~gF~P~~i~v~W~kng~~~~   50 (111)
T cd05772           1 SVRAKPSVPVVSGPSG----RANPGQSVNFTCSAHGFSPRDITVKWLKNGNELS   50 (111)
T ss_pred             CcccCCCCcEeCCchh----ccCCCCCEEEEEEEeeEeCCCCEEEEEECCEECc
Confidence            3789999998876443    45678899999999999996 7999999999874


No 5  
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=98.88  E-value=5.9e-09  Score=57.86  Aligned_cols=36  Identities=22%  Similarity=0.355  Sum_probs=31.5

Q ss_pred             CeEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          29 SKIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        29 ~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ..+.+.+|+.++|.|.+.+..|+|.++|||||+++.
T Consensus        11 ~~~~v~~G~~v~L~c~v~g~~P~p~v~W~Kdg~~i~   46 (101)
T cd04975          11 TTIFVNLGENLNLVVEVEAYPPPPHINWTYDNRTLT   46 (101)
T ss_pred             ceEEEECCCCEEEEEEEEecCCCCccEEEeCCeeCC
Confidence            346889999999999996658999999999999875


No 6  
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=98.85  E-value=6.5e-09  Score=55.89  Aligned_cols=27  Identities=37%  Similarity=0.812  Sum_probs=24.6

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEccC
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELKL   65 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~~   65 (65)
                      ++|+|.+.+++|+++|+|||||+++.+
T Consensus         2 ~~LtC~a~gf~P~~~itW~kng~~l~~   28 (83)
T cd05884           2 MQLTCKTSGSKPAADIRWFKNDKEIKD   28 (83)
T ss_pred             EEEEEEeCCccCCCEEEEEECCEECcC
Confidence            689999999999999999999998753


No 7  
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=98.85  E-value=7e-09  Score=55.26  Aligned_cols=27  Identities=44%  Similarity=0.897  Sum_probs=24.6

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEccC
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELKL   65 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~~   65 (65)
                      ++|+|.+.+++|+++|+|||||+++.+
T Consensus         2 ~~L~C~~~~~~P~~~v~W~~~~~~l~~   28 (82)
T cd05761           2 VELTCTSSGSKPAATIRWFKGDKELKG   28 (82)
T ss_pred             EEEEEEecCcCcCCeEEEEECCEEccC
Confidence            689999999999999999999998753


No 8  
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=98.84  E-value=7.6e-09  Score=55.49  Aligned_cols=27  Identities=41%  Similarity=0.759  Sum_probs=24.6

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEccC
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELKL   65 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~~   65 (65)
                      ++|+|.+.+++|+++|+|||||+++.+
T Consensus         2 ~~LtC~a~g~~P~~~ItW~k~g~~l~~   28 (83)
T cd07705           2 AKLRCTSSGSKPAANIKWRKGDQELEG   28 (83)
T ss_pred             EEEEEEecCccCCCEeEEEECCEECCC
Confidence            689999999999999999999998753


No 9  
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=98.79  E-value=1.9e-08  Score=53.81  Aligned_cols=33  Identities=24%  Similarity=0.691  Sum_probs=28.8

Q ss_pred             EEeecCCcEEEEEEecCCCCCc-eEEEEECCEEcc
Q psy7728          31 IEIRENQEITLECLVKNAKPAA-KIVWYRGNTELK   64 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~-~i~W~~~~~~l~   64 (65)
                      +.+.+|+.+.|+|.+. |+|.| +|+|+|||+++.
T Consensus         8 ~~v~~G~~v~l~C~a~-G~P~P~~I~W~k~g~~l~   41 (81)
T cd05749           8 LSVTANTPFNLTCQAV-GPPEPVEILWWQGGSPLG   41 (81)
T ss_pred             eEEcCCCCEEEEEEee-eecCCeEEEEEECCEECC
Confidence            5788999999999985 57888 799999999874


No 10 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=98.79  E-value=2.1e-08  Score=54.16  Aligned_cols=34  Identities=24%  Similarity=0.603  Sum_probs=29.6

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+.+|+.++|.|.+. |.|.|.|.|||+|+++.
T Consensus        10 ~v~v~~G~~v~L~C~v~-G~P~p~v~W~k~g~~l~   43 (92)
T cd05737          10 VVTIMEGKTLNLTCTVF-GDPDPEVSWLKNDQALA   43 (92)
T ss_pred             eEEEeCCCcEEEEEEEE-ecCCCeEEEEECCEECc
Confidence            45789999999999985 57999999999998763


No 11 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=98.78  E-value=2.8e-08  Score=52.43  Aligned_cols=34  Identities=18%  Similarity=0.462  Sum_probs=29.7

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.+.+|+++.|.|.+..+.|.+.|.|||+|+.+.
T Consensus         6 ~~~~~G~~v~l~C~~~~g~p~p~i~W~k~g~~~~   39 (86)
T cd05724           6 TQVAVGEMAVLECSPPRGHPEPTVSWRKDGQPLN   39 (86)
T ss_pred             EEEeCCCCEEEEEECCCCCCCCEEEEEECCEECC
Confidence            4678999999999986678999999999998763


No 12 
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=98.77  E-value=2.6e-08  Score=53.39  Aligned_cols=34  Identities=21%  Similarity=0.584  Sum_probs=29.6

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+.+|+.++|+|.+. |+|.+.|+|||+|+.+.
T Consensus        10 ~~~v~~G~~~~l~C~~~-g~P~p~i~W~k~g~~l~   43 (100)
T cd07693          10 DLIVSKGDPATLNCKAE-GRPTPTIQWLKNGQPLE   43 (100)
T ss_pred             eeEEcCCCeEEEEeeCC-cCCCCEEEEEECCEECc
Confidence            45788999999999985 57999999999998864


No 13 
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=98.76  E-value=7.1e-08  Score=55.53  Aligned_cols=53  Identities=17%  Similarity=0.224  Sum_probs=39.1

Q ss_pred             cCCCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCC-ceEEEEECCEE
Q psy7728           5 YGPRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPA-AKIVWYRGNTE   62 (65)
Q Consensus         5 ~~~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~-~~i~W~~~~~~   62 (65)
                      ....++|+|..+|.. .+....    ....+|+.++|+|.+.+.+|+ ++|+|+|+|..
T Consensus        27 ~~~~~~l~v~~~P~v-~~~~~~----~~~~~~~~~~L~C~a~g~~P~~~~i~W~~~g~~   80 (139)
T cd05771          27 AQQIIQLSVSEPPRV-RLSLEK----LVSMIEEPQTLICHIAGYYPLDVQVEWTREPPG   80 (139)
T ss_pred             eeeEEEEEEecCCce-EEeCCC----ceeecCCcEEEEEEECCCCCCCeEEEEEECCCC
Confidence            445688999998854 333221    234478999999999988886 69999999853


No 14 
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.75  E-value=2.2e-08  Score=52.91  Aligned_cols=26  Identities=42%  Similarity=0.891  Sum_probs=23.7

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.|+|.+.+++|.+.|+|||+|+++.
T Consensus         2 ~~L~C~v~g~~P~~~v~W~~~g~~l~   27 (82)
T cd05759           2 YNLTCRARGAKPAAEIIWFRDGEVLD   27 (82)
T ss_pred             EEEEEEEeCccCCCEEEEEECCEEcc
Confidence            68999999989999999999999764


No 15 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.73  E-value=1.9e-08  Score=52.27  Aligned_cols=29  Identities=28%  Similarity=0.656  Sum_probs=25.5

Q ss_pred             cCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          35 ENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        35 ~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +|+.+.|.|.+. |+|.|.|+|||+|..+.
T Consensus         1 eG~~v~l~C~~~-g~P~p~i~W~k~g~~~~   29 (74)
T cd05745           1 EGQTVDFLCEAQ-GYPQPVIAWTKGGSQLS   29 (74)
T ss_pred             CCCeEEEEeECC-EecCCEEEEEECCEECC
Confidence            689999999984 58999999999998763


No 16 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=98.73  E-value=3.7e-08  Score=51.99  Aligned_cols=32  Identities=16%  Similarity=0.562  Sum_probs=28.1

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+|+.++|.|.+.+ .|++.|+|||+|+++.
T Consensus         5 ~v~~G~~~~L~C~~~g-~P~p~i~W~k~g~~l~   36 (85)
T cd05857           5 AVPAANTVKFRCPAAG-NPTPTMRWLKNGKEFK   36 (85)
T ss_pred             EcCCCCEEEEEEEcCC-CCCCEEEEEECCEECC
Confidence            5788999999999954 6999999999998864


No 17 
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=98.71  E-value=1.9e-08  Score=53.73  Aligned_cols=28  Identities=29%  Similarity=0.675  Sum_probs=24.8

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      |+.++|+|.+.+++|+|.|+|+.++..+
T Consensus        14 ~~~~~~~C~s~~~~P~~~i~W~~~~~~~   41 (89)
T PF08205_consen   14 GEEVTLTCSSSGGYPPPQITWYLDGGPV   41 (89)
T ss_dssp             TEEEEEEEEEEEEBS-EEEEEEETTCEE
T ss_pred             ceEEEEEEEeCCeECCeEEEEEECCCce
Confidence            6799999999999999999999998765


No 18 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=98.71  E-value=6.3e-08  Score=52.59  Aligned_cols=42  Identities=26%  Similarity=0.350  Sum_probs=32.6

Q ss_pred             cEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          20 IEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        20 ~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      |.|.....+..+.+.+|+.++|.|.+.+ . .+.|.||||+..+
T Consensus         2 p~~~~~~~~~~~~v~~g~~v~l~C~a~g-~-~p~i~W~kng~~l   43 (91)
T cd05740           2 PVINSNNSVGNQPPEDNQPVTLTCEAEG-Q-ATYIWWVNNGSLL   43 (91)
T ss_pred             CEeecccccCccccccCCcEEEEEEeCC-C-CCEEEEEECCEEC
Confidence            3444334444568999999999999965 5 8999999999875


No 19 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.71  E-value=5.1e-08  Score=51.73  Aligned_cols=32  Identities=25%  Similarity=0.450  Sum_probs=26.5

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .+.+|+.++|+|.+.+..+...+.|||||+.+
T Consensus        11 ~v~~G~~V~L~C~~~~~p~~~~~~W~kng~~l   42 (78)
T cd05752          11 TIFQGEKVTLTCNGFNSPEQNSTQWYHNGKLL   42 (78)
T ss_pred             EeeCCCCEEEEEeCCCCCCCccEEEEECCEEe
Confidence            67899999999999664234579999999986


No 20 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=98.70  E-value=6e-08  Score=52.36  Aligned_cols=34  Identities=18%  Similarity=0.434  Sum_probs=29.5

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+..|+.++|.|.+. |.|.+.++|+|+|+.+.
T Consensus        12 ~~~~~~G~~v~L~C~~~-g~P~p~v~W~k~g~~~~   45 (95)
T cd05730          12 NATANLGQSVTLACDAD-GFPEPTMTWTKDGEPIE   45 (95)
T ss_pred             ceEEeCCCCEEEEEecc-EeCCCEEEEEECCEECc
Confidence            45789999999999985 58999999999998764


No 21 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=98.67  E-value=4.8e-08  Score=50.58  Aligned_cols=28  Identities=25%  Similarity=0.675  Sum_probs=24.4

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      |+.++|.|.+. |+|.|.|+|+|+|+++.
T Consensus         1 G~~v~L~C~a~-G~P~P~v~W~k~g~~l~   28 (69)
T cd05739           1 GGSVNLTCVAV-GAPMPYVKWMKGGEELT   28 (69)
T ss_pred             CCeEEEEEEee-ecCCCEEEEEECCEECC
Confidence            67899999996 57999999999998763


No 22 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.67  E-value=4.4e-08  Score=51.13  Aligned_cols=28  Identities=21%  Similarity=0.580  Sum_probs=24.4

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      |+.++|.|.+. |.|.|.|+|||||+++.
T Consensus         1 G~~v~l~C~~~-G~P~p~i~W~k~g~~i~   28 (76)
T cd05867           1 GETARLDCQVE-GIPTPNITWSINGAPIE   28 (76)
T ss_pred             CCeEEEEEEee-EeCCCeEEEEECCEECC
Confidence            68899999985 57999999999998764


No 23 
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.66  E-value=6.8e-08  Score=51.97  Aligned_cols=32  Identities=25%  Similarity=0.449  Sum_probs=28.0

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ..+.+|+.++|.|.+. |+|.|.|+|||++.++
T Consensus        11 ~~~~~G~~v~l~C~~~-G~P~P~v~W~k~~~~~   42 (88)
T cd05851          11 TYALKGQNVTLECFAL-GNPVPVIRWRKILEPM   42 (88)
T ss_pred             EEEeCCCcEEEEEEec-ccCCCEEEEEECCcCC
Confidence            4688999999999995 5899999999998765


No 24 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=98.65  E-value=1e-07  Score=51.15  Aligned_cols=34  Identities=21%  Similarity=0.579  Sum_probs=29.9

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+.+|+.+.|.|.+. |.|.|.++|+|+++++.
T Consensus         4 ~~~v~~G~~v~l~c~~~-G~P~P~v~W~k~~~~i~   37 (86)
T cd05894           4 TIVVVAGNKLRLDVPIS-GEPAPTVTWSRGDKAFT   37 (86)
T ss_pred             EEEEEcCCEEEEEeeEe-ecCCCeEEEEECCEECc
Confidence            45789999999999995 58999999999999874


No 25 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=98.64  E-value=1.2e-07  Score=51.14  Aligned_cols=34  Identities=21%  Similarity=0.551  Sum_probs=29.7

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+.+|+.+.|.|.+. ++|.+.+.|||+|..+.
T Consensus        12 ~~~~~~G~~~~L~C~~~-g~P~p~v~W~k~g~~l~   45 (92)
T cd05747          12 SLTVSEGESARFSCDVD-GEPAPTVTWMREGQIIV   45 (92)
T ss_pred             cEEEeCCCcEEEEEEEe-ecCCCEEEEEECCEECC
Confidence            46789999999999985 68999999999998763


No 26 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.64  E-value=1.1e-07  Score=51.43  Aligned_cols=33  Identities=24%  Similarity=0.504  Sum_probs=28.3

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ..+.+|++++|.|.+. +.|++.|+|+|||+.+.
T Consensus         9 ~~~~~g~~v~l~C~v~-g~P~p~i~W~k~g~~l~   41 (95)
T cd05722           9 IVAVRGGPVVLNCSAE-GEPPPKIEWKKDGVLLN   41 (95)
T ss_pred             eEEcCCCCEEEeeecc-cCCCCEEEEEECCeECc
Confidence            3567899999999985 46999999999999874


No 27 
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=98.63  E-value=1.1e-07  Score=52.25  Aligned_cols=34  Identities=15%  Similarity=0.463  Sum_probs=30.1

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+.+|+.+.|.|.+. |.|++.++|||||++|.
T Consensus         9 ~~~v~~G~~v~l~C~~~-G~p~p~v~W~kdg~~l~   42 (98)
T cd05762           9 DMKVRAGESVELFCKVT-GTQPITCTWMKFRKQIQ   42 (98)
T ss_pred             CEEEECCCEEEEEEEEc-ccCCCceEEEECCEEec
Confidence            35789999999999995 68999999999999874


No 28 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.62  E-value=6.9e-08  Score=50.63  Aligned_cols=28  Identities=21%  Similarity=0.531  Sum_probs=24.5

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      |+.++|.|.+. |+|.|.|+|+|||+++.
T Consensus         1 g~~~~l~C~a~-G~P~P~i~W~k~g~~i~   28 (76)
T cd05868           1 GEDGTLICRAN-GNPKPSISWLTNGVPIE   28 (76)
T ss_pred             CCCEEEEEEee-EeCCCeEEEEECCEEcc
Confidence            67899999995 47999999999999873


No 29 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=98.61  E-value=7.7e-08  Score=52.38  Aligned_cols=30  Identities=23%  Similarity=0.676  Sum_probs=25.9

Q ss_pred             ecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          34 RENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+|+.++|.|.+. |.|.|.|+|||||+++.
T Consensus        17 ~~g~~v~l~C~~~-G~P~P~i~W~k~g~~l~   46 (94)
T cd05848          17 SDEKKVILNCEAR-GNPVPTYRWLRNGTEID   46 (94)
T ss_pred             CCCCEEEEEEEee-ecCCCEEEEEECCeECc
Confidence            3578999999995 57999999999998874


No 30 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=98.59  E-value=1.5e-07  Score=50.96  Aligned_cols=34  Identities=21%  Similarity=0.727  Sum_probs=29.5

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+.+|+.+.|.|.+. +.|.+.+.|||+|..+.
T Consensus        10 ~v~v~eG~~v~L~C~v~-g~P~p~i~W~k~~~~~~   43 (92)
T cd05891          10 VVTIMEGKTLNLTCTVF-GNPDPEVIWFKNDQDIE   43 (92)
T ss_pred             cEEEcCCCEEEEEEEEE-EeCCCeEEEEECCEECC
Confidence            46889999999999985 47999999999998763


No 31 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=98.59  E-value=1.5e-07  Score=50.50  Aligned_cols=31  Identities=19%  Similarity=0.433  Sum_probs=27.9

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .+.+|+.+.|.|.+. |+|.|.|+||+||..+
T Consensus        11 ~v~~G~~v~l~C~~~-G~P~p~v~W~~~g~~~   41 (90)
T cd04972          11 VVYEGGTATIRCTAE-GSPLPKVEWIIAGLIV   41 (90)
T ss_pred             EEcCCCcEEEEEEEE-EcCCCeEEEEECCEEc
Confidence            478999999999996 5899999999999876


No 32 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.57  E-value=1.7e-07  Score=49.98  Aligned_cols=33  Identities=18%  Similarity=0.419  Sum_probs=28.7

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ..+..|+.++|.|.+. |.|.|.++|||+|+++.
T Consensus         9 ~~~~~G~~~~l~C~~~-g~p~p~v~W~k~g~~~~   41 (85)
T cd05728           9 TEADIGSSLRWECKAS-GNPRPAYRWLKNGQPLA   41 (85)
T ss_pred             cEEcCCCcEEEEEEee-EeCCCEEEEEECCEECC
Confidence            3678899999999985 57999999999999764


No 33 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.54  E-value=1.7e-07  Score=48.45  Aligned_cols=28  Identities=18%  Similarity=0.462  Sum_probs=24.5

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      |+.++|.|.+. ++|.|.|+||++|+++.
T Consensus         1 G~~~~l~C~~~-g~P~p~i~W~~~g~~~~   28 (76)
T cd04978           1 GETGRLDCEAE-GIPQPTITWRLNGVPIE   28 (76)
T ss_pred             CCeEEEEEEce-eeCCCEEEEEECCEECC
Confidence            68899999985 58999999999998763


No 34 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=98.53  E-value=4.2e-07  Score=48.06  Aligned_cols=34  Identities=29%  Similarity=0.805  Sum_probs=30.0

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+.+|+.++|.|.+.+ .|.+.+.|+++|..+.
T Consensus         9 ~~~v~~G~~~~l~c~~~~-~p~~~v~W~~~~~~l~   42 (90)
T PF07679_consen    9 DVTVKEGESVTLECEVSG-NPPPTVTWYKNGRPLT   42 (90)
T ss_dssp             EEEEETTSEEEEEEEEEE-SSSSEEEEEETTEEEE
T ss_pred             CEEEeCCCEEEEEEEEEe-CCCCccccccccccee
Confidence            468899999999999975 5999999999998874


No 35 
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=98.52  E-value=1.8e-07  Score=50.82  Aligned_cols=29  Identities=34%  Similarity=0.664  Sum_probs=24.9

Q ss_pred             cCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          35 ENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        35 ~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .|+.++|.|.+. |+|.+.|+||+||+.+.
T Consensus        18 ~g~~v~l~C~a~-g~P~p~i~W~~~g~~l~   46 (94)
T cd05850          18 PEEKVTLGCRAR-ASPPATYRWKMNGTEIK   46 (94)
T ss_pred             CCCeEEEEeEce-eCCCCEEEEEECCEECc
Confidence            356899999995 58999999999999874


No 36 
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=98.52  E-value=5.9e-07  Score=46.06  Aligned_cols=32  Identities=25%  Similarity=0.770  Sum_probs=28.4

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.+|+.++|+|.+. ++|...+.|++++..+.
T Consensus        10 ~v~~g~~~~l~C~~~-~~p~~~~~w~~~~~~~~   41 (80)
T PF13895_consen   10 SVEEGDSVTLTCSVS-GNPPPQVQWYKNGSPIN   41 (80)
T ss_dssp             EEETTSEEEEEEEEE-SSSSSEEEEEETTEEEE
T ss_pred             EEeCCCcEEEEEEEE-cccceeeeeeeeeeeee
Confidence            689999999999997 68889999999998763


No 37 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=98.50  E-value=3.1e-07  Score=48.38  Aligned_cols=32  Identities=16%  Similarity=0.448  Sum_probs=26.9

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ..+.+|+.++|+|.+.+ . .+.|.|||||+++.
T Consensus         4 ~~~~~G~~v~l~C~~~~-~-~~~v~W~k~g~~l~   35 (79)
T cd04973           4 YSAHPGDLLQLRCRLRD-D-VQSINWTKDGVQLG   35 (79)
T ss_pred             EEecCCCCEEEEEEecC-C-CceEEEeeCCcCCC
Confidence            46889999999999976 3 56899999998764


No 38 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=98.49  E-value=1.5e-07  Score=48.79  Aligned_cols=25  Identities=24%  Similarity=0.563  Sum_probs=21.8

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ++|.|.+. |.|+|.++|||||+++.
T Consensus         1 ~~l~c~v~-g~P~P~v~W~kdg~~l~   25 (67)
T cd05863           1 VKLPVKVA-AYPPPEFQWYKDGKLIS   25 (67)
T ss_pred             CEEEEEEE-EeCCCEEEEEECCEECc
Confidence            47999995 58999999999999874


No 39 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=98.49  E-value=3.4e-07  Score=50.70  Aligned_cols=33  Identities=18%  Similarity=0.229  Sum_probs=28.7

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ..+..|+.++|.|.+.+ .|+|.++|||||++|.
T Consensus        13 ~~~~~~~~~~l~~~v~g-~P~P~v~W~kdg~~l~   45 (101)
T cd05859          13 EFANLHEVKEFVVEVEA-YPPPQIRWLKDNRTLI   45 (101)
T ss_pred             EEEecCCcEEEEEEEEE-eCCCceEEEECCEECc
Confidence            36788899999999954 7999999999999874


No 40 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=98.49  E-value=3.7e-07  Score=49.09  Aligned_cols=32  Identities=28%  Similarity=0.560  Sum_probs=27.3

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ..+.+|+.++|.|.+. +.|.+.++|||++..+
T Consensus        11 ~~~~~g~~v~l~C~~~-g~p~p~v~W~~~~~~~   42 (96)
T cd05732          11 QTAVELEQITLTCEAE-GDPIPEITWRRATRNF   42 (96)
T ss_pred             eeEecCCcEEEEEEEe-EcCCCcEEEEECCccc
Confidence            4688999999999995 5799999999998544


No 41 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=98.46  E-value=7.6e-07  Score=48.39  Aligned_cols=30  Identities=23%  Similarity=0.584  Sum_probs=25.4

Q ss_pred             eecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          33 IRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        33 ~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ...|+.++|.|.+. |.|.|.|+||++++.+
T Consensus        14 ~~~g~~v~l~C~~~-G~P~P~v~W~~~~~~~   43 (97)
T cd05869          14 MELEEQITLTCEAS-GDPIPSITWRTSTRNI   43 (97)
T ss_pred             EEcCCCEEEEEEee-EeCCCEEEEEECCccc
Confidence            44589999999996 5799999999998765


No 42 
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=98.45  E-value=2.4e-07  Score=47.66  Aligned_cols=26  Identities=23%  Similarity=0.721  Sum_probs=22.6

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.|.|.+.++.|.+.++|||+|+++.
T Consensus         1 ~~l~C~~~g~~P~p~~~W~k~g~~l~   26 (75)
T cd05750           1 LVLKCEATSEYPSLRFKWFKDGKELN   26 (75)
T ss_pred             CEEEEEccCCCCCceEEEEcCCeecc
Confidence            47999998768999999999998764


No 43 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=98.45  E-value=3e-07  Score=47.77  Aligned_cols=32  Identities=25%  Similarity=0.612  Sum_probs=27.1

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +....|+.++|.|.+. +.|.+.++|||++..+
T Consensus         4 ~~~~~G~~v~L~C~~~-g~p~p~i~W~k~~~~~   35 (82)
T cd05856           4 IARPVGSSVRLKCVAS-GNPRPDITWLKDNKPL   35 (82)
T ss_pred             eeccCCCeEEEEEEee-EeCCCcEEEEECCcCC
Confidence            4567799999999985 4799999999998765


No 44 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.43  E-value=5e-07  Score=48.15  Aligned_cols=32  Identities=25%  Similarity=0.549  Sum_probs=27.3

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ..+.+|+.++|.|.+. ++|.+.++|+|++..+
T Consensus        11 ~~~~~g~~v~l~C~~~-g~P~p~v~W~k~~~~~   42 (88)
T cd04968          11 TYALKGQNVTLECFAL-GNPVPQIKWRKVDGSM   42 (88)
T ss_pred             eEEeCCCcEEEEEEee-EeCCCEEEEEECCCcC
Confidence            4678999999999985 5799999999987654


No 45 
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=98.42  E-value=7.9e-07  Score=47.10  Aligned_cols=33  Identities=30%  Similarity=0.600  Sum_probs=28.3

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +.+.+|+.++|.|.+.++.|.+.|.|++++..+
T Consensus        11 ~~v~~G~~v~L~C~~~~~~~~~~i~W~~~~~~~   43 (85)
T cd05754          11 QEVRPGADVSFICRAKSKSPAYTLVWTRVGGGL   43 (85)
T ss_pred             eEEcCCCCEEEEEEcCCCCCCcEEEEEECCCcC
Confidence            467889999999999776799999999998654


No 46 
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=98.41  E-value=3.7e-07  Score=48.07  Aligned_cols=25  Identities=40%  Similarity=0.825  Sum_probs=21.6

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.|.|.+. |.|.|.|+|||||+.+.
T Consensus         1 v~l~C~v~-G~P~P~i~W~k~~~~i~   25 (75)
T cd05892           1 VKLECQIS-AIPPPKIFWKRNNEMVQ   25 (75)
T ss_pred             CEEEEEEE-ecCCCeEEEEECCEECc
Confidence            47999995 57999999999999874


No 47 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=98.41  E-value=1.2e-06  Score=47.58  Aligned_cols=33  Identities=21%  Similarity=0.398  Sum_probs=27.9

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ...+..|+++.|.|.+. + |.+.|+|++||+++.
T Consensus         5 ~~~v~~G~~v~L~C~~~-~-~~~~i~W~~ng~~i~   37 (87)
T cd05873           5 QRTFKLGNNAELKCSPK-S-NLARVVWKFDGKVLT   37 (87)
T ss_pred             eEEEECCCCEEEEEECC-C-CCCeEEEEECCEECC
Confidence            35789999999999974 3 678999999999874


No 48 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.40  E-value=1.4e-06  Score=47.37  Aligned_cols=28  Identities=32%  Similarity=0.583  Sum_probs=24.9

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEEC
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      ..+.+|+.++|.|.+. |.|.|.|+|||+
T Consensus        11 ~~~~~G~~v~l~C~~~-G~P~p~i~W~k~   38 (98)
T cd05870          11 ETTVENGAATLSCKAE-GEPIPEITWKRA   38 (98)
T ss_pred             EEEcCCCcEEEEEecc-cCCCCeEEEEEC
Confidence            5789999999999985 579999999994


No 49 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.40  E-value=6.4e-07  Score=46.28  Aligned_cols=28  Identities=32%  Similarity=0.687  Sum_probs=24.2

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      |+.+.|.|.+. +.|.+.++|||+++.+.
T Consensus         1 G~~v~L~C~~~-g~P~p~v~W~k~~~~~~   28 (73)
T cd04969           1 GGDVIIECKPK-AAPKPTISWSKGTELLT   28 (73)
T ss_pred             CCeEEEEEeee-EcCCCEEEEEECCEEcc
Confidence            67899999985 57999999999998763


No 50 
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.40  E-value=4.4e-07  Score=47.76  Aligned_cols=24  Identities=33%  Similarity=0.767  Sum_probs=20.9

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +.|.|.+. |+|.|+|+|||||.++
T Consensus         1 ~~l~C~a~-G~P~P~i~W~k~g~~l   24 (77)
T cd05874           1 IVIQCEAK-GKPPPSFSWTRNGTHF   24 (77)
T ss_pred             CEEEeeCc-ccCCCeEEEEECCeEC
Confidence            47999995 5799999999999876


No 51 
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=98.39  E-value=6.1e-07  Score=49.81  Aligned_cols=30  Identities=27%  Similarity=0.564  Sum_probs=27.1

Q ss_pred             eEEeecCCcEEE-EEEecCCCCCceEEEEEC
Q psy7728          30 KIEIRENQEITL-ECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        30 ~~~~~~G~~~~L-~C~~~~~~P~~~i~W~~~   59 (65)
                      .+.+.+|+.+.+ +|.+.+|+|+|+|+||.+
T Consensus        10 ~~~~~~g~~~~vA~C~sa~gkPaa~IsW~~~   40 (97)
T cd07704          10 SLLIDGGNGTTLAACCAAEGRPAADVTWETN   40 (97)
T ss_pred             eeEeecCcceeEEEEEccCCccCCEeEEeCC
Confidence            456788999999 999999999999999987


No 52 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.39  E-value=5.6e-07  Score=47.04  Aligned_cols=27  Identities=33%  Similarity=0.684  Sum_probs=23.7

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      |+.+.|.|.+. +.|.|.|+|||+++.+
T Consensus         1 G~~~~l~C~~~-g~P~p~v~W~k~~~~l   27 (73)
T cd05852           1 GGRVIIECKPK-AAPKPKFSWSKGTELL   27 (73)
T ss_pred             CCeEEEEEecc-eeCCCEEEEEeCCEec
Confidence            67899999996 5799999999999865


No 53 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=98.39  E-value=1.1e-06  Score=49.05  Aligned_cols=29  Identities=17%  Similarity=0.486  Sum_probs=25.1

Q ss_pred             cCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          35 ENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        35 ~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .|..++|.|.+. |+|.+.++|+|||..+.
T Consensus        22 ~g~~v~L~C~a~-G~P~p~i~W~k~g~~l~   50 (109)
T cd05773          22 GSSDANLVCQAQ-GVPRVQFRWAKNGVPLD   50 (109)
T ss_pred             CCCEEEEEEECc-ccCCCEEEEEECCEECC
Confidence            467899999996 58999999999998763


No 54 
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.39  E-value=7.9e-07  Score=47.45  Aligned_cols=32  Identities=25%  Similarity=0.457  Sum_probs=28.1

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .+.+|+.++|+|.+.++.|..++.|||+|+.+
T Consensus        10 ~V~~G~~vtL~C~~~~~~~~~~~~w~k~g~~~   41 (83)
T cd05753          10 VVFEGEPLVLRCHGWKNKPVYKVTYYRDGKAK   41 (83)
T ss_pred             eecCCCCEEEEeeCCCCCcceEEEEEECCeEc
Confidence            57899999999998766778899999999865


No 55 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.38  E-value=2.3e-06  Score=46.55  Aligned_cols=33  Identities=24%  Similarity=0.456  Sum_probs=28.0

Q ss_pred             EEeecCCcEEEEEEecCCCCCc-eEEEEECCEEcc
Q psy7728          31 IEIRENQEITLECLVKNAKPAA-KIVWYRGNTELK   64 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~-~i~W~~~~~~l~   64 (65)
                      ..+.+|+.++|.|.+.+ .|.| .|.|+++++.+.
T Consensus        11 ~~~~~G~~v~L~C~~~g-~P~P~~v~W~~~~~~i~   44 (98)
T cd05758          11 QYAILGDKGRVECFIFS-TPPPDRIVWTWKENELE   44 (98)
T ss_pred             EEEeCCCcEEEEEEEcc-cCCCCEeEEEECCEEcc
Confidence            46789999999999964 6887 699999998763


No 56 
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=98.37  E-value=7.5e-07  Score=47.74  Aligned_cols=31  Identities=26%  Similarity=0.549  Sum_probs=26.7

Q ss_pred             ecCCcEEEEEEecCCCC-CceEEEEECCEEcc
Q psy7728          34 RENQEITLECLVKNAKP-AAKIVWYRGNTELK   64 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P-~~~i~W~~~~~~l~   64 (65)
                      ..|+.++|.|.+.+.+| .++|+|++||+.+.
T Consensus        11 ~~~~~~~L~C~a~g~~P~~~~i~W~~~g~~~~   42 (95)
T cd00098          11 LLGGSVTLTCLATGFYPPDITVTWLKNGKELT   42 (95)
T ss_pred             HcCCCeEEEEEEeeEECCCcEEEEEECCEECC
Confidence            36889999999998877 47899999999874


No 57 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=98.37  E-value=5e-07  Score=47.34  Aligned_cols=25  Identities=32%  Similarity=0.801  Sum_probs=21.4

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ++|.|.+. |.|.|.|+|||+|.++.
T Consensus         1 v~L~C~~~-g~P~p~v~W~k~g~~l~   25 (77)
T cd05760           1 VTLRCHID-GHPRPTYQWFRDGTPLS   25 (77)
T ss_pred             CEEEEEee-ecCCCcEEEEECCEECC
Confidence            47999985 57999999999999873


No 58 
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=98.37  E-value=1.4e-06  Score=47.78  Aligned_cols=32  Identities=19%  Similarity=0.328  Sum_probs=27.7

Q ss_pred             eecCCcEEEEEEecCCCCCc-eEEEEECCEEcc
Q psy7728          33 IRENQEITLECLVKNAKPAA-KIVWYRGNTELK   64 (65)
Q Consensus        33 ~~~G~~~~L~C~~~~~~P~~-~i~W~~~~~~l~   64 (65)
                      +..|+..+|+|.+.+..|+. +++|+|||+++.
T Consensus        11 ~~~~~~~~L~C~~~gFyP~~i~v~W~~~g~~~~   43 (94)
T cd05766          11 GSLSHPHLLVCHVWGFYPPEITVKWFKNGQEET   43 (94)
T ss_pred             ccCCCCeEEEEEEeeecCCCCEEEEEECCeecC
Confidence            34678899999999999987 899999999864


No 59 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.35  E-value=7.9e-07  Score=45.88  Aligned_cols=26  Identities=23%  Similarity=0.654  Sum_probs=22.1

Q ss_pred             cEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          38 EITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .++|.|.+. |.|.|.|+|||+|.++.
T Consensus         1 ~v~l~C~~~-G~P~p~v~W~k~g~~~~   26 (71)
T cd05723           1 DVIFECEVT-GKPTPTVKWVKNGDMVI   26 (71)
T ss_pred             CEEEEEEEE-EeCCCEEEEEECCeECC
Confidence            378999995 57999999999998763


No 60 
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=98.34  E-value=6.1e-07  Score=47.01  Aligned_cols=24  Identities=29%  Similarity=0.727  Sum_probs=20.9

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ++|.|.+. |+|+|+|+|||||..+
T Consensus         1 i~l~C~~~-G~P~P~v~W~k~g~~l   24 (77)
T cd05733           1 IVIKCEAK-GNPPPTFSWTRNGTHF   24 (77)
T ss_pred             CEEEeeCc-ccCCCeEEEEECCeEC
Confidence            47999985 5799999999999876


No 61 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=98.34  E-value=9.8e-07  Score=48.43  Aligned_cols=31  Identities=23%  Similarity=0.488  Sum_probs=25.3

Q ss_pred             EeecCCcEEEEEEecCCCC-CceEEEEE-CCEEc
Q psy7728          32 EIRENQEITLECLVKNAKP-AAKIVWYR-GNTEL   63 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P-~~~i~W~~-~~~~l   63 (65)
                      .+..|+.++|.|.+.+ .| ++.|+||+ |++.+
T Consensus        11 ~v~~G~~v~l~C~v~G-~P~~p~i~W~~~~g~~l   43 (96)
T cd05865          11 EISVGESKFFLCQVAG-EAKDKDISWFSPNGEKL   43 (96)
T ss_pred             EECCCCeEEEEEEEeC-CCCCCEEEEECCCCcCc
Confidence            5778999999999966 56 57999998 77654


No 62 
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.33  E-value=1.3e-06  Score=47.54  Aligned_cols=28  Identities=18%  Similarity=0.581  Sum_probs=23.8

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      |..+.|.|.+. |+|.|.|+|||+++.+.
T Consensus        19 ~~~v~l~C~a~-G~P~P~i~W~k~~~~i~   46 (93)
T cd05849          19 EGKVSVNCRAR-ANPFPIYKWRKNNLDID   46 (93)
T ss_pred             CCeEEEeCcCc-cCCCCEEEEEECCEEcc
Confidence            44799999995 57999999999998763


No 63 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=98.33  E-value=8.3e-07  Score=46.39  Aligned_cols=25  Identities=40%  Similarity=0.779  Sum_probs=21.6

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ++|.|.+. |.|.|.|+|||||+.+.
T Consensus         1 v~L~C~v~-G~P~P~v~W~k~~~~i~   25 (75)
T cd05744           1 VRLECRVS-AIPPPQIFWKKNNEMLT   25 (75)
T ss_pred             CEEEEEEe-ecCCCeEEEEECCEECC
Confidence            47999995 58999999999998874


No 64 
>PHA02785 IL-beta-binding protein; Provisional
Probab=98.33  E-value=5.4e-06  Score=53.90  Aligned_cols=53  Identities=15%  Similarity=0.234  Sum_probs=35.6

Q ss_pred             EEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCC--ceEEEEECCEEcc
Q psy7728           9 TRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPA--AKIVWYRGNTELK   64 (65)
Q Consensus         9 ~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~--~~i~W~~~~~~l~   64 (65)
                      +.|.|..+...|.+.. +  ..+.+..|+.++|+|.+.++.++  +.|.|+|||+.+.
T Consensus       211 v~l~V~~~~~pp~~~~-p--~~~~~~~G~~v~L~C~a~g~P~~~~~~v~W~kng~~i~  265 (326)
T PHA02785        211 VKLEVRDRIIPPTMQL-P--EGVVTSIGSNLTIACRVSLRPPTTDADVFWISNGMYYE  265 (326)
T ss_pred             EEEEEeccCCCceecC-C--CcEEecCCCcEEEEEEEECCCCCCCceEEEEECCEECC
Confidence            4566654333334432 2  24567789999999999775433  5899999998763


No 65 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=98.32  E-value=1e-06  Score=46.13  Aligned_cols=27  Identities=15%  Similarity=0.439  Sum_probs=23.6

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      |+.++|.|.+. +.|.|.|+||+++..+
T Consensus         1 G~~v~l~C~~~-g~P~p~v~W~~~~~~~   27 (78)
T cd05743           1 GETVEFTCVAT-GVPTPIINWRLNWGHV   27 (78)
T ss_pred             CCEEEEEEEEE-EecCCEEEEEECCeEC
Confidence            68899999996 5799999999998765


No 66 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=98.32  E-value=7.8e-07  Score=46.74  Aligned_cols=25  Identities=36%  Similarity=0.757  Sum_probs=21.4

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ++|.|.+. |.|.|.|+|||+++++.
T Consensus         1 v~l~C~v~-G~P~P~v~W~k~~~~l~   25 (75)
T cd05893           1 VRLECRVS-GVPHPQIFWKKENESLT   25 (75)
T ss_pred             CEEEEEEe-EecCCEEEEEECCEECC
Confidence            47999995 57999999999998764


No 67 
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=98.31  E-value=7e-07  Score=46.40  Aligned_cols=26  Identities=19%  Similarity=0.650  Sum_probs=22.3

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.|.|.+.++.|.+.++|||||+++.
T Consensus         1 ~~L~C~a~~~~p~~~~~W~~~g~~i~   26 (76)
T cd05895           1 LVLRCETVSEYPSLRFKWFKNGKEIG   26 (76)
T ss_pred             CEEEEecccCCCCCceEEEECCcccc
Confidence            47999987778999999999998863


No 68 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=98.30  E-value=8.9e-07  Score=48.38  Aligned_cols=32  Identities=16%  Similarity=0.564  Sum_probs=27.5

Q ss_pred             EEeecCCcEEEEEEecCC----CCCceEEEEECCEE
Q psy7728          31 IEIRENQEITLECLVKNA----KPAAKIVWYRGNTE   62 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~----~P~~~i~W~~~~~~   62 (65)
                      ..+.+|+.+.|.|.+.+.    .|.+.|+|||+|..
T Consensus         9 ~~v~~G~~~~L~C~~~g~~~~~~p~~~v~Wyk~~~~   44 (94)
T cd05756           9 SYVLEGEPVVIKCPLFYSYIAQSPGLNLTWYKSDGK   44 (94)
T ss_pred             EEEecCCCeEEECCCCCcccccCCCceEEEEEcCCC
Confidence            467899999999998765    68899999999865


No 69 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=98.30  E-value=2e-06  Score=45.95  Aligned_cols=31  Identities=29%  Similarity=0.529  Sum_probs=26.5

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +.+.+|+.+.|.|.+. + |.+.|.|||++..+
T Consensus         6 ~~v~~g~~v~L~C~~~-~-p~~~i~W~k~~~~~   36 (89)
T cd04979           6 VTVVEGNSVFLECSPK-S-NLASVVWLFQGGPL   36 (89)
T ss_pred             EEEECCCcEEEEEeCC-C-CCceEEEEECCccc
Confidence            5688999999999985 4 88899999998754


No 70 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=98.29  E-value=1.1e-06  Score=46.27  Aligned_cols=24  Identities=29%  Similarity=0.649  Sum_probs=20.7

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +.|.|.+. |+|.|.|+|||||..+
T Consensus         1 ~~l~C~~~-G~P~P~v~W~k~g~~~   24 (77)
T cd05875           1 IIIECEAK-GNPVPTFQWTRNGKFF   24 (77)
T ss_pred             CEEEEecc-ccCCCEEEEEECCEEc
Confidence            46899995 5799999999999865


No 71 
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=98.27  E-value=5.1e-06  Score=51.92  Aligned_cols=33  Identities=12%  Similarity=0.415  Sum_probs=27.8

Q ss_pred             EeecCCcEEEEEEecCC----CCCceEEEEECCEEcc
Q psy7728          32 EIRENQEITLECLVKNA----KPAAKIVWYRGNTELK   64 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~----~P~~~i~W~~~~~~l~   64 (65)
                      .+.+|+.++|+|.+.++    .|.++|+|||||+++.
T Consensus       140 ~~~~G~~v~L~C~~~~~~~~~~p~p~I~WyKng~~l~  176 (227)
T PHA02826        140 QFNSGKDSKLHCYGTDGISSTFKDYTLTWYKNGNIVL  176 (227)
T ss_pred             eEecCCCEEEEeeCCCCccccCCCceEEEEECCEECC
Confidence            56789999999998654    4689999999999873


No 72 
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.26  E-value=1.7e-06  Score=47.93  Aligned_cols=33  Identities=15%  Similarity=0.266  Sum_probs=29.9

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ..+.+|+.+.|.|....+.|++.+.|++|+.++
T Consensus        13 ~~v~eG~~~~L~C~pP~g~P~p~~~W~k~~~~~   45 (96)
T cd05727          13 VKVKEGWGVVLFCDPPPHYPDLSYRWLLNEFPN   45 (96)
T ss_pred             eeeeeCCcEEEeeCCCCCCCCCEEEEEECCccc
Confidence            478999999999999999999999999998753


No 73 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=98.26  E-value=4.7e-06  Score=43.31  Aligned_cols=32  Identities=16%  Similarity=0.519  Sum_probs=27.7

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +.+..|+.++|.|.+. +.|.+.+.|||++..+
T Consensus         4 ~~~~~G~~~~l~C~~~-~~p~~~v~W~k~~~~~   35 (85)
T cd05729           4 HAVPAGSTVRLKCPAS-GNPRPTITWLKDGKPF   35 (85)
T ss_pred             eEecCCCcEEEEEEcC-CCCCCeEEEEECCEEC
Confidence            4677899999999996 4689999999998875


No 74 
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=98.25  E-value=2.6e-06  Score=47.32  Aligned_cols=31  Identities=29%  Similarity=0.558  Sum_probs=26.1

Q ss_pred             ecCCcEEEEEEecCCCCCc-eEEEEECCEEcc
Q psy7728          34 RENQEITLECLVKNAKPAA-KIVWYRGNTELK   64 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P~~-~i~W~~~~~~l~   64 (65)
                      ..|..++|+|.+.+..|.. .++|+|||+++.
T Consensus        14 ~~~~~~tL~C~a~gFyP~~i~v~W~k~g~~~~   45 (102)
T cd05768          14 SLQETATLTCLVKGFSPSDIFVKWLQNGQPLS   45 (102)
T ss_pred             CcCCceEEEEEEeeEeCCCCEEEEEECCEECC
Confidence            3467799999999998875 689999999864


No 75 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=98.25  E-value=2.1e-06  Score=46.10  Aligned_cols=29  Identities=21%  Similarity=0.617  Sum_probs=24.5

Q ss_pred             ecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          34 RENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ..|..+.|.|.+. ++|++.|+|||+++.+
T Consensus        17 ~~~~~~~l~C~~~-g~p~p~i~W~k~~~~l   45 (91)
T cd04967          17 SDEGKVSLNCRAR-GSPPPTYRWLMNGTEI   45 (91)
T ss_pred             CCCCEEEEEEeee-EcCCCEEEEEECCEEC
Confidence            3456799999995 4799999999999987


No 76 
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=98.25  E-value=2e-06  Score=45.00  Aligned_cols=25  Identities=36%  Similarity=0.723  Sum_probs=22.3

Q ss_pred             EEEEEEecCCCCC-ceEEEEECCEEc
Q psy7728          39 ITLECLVKNAKPA-AKIVWYRGNTEL   63 (65)
Q Consensus        39 ~~L~C~~~~~~P~-~~i~W~~~~~~l   63 (65)
                      ++|.|.+.+.+|+ .+|+|+|||+++
T Consensus         2 ~~L~C~a~gf~P~~i~v~W~k~g~~~   27 (75)
T smart00407        2 ATLVCLVSGFYPPDITVTWLRNGQEV   27 (75)
T ss_pred             eEEEEEEEeEeCCCCEEEEEECCEEC
Confidence            6899999999998 699999999863


No 77 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=98.25  E-value=1.3e-06  Score=45.23  Aligned_cols=25  Identities=32%  Similarity=0.651  Sum_probs=21.4

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.|.|.+. |.|+|.++|||||+++.
T Consensus         1 ~~l~c~v~-g~P~p~v~W~k~g~~l~   25 (71)
T cd04976           1 VRLPVKVK-AYPPPEIQWYKNGKLIS   25 (71)
T ss_pred             CEEEeEEE-EeCCCEEEEEECCEECC
Confidence            46899995 57999999999999874


No 78 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.24  E-value=2.5e-06  Score=45.83  Aligned_cols=27  Identities=11%  Similarity=0.384  Sum_probs=24.0

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      |+.++|.|.+.+ .|++.|+|+|+++.+
T Consensus         1 g~~~~l~C~~~g-~p~~~i~W~k~~~~i   27 (88)
T cd05735           1 GQKKEMSCTAHG-EKPIIVRWEKEDRII   27 (88)
T ss_pred             CCeEEEEEEEEC-CCCCEEEEeeCCEEC
Confidence            788999999975 699999999999876


No 79 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.20  E-value=1.7e-06  Score=44.97  Aligned_cols=24  Identities=13%  Similarity=0.419  Sum_probs=21.0

Q ss_pred             EEEEEecCCCCCceEEEEECCEEcc
Q psy7728          40 TLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        40 ~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .+.|.+. |.|.|.++|||||+++.
T Consensus         2 ~~~c~v~-G~P~P~v~W~k~g~~l~   25 (70)
T cd05864           2 KIPVKYY-GYPPPEVKWYKNGQLIV   25 (70)
T ss_pred             EEEeEEE-EeCCCEEEEEECCEECC
Confidence            6889985 58999999999999874


No 80 
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=98.19  E-value=2e-06  Score=44.68  Aligned_cols=25  Identities=20%  Similarity=0.611  Sum_probs=21.1

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ++|.|.+. |+|.|.|+|||++.++.
T Consensus         1 a~l~C~~~-G~P~p~v~W~k~~~~~~   25 (74)
T cd05738           1 ATMLCAAS-GNPDPEITWFKDFLPVD   25 (74)
T ss_pred             CEEEEEEe-EecCCEEEEEECCEECc
Confidence            37999985 58999999999998764


No 81 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=98.19  E-value=3.1e-06  Score=43.64  Aligned_cols=25  Identities=20%  Similarity=0.608  Sum_probs=21.7

Q ss_pred             cEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          38 EITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .+.|.|.+. |.|.|.++|||+|+.+
T Consensus         1 ~~~l~c~~~-G~P~p~v~W~k~g~~l   25 (74)
T cd05748           1 SVRLEVPIS-GRPTPTVTWSKDGKPL   25 (74)
T ss_pred             CEEEEeeEe-eeCCCeEEEEECCEEc
Confidence            368999995 5899999999999886


No 82 
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=98.19  E-value=4.8e-06  Score=40.19  Aligned_cols=29  Identities=31%  Similarity=0.699  Sum_probs=24.3

Q ss_pred             cCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          35 ENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        35 ~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +|+.++|.|.+ .+.|.+.+.||++++.+.
T Consensus         1 ~g~~~~l~C~~-~~~~~~~v~W~~~~~~~~   29 (63)
T smart00408        1 EGQSVTLTCPA-EGDPVPNITWLKDGKPLP   29 (63)
T ss_pred             CCceEEEEeeC-ccCCCCeEEEEECCEECC
Confidence            58899999996 457889999999988653


No 83 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.19  E-value=1.6e-06  Score=44.38  Aligned_cols=25  Identities=16%  Similarity=0.654  Sum_probs=21.2

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ++|.|.+. |.|.|.|+|+|+|.++.
T Consensus         1 v~L~C~~~-g~P~p~i~W~k~g~~~~   25 (69)
T cd05746           1 VQIPCSAQ-GDPEPTITWNKDGVQVT   25 (69)
T ss_pred             CEeEecce-EeCCCEEEEEECCEECC
Confidence            47999985 57999999999998763


No 84 
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=98.18  E-value=3.9e-06  Score=47.74  Aligned_cols=31  Identities=26%  Similarity=0.533  Sum_probs=26.5

Q ss_pred             ecCCcEEEEEEecCCCCCc-eEEEEECCEEcc
Q psy7728          34 RENQEITLECLVKNAKPAA-KIVWYRGNTELK   64 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P~~-~i~W~~~~~~l~   64 (65)
                      .++..++|+|.+.+..|+. +|+|+|||+++.
T Consensus        16 ~~~~~~tL~Cla~gFyP~~I~V~W~kng~~l~   47 (115)
T cd05769          16 RNKRKATLVCLATGFYPDHVSLSWKVNGKEVT   47 (115)
T ss_pred             ccCCCcEEEEEEEeEeCCCcEEEEEECCEECC
Confidence            3567789999999999984 899999998864


No 85 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.17  E-value=2.7e-06  Score=45.60  Aligned_cols=26  Identities=19%  Similarity=0.655  Sum_probs=22.4

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEE
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTE   62 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~   62 (65)
                      |+.++|.|.+ .++|.+.|.|||+|..
T Consensus         1 G~~v~L~C~~-~g~P~p~v~W~k~g~~   26 (90)
T cd05726           1 GRTVTFQCEA-TGNPQPAIFWQKEGSQ   26 (90)
T ss_pred             CCEEEEEEEC-CccCCCEEEEEeCCCc
Confidence            6889999998 5579999999999864


No 86 
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=98.17  E-value=3.7e-06  Score=46.88  Aligned_cols=32  Identities=28%  Similarity=0.507  Sum_probs=28.3

Q ss_pred             EeecCCcEEEEEEecCCCCC--ceEEEEECCEEc
Q psy7728          32 EIRENQEITLECLVKNAKPA--AKIVWYRGNTEL   63 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~--~~i~W~~~~~~l   63 (65)
                      .+.+|+.+++.|.+.++.|.  ..|.|||+...+
T Consensus        11 ~l~~G~~vtv~C~v~~v~P~~~l~v~LlkG~~~l   44 (99)
T cd07689          11 PLEEGKPVTVKCEVPDVYPFDRLEIELLKGETLL   44 (99)
T ss_pred             cccCCceEEEEEEecCcccCCceEEEEecCccee
Confidence            57999999999999999998  789999987654


No 87 
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.16  E-value=3.6e-06  Score=46.48  Aligned_cols=32  Identities=22%  Similarity=0.510  Sum_probs=27.1

Q ss_pred             eecCCcEEEEEEecCCCC-CceEEEEECCEEcc
Q psy7728          33 IRENQEITLECLVKNAKP-AAKIVWYRGNTELK   64 (65)
Q Consensus        33 ~~~G~~~~L~C~~~~~~P-~~~i~W~~~~~~l~   64 (65)
                      ..+++.++|+|.+.+.+| ...|+|+|||+++.
T Consensus        14 ~~~~~~~~L~C~~~gfyP~~i~v~W~~~g~~~~   46 (100)
T cd07699          14 LEKSGKATLVCLINDFYPGFATVQWKVDGATVS   46 (100)
T ss_pred             HccCCCcEEEEEEEeEECCCCEEEEEECCEECc
Confidence            345677899999999998 67899999999873


No 88 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.13  E-value=2.2e-06  Score=44.21  Aligned_cols=24  Identities=29%  Similarity=0.714  Sum_probs=20.4

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +.|.|.+. |.|.|.|+|+|++..+
T Consensus         1 ~~L~C~~~-G~P~P~v~W~k~~~~~   24 (71)
T cd05876           1 LVLECIAE-GLPTPEVHWDRIDGPL   24 (71)
T ss_pred             CEEEEEee-EecCCeEEEEECCcCC
Confidence            47999995 5899999999998754


No 89 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.12  E-value=3.3e-06  Score=44.32  Aligned_cols=25  Identities=28%  Similarity=0.470  Sum_probs=21.2

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.|.|.+. |.|+|.++|||||+++.
T Consensus         1 ~~l~c~v~-g~P~P~v~W~kdg~~l~   25 (72)
T cd07702           1 YRLTPKVK-AFPAPEVIWLKDGLPAA   25 (72)
T ss_pred             CeEEeeEE-EcCCCeEEEEECCEECC
Confidence            36899985 57999999999999864


No 90 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=98.11  E-value=6.8e-06  Score=44.43  Aligned_cols=31  Identities=26%  Similarity=0.490  Sum_probs=24.6

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEE-CCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYR-GNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~-~~~~l   63 (65)
                      ..+..|+.+.|.|.+.+. |+ .++||+ +++.+
T Consensus        10 ~~v~~G~~~~l~C~~~G~-p~-~i~W~~~~~~~~   41 (92)
T cd04977          10 GEISVGESKFFLCQVIGE-PK-DISWFSPNGEKL   41 (92)
T ss_pred             EEECCCCeEEEEEEeEee-CC-eEEEECCCCCEe
Confidence            367889999999999764 65 999998 56543


No 91 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.09  E-value=5.3e-06  Score=43.12  Aligned_cols=24  Identities=21%  Similarity=0.613  Sum_probs=20.9

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECC
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      |+.++|.|.+ .+.|.|.|+|||++
T Consensus         1 G~~v~l~C~~-~g~P~p~v~W~k~~   24 (81)
T cd05765           1 GETASFHCDV-TGRPPPEITWEKQV   24 (81)
T ss_pred             CCcEEEEeec-cccCCCcEEEEecC
Confidence            6889999998 45899999999973


No 92 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=98.08  E-value=4.8e-06  Score=44.47  Aligned_cols=23  Identities=17%  Similarity=0.534  Sum_probs=19.4

Q ss_pred             EEEEecCCCCCceEEEEECCEEcc
Q psy7728          41 LECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        41 L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +-|.+ .|+|.|.|+|||||++|.
T Consensus         3 i~~~v-~G~P~Pti~W~kng~~l~   25 (79)
T cd05855           3 IPFTV-KGNPKPTLQWFHEGAILN   25 (79)
T ss_pred             EEEEE-eEeCCCceEEEECCEECC
Confidence            56777 458999999999999885


No 93 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=98.07  E-value=6.4e-06  Score=44.25  Aligned_cols=24  Identities=17%  Similarity=0.526  Sum_probs=20.8

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECC
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      |+.++|.|.+. |.|.|.|+|+|++
T Consensus         1 G~~v~l~C~v~-g~P~P~i~W~k~~   24 (90)
T cd04974           1 GSDVEFHCKVY-SDAQPHIQWLKHV   24 (90)
T ss_pred             CCcEEEEEEEe-CCCCCeEEEEEec
Confidence            67899999995 5799999999963


No 94 
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=98.06  E-value=9.3e-06  Score=44.78  Aligned_cols=21  Identities=29%  Similarity=0.688  Sum_probs=19.6

Q ss_pred             EEEEEEecCCCCCceEEEEEC
Q psy7728          39 ITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      ..++|.+.+|+|+++|+||++
T Consensus        18 ~va~C~s~~gkPaa~IsW~~~   38 (95)
T cd07703          18 PVAKCVSANGRPPARISWSST   38 (95)
T ss_pred             EEEEEEcCCCCCCcEEEEEcC
Confidence            568999999999999999998


No 95 
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=98.04  E-value=7.8e-06  Score=44.96  Aligned_cols=22  Identities=32%  Similarity=0.595  Sum_probs=19.7

Q ss_pred             cEEEEEEecCCCCCceEEEEEC
Q psy7728          38 EITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      ...++|.+.+|+|+|+|+||++
T Consensus        17 ~~va~C~s~~gkP~a~ItW~~~   38 (95)
T cd05719          17 VTVATCVSANGKPPATISWETT   38 (95)
T ss_pred             cEEEEEECCCCcCCCEEEEEeC
Confidence            3457999999999999999997


No 96 
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=98.04  E-value=6.6e-06  Score=41.76  Aligned_cols=24  Identities=33%  Similarity=0.756  Sum_probs=20.5

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ++|.|.+. |.|.|.++|||++..+
T Consensus         1 v~l~C~~~-g~P~p~v~W~k~~~~~   24 (71)
T cd05731           1 LLLECIAE-GLPTPEISWIKIGGEL   24 (71)
T ss_pred             CEEEEEee-EecCCeEEEEECCeEC
Confidence            47999995 5799999999998765


No 97 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=98.02  E-value=7.1e-06  Score=43.68  Aligned_cols=23  Identities=22%  Similarity=0.651  Sum_probs=19.5

Q ss_pred             EEEEecCCCCCceEEEEECCEEcc
Q psy7728          41 LECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        41 L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.|.+. |+|.|.|+|||||+++.
T Consensus         3 i~~~v~-G~P~P~v~W~k~g~~i~   25 (81)
T cd04971           3 IPFTVR-GNPKPTLTWYHNGAVLN   25 (81)
T ss_pred             EEEEeE-eeCCCcEEEEECCEECc
Confidence            578884 58999999999999874


No 98 
>KOG4221|consensus
Probab=98.01  E-value=2.1e-05  Score=58.55  Aligned_cols=61  Identities=21%  Similarity=0.468  Sum_probs=44.9

Q ss_pred             cccCCCEEEEEEcCCCccE-EEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728           3 SRYGPRTRLYQFAPPSSIE-IVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus         3 ~~~~~~~~L~V~~pP~~~~-i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +|++..+.|+|.-.|.... +.-...++...+.+|+.+.|.|.+. +-|.|.|.|.|||+.+.
T Consensus       218 ~r~S~~a~ltv~s~~~~~~~~~fl~~p~~~~v~~g~~v~leCvvs-~~p~p~v~Wlrng~~i~  279 (1381)
T KOG4221|consen  218 QRTSNEAELTVLSDPGALNKLVFLDEPSNAVVVEGDDVVLECVVS-GVPKPSVKWLRNGEKIS  279 (1381)
T ss_pred             CCccceeEEEecCCcccccceeeecCCCccccccCCcEEEEEEec-CCCCCceEEeeCCeeee
Confidence            5788999999994333211 1111233456789999999999994 58999999999998863


No 99 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.01  E-value=1.5e-05  Score=40.97  Aligned_cols=27  Identities=26%  Similarity=0.571  Sum_probs=22.1

Q ss_pred             CCcEEEEEEecCCCCCceEEEEE-CCEEc
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYR-GNTEL   63 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~-~~~~l   63 (65)
                      |+.++|.|.+. +.|.|.++|++ +++.+
T Consensus         1 G~~~~l~C~~~-g~P~p~v~W~~~~~~~~   28 (74)
T cd05764           1 GQRATLRCKAR-GDPEPAIHWISPDGKLI   28 (74)
T ss_pred             CCeEEEEEEcc-CcCCCEEEEEeCCCEEe
Confidence            68899999985 57999999997 55543


No 100
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=98.00  E-value=1.5e-05  Score=42.53  Aligned_cols=26  Identities=19%  Similarity=0.593  Sum_probs=20.9

Q ss_pred             CcEEEEEEecCCCCCc--eEEEEECCEEc
Q psy7728          37 QEITLECLVKNAKPAA--KIVWYRGNTEL   63 (65)
Q Consensus        37 ~~~~L~C~~~~~~P~~--~i~W~~~~~~l   63 (65)
                      ++++|.|.+.+ +|.+  .++|+|||+++
T Consensus         1 ~~~~L~C~a~g-~P~p~~~v~W~~~g~~i   28 (85)
T cd05854           1 ENLTLQCHASH-DPTMDLTFTWSLDDFPI   28 (85)
T ss_pred             CcEEEEEEEec-CCCCCeEEEEEECCeEc
Confidence            46899999965 5655  68999999876


No 101
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=98.00  E-value=1.8e-05  Score=42.90  Aligned_cols=27  Identities=22%  Similarity=0.614  Sum_probs=23.7

Q ss_pred             CCcEEEEEEecCCCCCc-eEEEEECCEE
Q psy7728          36 NQEITLECLVKNAKPAA-KIVWYRGNTE   62 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~-~i~W~~~~~~   62 (65)
                      |+.++|+|.+.+..|+. .|+|+|+|+.
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~~~g~~   41 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWLRDGED   41 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEEECCEE
Confidence            67899999999988876 8999999963


No 102
>KOG3515|consensus
Probab=98.00  E-value=6.1e-06  Score=58.83  Aligned_cols=49  Identities=18%  Similarity=0.429  Sum_probs=40.4

Q ss_pred             EEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          13 QFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        13 V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      |+.+|..|.+..... .+ .+++|+.|.|.|.+.+++|++.+.||+.++.+
T Consensus         1 vl~~p~~pv~~~~~l-~~-~~~~g~~v~l~C~v~~~pp~~~~eW~h~~~~~   49 (741)
T KOG3515|consen    1 VLFPPNVPVCESSSL-TV-GLRLGEDVPLPCRVNSNPPEIDVEWYHSTSGE   49 (741)
T ss_pred             CCcCCCCccccCCCC-Ch-hhccCCcceeeeecCCCCCCcceEEEecCccc
Confidence            567888888765443 23 78999999999999999999999999998754


No 103
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=97.98  E-value=9.8e-06  Score=41.27  Aligned_cols=24  Identities=25%  Similarity=0.760  Sum_probs=20.0

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ++|.|.+. |.|+|.++|+|++..+
T Consensus         1 v~l~C~~~-g~P~p~v~W~k~~~~~   24 (69)
T cd05725           1 VEFQCEVG-GDPVPTVLWRKEDGEL   24 (69)
T ss_pred             CEEEEECc-cCCCCEEEEEECCccC
Confidence            47999985 5799999999998654


No 104
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=97.98  E-value=1.7e-05  Score=43.26  Aligned_cols=31  Identities=19%  Similarity=0.554  Sum_probs=25.3

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEE-CCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYR-GNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~-~~~~l   63 (65)
                      +.+.+|+.++|.|.+.| .|. .++||+ +++.+
T Consensus        10 ~~v~~G~~v~l~C~~~G-~P~-~v~W~k~~g~~~   41 (92)
T cd05866          10 VELSVGESKFFTCTAIG-EPE-SIDWYNPQGEKI   41 (92)
T ss_pred             eEEcCCCeEEEEEEEEE-eCC-eEEEEeCCCeEe
Confidence            36788999999999965 787 999998 46654


No 105
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=97.97  E-value=1.7e-05  Score=42.51  Aligned_cols=23  Identities=17%  Similarity=0.507  Sum_probs=20.1

Q ss_pred             CCcEEEEEEecCCCCCceEEEEEC
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      |+.++|.|.+. +.|.|.|+|+|+
T Consensus         1 G~~v~L~C~~~-g~P~P~i~W~k~   23 (90)
T cd05858           1 GSTVEFVCKVY-SDAQPHIQWLKH   23 (90)
T ss_pred             CCeEEEEEEEe-cCCCCEEEEEEe
Confidence            67899999995 579999999994


No 106
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=97.96  E-value=9.2e-06  Score=44.30  Aligned_cols=33  Identities=12%  Similarity=0.278  Sum_probs=27.2

Q ss_pred             EeecCCcEEEEEEecCC----CCCceEEEEECCEEcc
Q psy7728          32 EIRENQEITLECLVKNA----KPAAKIVWYRGNTELK   64 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~----~P~~~i~W~~~~~~l~   64 (65)
                      .+.+|+...|+|...+.    +|.+.|.||||++++.
T Consensus         6 ~~~~g~~~~l~Cp~~~~~~~~~~~p~i~Wyk~~~~i~   42 (92)
T cd05757           6 ILFSTKGGKIVCPDLDDFKNENTLPPVQWYKDCKLLE   42 (92)
T ss_pred             EEeeccCCEEECCChHHccCCCCCCcEEEeECCEECC
Confidence            56789999999987543    3788999999999874


No 107
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=97.94  E-value=2.1e-05  Score=43.12  Aligned_cols=31  Identities=19%  Similarity=0.404  Sum_probs=26.7

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEE
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTE   62 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~   62 (65)
                      ..+.+|+.+.|.|.+.+ .|.+.|.|+|+++.
T Consensus         7 ~tv~~G~tv~L~C~v~g-~~~~~v~W~k~~~~   37 (95)
T cd05882           7 ETVAVGGTVTLKCGVKE-HDNSSLQWSNTAQQ   37 (95)
T ss_pred             EEEecCCcEEEEEEEeC-CCCCeEEEeccCcc
Confidence            57899999999999965 68899999997753


No 108
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=97.92  E-value=2.3e-05  Score=43.30  Aligned_cols=33  Identities=18%  Similarity=0.478  Sum_probs=28.9

Q ss_pred             CeEEeecCCcEEEEEEecCCCCCceEEEEECCE
Q psy7728          29 SKIEIRENQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus        29 ~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      +.+.+.+|+.+.|.|....+.|.+.|.|++++.
T Consensus        11 ~~v~V~eG~~~~L~C~pP~g~P~P~i~W~~~~~   43 (95)
T cd05845          11 RPVEVEEGDSVVLPCNPPKSAVPLRIYWMNSDL   43 (95)
T ss_pred             ceeEEecCCCEEEEecCCCCCCCCEEEEECCCC
Confidence            456899999999999977889999999998764


No 109
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.92  E-value=1.2e-05  Score=41.55  Aligned_cols=21  Identities=29%  Similarity=0.757  Sum_probs=18.4

Q ss_pred             EEEEEecCCCCCceEEEEECCE
Q psy7728          40 TLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus        40 ~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      +|.|.+. |.|.|.|+|||+|.
T Consensus         2 ~l~C~~~-G~P~P~v~W~k~~~   22 (75)
T cd05763           2 RLECAAT-GHPTPQIAWQKDGG   22 (75)
T ss_pred             EeEeecc-cccCCEEEEEeCCC
Confidence            6899985 58999999999985


No 110
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=97.91  E-value=2.7e-05  Score=41.15  Aligned_cols=27  Identities=22%  Similarity=0.573  Sum_probs=21.3

Q ss_pred             CcEEEEEEecCCCCCc--eEEEEECCEEcc
Q psy7728          37 QEITLECLVKNAKPAA--KIVWYRGNTELK   64 (65)
Q Consensus        37 ~~~~L~C~~~~~~P~~--~i~W~~~~~~l~   64 (65)
                      +.++|.|.+.+ .|.+  .++|+|||+++.
T Consensus         1 e~~~L~C~~~g-~P~p~i~~~W~~~g~~i~   29 (85)
T cd04970           1 ESITLQCHASH-DPTLDLTFTWSFNGVPID   29 (85)
T ss_pred             CcEEEEEEEec-CCCCCeEEEEEECCeEee
Confidence            46899999964 5766  679999998763


No 111
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=97.91  E-value=2.1e-05  Score=39.16  Aligned_cols=27  Identities=22%  Similarity=0.639  Sum_probs=23.3

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCEE
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNTE   62 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~~   62 (65)
                      |+.++|+|.+....|...+.|+++++.
T Consensus         1 G~~v~L~C~~~~~~~~~~~~W~~~~~~   27 (64)
T PF00047_consen    1 GSSVTLTCSVSSGPPPTTVTWSKNGQS   27 (64)
T ss_dssp             TSEEEEEEEEEESSSTSEEEEEETTTT
T ss_pred             CCeEEEEeecCCCCCCcEEEEEECCcc
Confidence            788999999955678999999999864


No 112
>KOG3513|consensus
Probab=97.89  E-value=4.3e-05  Score=56.20  Aligned_cols=56  Identities=21%  Similarity=0.449  Sum_probs=43.6

Q ss_pred             cccCCCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728           3 SRYGPRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus         3 ~~~~~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ++.....+|+|..+|.=..  ..   ....+..|+++++.|.+. |+|-|.|+|+|||.++.
T Consensus       318 G~~~~~~~v~v~a~P~w~~--~~---~d~~~~~gs~v~~eC~a~-g~P~p~v~WlkNg~pl~  373 (1051)
T KOG3513|consen  318 GSATHSGHVTVYAPPYWLQ--KP---QDTEADTGSNVTLECKAS-GKPNPTVKWLKNGEPLE  373 (1051)
T ss_pred             ccceeeEEEEEecCchhhc--cc---ceeEecCCCCeEEEEEec-CCCCCceEEeeCCeecC
Confidence            3444568899999986432  11   235788999999999995 79999999999998874


No 113
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=97.88  E-value=2e-05  Score=40.76  Aligned_cols=24  Identities=17%  Similarity=0.696  Sum_probs=20.6

Q ss_pred             EEEEEecCCCCCceEEEEECCEEcc
Q psy7728          40 TLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        40 ~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      .|.|.+. |.|.+.++|||+++.+.
T Consensus         2 ~L~C~v~-g~P~p~v~W~k~~~~l~   25 (76)
T cd05736           2 SLRCHAE-GIPLPRLTWLKNGMDIT   25 (76)
T ss_pred             EeEeEee-ecCCCEEEEEECCEECC
Confidence            6899996 47999999999998763


No 114
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=97.85  E-value=4.4e-05  Score=41.22  Aligned_cols=28  Identities=18%  Similarity=0.350  Sum_probs=23.5

Q ss_pred             CcEEEEEEecC-CCCCceEEEEECCEEcc
Q psy7728          37 QEITLECLVKN-AKPAAKIVWYRGNTELK   64 (65)
Q Consensus        37 ~~~~L~C~~~~-~~P~~~i~W~~~~~~l~   64 (65)
                      +++.|.|.+.. ..++..|.|++||+++.
T Consensus         1 ~~~~l~C~v~~d~~l~~~~~W~~dg~~i~   29 (85)
T cd05853           1 ESIVLPCQVSHDHSLDIVFTWSFNGHLID   29 (85)
T ss_pred             CcEEEEEEeccCCCCCcEEEEEECCEECc
Confidence            36789999975 56789999999999874


No 115
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=97.83  E-value=4.3e-05  Score=41.87  Aligned_cols=29  Identities=21%  Similarity=0.505  Sum_probs=25.0

Q ss_pred             cCCcEEEEEEecCCCCC-ceEEEEECCEEc
Q psy7728          35 ENQEITLECLVKNAKPA-AKIVWYRGNTEL   63 (65)
Q Consensus        35 ~G~~~~L~C~~~~~~P~-~~i~W~~~~~~l   63 (65)
                      .+..++|.|.+.+..|. ..|+|+|||+.+
T Consensus        13 ~~~~~~L~C~a~gFyP~~I~vtW~~dg~~~   42 (94)
T cd05847          13 TSETIQLLCLISGYTPGTIEVEWLVDGQVA   42 (94)
T ss_pred             CCCCEEEEEEEEeEECCCCEEEEEECCEEC
Confidence            34668999999999887 789999999986


No 116
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=97.82  E-value=6.5e-05  Score=40.44  Aligned_cols=38  Identities=21%  Similarity=0.280  Sum_probs=29.5

Q ss_pred             cEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEE
Q psy7728          20 IEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTE   62 (65)
Q Consensus        20 ~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~   62 (65)
                      |.+...+.   ..+.+|++++|+|.+.  .|...+.|||+|..
T Consensus         3 P~L~a~p~---~vV~~G~~VtL~C~~~--~~~~~f~l~k~g~~   40 (91)
T cd05751           3 PSLWAEPS---SVVPLGKPVTLRCQGP--YGAVEYRLYREGST   40 (91)
T ss_pred             CEEEecCC---CccCCCCcEEEEEecC--CCCCEEEEEECCCC
Confidence            45655543   2678999999999874  67889999999874


No 117
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=97.81  E-value=3.7e-05  Score=40.67  Aligned_cols=31  Identities=26%  Similarity=0.593  Sum_probs=26.5

Q ss_pred             ecCCcEEEEEEecCCCCCc-eEEEEECCEEcc
Q psy7728          34 RENQEITLECLVKNAKPAA-KIVWYRGNTELK   64 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P~~-~i~W~~~~~~l~   64 (65)
                      ..+..++|.|.+.+..|.. .|+|++||+.+.
T Consensus         6 ~~~~~~~L~C~v~~f~P~~i~v~W~~~~~~~~   37 (83)
T PF07654_consen    6 ELGGSVTLTCLVSGFYPKDITVTWLKNGKEVT   37 (83)
T ss_dssp             HSTSEEEEEEEEEEEBSSTEEEEEEETTEEET
T ss_pred             cCCCCEEEEEEEEEEECCCcEEEEEeccceee
Confidence            3478899999999999976 799999999764


No 118
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=97.80  E-value=0.0001  Score=40.47  Aligned_cols=30  Identities=17%  Similarity=0.386  Sum_probs=25.3

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCE
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      +.+.+|++++|.|...+ .|.+.|.||++++
T Consensus         2 v~~~~G~~VtL~C~~s~-~~~~~i~W~~~~~   31 (94)
T cd07690           2 VLGKKGDTAELPCTASQ-KKSIQFHWKNSNQ   31 (94)
T ss_pred             eEeeCCCCEEEEEEeCC-CCCcEEEEEECCc
Confidence            35788999999999865 6899999998773


No 119
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=97.78  E-value=6.3e-05  Score=40.99  Aligned_cols=29  Identities=17%  Similarity=0.439  Sum_probs=24.7

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEEC
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      .+.+.+|++++|.|.+.+ .|.+.|.||+.
T Consensus         6 ~v~v~eG~~v~L~C~~~~-~p~~~v~W~~~   34 (95)
T cd07701           6 NVTVVEGGTANLTCRVDQ-NDNTSLQWSNP   34 (95)
T ss_pred             eEEEecCCcEEEEEEEec-CCceEEEEeCC
Confidence            367899999999999865 68999999863


No 120
>smart00409 IG Immunoglobulin.
Probab=97.77  E-value=0.00015  Score=36.51  Aligned_cols=32  Identities=28%  Similarity=0.793  Sum_probs=27.4

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEEC-CEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRG-NTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~-~~~l   63 (65)
                      +.+..|+.++|.|.+.+. +.+.+.|+++ ++.+
T Consensus         4 ~~~~~g~~~~l~C~~~~~-~~~~~~W~~~~~~~v   36 (86)
T smart00409        4 VTVKEGESVTLSCEVSGS-PPPEVTWYKQGGKLL   36 (86)
T ss_pred             EEEeCCCeEEEEEEEccC-CCCeEEEEECCCEEc
Confidence            467889999999999765 8899999998 7665


No 121
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=97.77  E-value=0.00015  Score=36.51  Aligned_cols=32  Identities=28%  Similarity=0.793  Sum_probs=27.4

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEEC-CEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRG-NTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~-~~~l   63 (65)
                      +.+..|+.++|.|.+.+. +.+.+.|+++ ++.+
T Consensus         4 ~~~~~g~~~~l~C~~~~~-~~~~~~W~~~~~~~v   36 (86)
T smart00410        4 VTVKEGESVTLSCEVSGS-PPPEVTWYKQGGKLL   36 (86)
T ss_pred             EEEeCCCeEEEEEEEccC-CCCeEEEEECCCEEc
Confidence            467889999999999765 8899999998 7665


No 122
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=97.75  E-value=4.2e-05  Score=40.31  Aligned_cols=28  Identities=14%  Similarity=0.370  Sum_probs=22.9

Q ss_pred             CCcEEEEEEecCC-CCCceEEEEECCEEc
Q psy7728          36 NQEITLECLVKNA-KPAAKIVWYRGNTEL   63 (65)
Q Consensus        36 G~~~~L~C~~~~~-~P~~~i~W~~~~~~l   63 (65)
                      |+.++|.|.+.+. .|.+.|+|+++++.+
T Consensus         1 Ge~~~L~C~~~g~~~~~~~i~W~~~~~~~   29 (84)
T cd05742           1 GETLVLNCTVLTELNEGVDFQWTYPGKKR   29 (84)
T ss_pred             CCeEEEEEEEEeCCCccEEEEEecCCccc
Confidence            7889999999764 289999999887643


No 123
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=97.74  E-value=5.5e-05  Score=41.50  Aligned_cols=32  Identities=16%  Similarity=0.358  Sum_probs=26.1

Q ss_pred             eecCCcEEEEEEecCCCCC-ceEEEEECCEEcc
Q psy7728          33 IRENQEITLECLVKNAKPA-AKIVWYRGNTELK   64 (65)
Q Consensus        33 ~~~G~~~~L~C~~~~~~P~-~~i~W~~~~~~l~   64 (65)
                      ...|...+|.|.+.+..|+ ..++|+|||+++.
T Consensus        12 ~~~g~~~~L~C~a~gFyP~~i~v~W~~dg~~~~   44 (93)
T cd05770          12 AENGKPNVLNCYVTGFHPPDIEIRLLKNGVKIP   44 (93)
T ss_pred             CcCCCceEEEEEEEEEeCCCCEEEEEECCEECC
Confidence            3456677999999998875 5799999999864


No 124
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=97.73  E-value=9.2e-05  Score=40.62  Aligned_cols=31  Identities=23%  Similarity=0.490  Sum_probs=25.5

Q ss_pred             ecCCcEEEEEEecCCCCC-ceEEEEECCEEcc
Q psy7728          34 RENQEITLECLVKNAKPA-AKIVWYRGNTELK   64 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P~-~~i~W~~~~~~l~   64 (65)
                      ..|+..+|.|.+.+..|. ..++|.|||+++.
T Consensus        13 ~~~~~~tL~C~a~gFyP~~I~v~W~~~g~~~~   44 (94)
T cd05767          13 ELGEPNTLICFVDNFFPPVLNVTWLKNGVPVT   44 (94)
T ss_pred             cCCCCeEEEEEEEEEECCcCEEEEEECCeEcc
Confidence            345667999999999885 5799999999863


No 125
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=97.69  E-value=0.00023  Score=39.40  Aligned_cols=33  Identities=15%  Similarity=0.382  Sum_probs=27.0

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ..+.+|+.+.|.|.+.+..||..|.|.+++..+
T Consensus        11 ~~~~~G~~~~L~C~~~s~P~P~~i~W~w~~~~i   43 (98)
T cd05898          11 QYAVRGERGKVKCFIGSTPPPDRIAWAWKENVL   43 (98)
T ss_pred             EEEeCCCcEEEEEEEccCCCCcEEEEEEccccc
Confidence            578899999999999765555678999987765


No 126
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=97.66  E-value=7.9e-05  Score=41.12  Aligned_cols=30  Identities=23%  Similarity=0.451  Sum_probs=24.6

Q ss_pred             cCCcEEEEEEecCCCCC-ceEEEEECCEEcc
Q psy7728          35 ENQEITLECLVKNAKPA-AKIVWYRGNTELK   64 (65)
Q Consensus        35 ~G~~~~L~C~~~~~~P~-~~i~W~~~~~~l~   64 (65)
                      .+...+|.|.+.+..|. ..++|.|||+.+.
T Consensus        15 ~~~~~tL~C~a~gFyP~~I~v~W~kng~~~~   45 (96)
T cd07697          15 KQGQGIYLCLLENFFPDVIQVHWREGNSPSI   45 (96)
T ss_pred             cCCCEEEEEEEEEEeCCCeEEEEEECCEECc
Confidence            35668999999998875 5699999999853


No 127
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.66  E-value=0.00012  Score=40.21  Aligned_cols=30  Identities=33%  Similarity=0.749  Sum_probs=24.2

Q ss_pred             eecCCcEEEEEEecCC-CCC-ceEEEEECCEE
Q psy7728          33 IRENQEITLECLVKNA-KPA-AKIVWYRGNTE   62 (65)
Q Consensus        33 ~~~G~~~~L~C~~~~~-~P~-~~i~W~~~~~~   62 (65)
                      +..|+..+|+|.+.+. .|+ ..++|+|||+.
T Consensus        11 l~~~~~~tLtC~v~gf~yP~~i~v~W~r~~~~   42 (96)
T cd07696          11 LLLTKSVKLTCLVTNLTSPEGVNVTWTRGSGE   42 (96)
T ss_pred             hccCCCeEEEEEEeCCCCCCCcEEEEEECCeE
Confidence            4557889999999999 654 67999999743


No 128
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=97.63  E-value=4.6e-05  Score=39.73  Aligned_cols=21  Identities=33%  Similarity=0.781  Sum_probs=17.9

Q ss_pred             EEEEEEecCCCCCceEEEEECC
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      ++|.|.+. |+|.|.|+|||++
T Consensus         1 v~l~C~~~-G~P~P~v~W~~~~   21 (79)
T cd05734           1 VTLNCSAE-GYPPPTIVWKHSK   21 (79)
T ss_pred             CEeEeeCe-EeCCCEEEEEECC
Confidence            47999985 5899999999974


No 129
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=97.58  E-value=0.00015  Score=38.50  Aligned_cols=25  Identities=20%  Similarity=0.550  Sum_probs=21.9

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCE
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      |++++|+|.+.+ +|.+.+.|++.++
T Consensus         1 Ge~~~l~C~~~~-~~~~~~~W~~~~~   25 (84)
T cd05861           1 GETITVNCIVQG-NEVVDFSWTYPGK   25 (84)
T ss_pred             CCcEEEEEEEEC-CCccEEEEEECCc
Confidence            789999999965 7899999998775


No 130
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=97.57  E-value=0.00019  Score=38.88  Aligned_cols=28  Identities=32%  Similarity=0.491  Sum_probs=23.5

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEEC
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      .+...+|+.++|.|.. + .|.+.|+|||+
T Consensus         5 ~~~~~eG~~v~L~C~~-~-~p~p~v~Wykq   32 (91)
T cd05871           5 VVYGVENNSTFLECLP-K-SPQASVKWLFQ   32 (91)
T ss_pred             EEEEecCCcEEEEEEC-C-CCCceEEEEEE
Confidence            3567899999999996 3 68899999984


No 131
>KOG4221|consensus
Probab=97.57  E-value=0.00021  Score=53.43  Aligned_cols=51  Identities=24%  Similarity=0.569  Sum_probs=41.2

Q ss_pred             CCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728           7 PRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus         7 ~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ..+.|+|++||.-+     ..+..+...++..+.+.|.+.+ +|.+.+.|||||..+
T Consensus       319 asaev~V~a~P~~~-----~~p~~l~A~e~~die~ec~~~g-~p~p~v~w~kNgd~~  369 (1381)
T KOG4221|consen  319 ASAEVTVLAPPGFT-----KAPTTLVAHESMDIEFECPVSG-KPIPTVRWYKNGDRI  369 (1381)
T ss_pred             cceEEEEEcCCCCC-----CCCcceeeeeccceeEeCCCCC-CCcceEEEEecCccc
Confidence            46899999998643     2334567888999999999955 699999999999765


No 132
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=97.56  E-value=0.00016  Score=39.15  Aligned_cols=32  Identities=22%  Similarity=0.460  Sum_probs=27.2

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +.+..|+.+.|.|..++  +.|.+.|++||..+.
T Consensus         6 ~tv~~g~~v~L~C~~~s--~~A~v~W~~ng~~l~   37 (85)
T cd05872           6 RTVAPGADVVLPCQLRS--NLASPVWLFNGTPLN   37 (85)
T ss_pred             EEEecCCCEEEECCCCC--CCccEEEEECCcccC
Confidence            57899999999999854  477999999998763


No 133
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.51  E-value=0.00029  Score=38.84  Aligned_cols=29  Identities=24%  Similarity=0.517  Sum_probs=24.5

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      .+.+.+|++++|.|...+  +...+.|||..
T Consensus         7 ~~~v~~G~~v~l~C~~~~--~~~~v~Wykq~   35 (110)
T cd05899           7 YLIKGRGQSVTLRCSQTS--GHDNMYWYRQD   35 (110)
T ss_pred             ceEEcCCCcEEEEEEECC--CCCEEEEEEEC
Confidence            357899999999999865  67889999963


No 134
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=97.47  E-value=0.0005  Score=37.31  Aligned_cols=38  Identities=18%  Similarity=0.377  Sum_probs=27.7

Q ss_pred             cEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEE
Q psy7728          20 IEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTE   62 (65)
Q Consensus        20 ~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~   62 (65)
                      |.|...+.   ..+.+|++++|.|++..  +.-.+.|||+|..
T Consensus         2 P~l~a~p~---~vV~~G~~VTL~C~~~~--~~~~f~l~k~g~~   39 (94)
T cd05711           2 PFLSAHPS---PVVPSGENVTLQCHSDI--RFDRFILYKEGRS   39 (94)
T ss_pred             CEEEecCC---CccCCCCeEEEEEecCC--CCCEEEEEECCCC
Confidence            34544443   26789999999998743  5678999998853


No 135
>KOG4194|consensus
Probab=97.45  E-value=0.00021  Score=50.85  Aligned_cols=56  Identities=16%  Similarity=0.386  Sum_probs=42.5

Q ss_pred             cccCCCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728           3 SRYGPRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus         3 ~~~~~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      |+.+..+.|+|+.-|+. .+.-    +...+..|+++.|.|.+.+.++.|.+.|||+++++
T Consensus       693 G~isanAtL~V~e~p~f-~~PL----~~~~V~~get~vlqC~a~~~~a~pr~~W~k~d~pi  748 (873)
T KOG4194|consen  693 GQISANATLTVLETPSF-SIPL----EDQLVVVGETLVLQCLAEGAPADPRLEWFKEDKPI  748 (873)
T ss_pred             cceeeceEEEEecCCcc-cccc----cceEEEecceEEEEEecCCCCCCccccccCCCCce
Confidence            56667799999988764 2221    22478889999999999665444999999999876


No 136
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.43  E-value=0.00032  Score=38.45  Aligned_cols=28  Identities=25%  Similarity=0.623  Sum_probs=23.6

Q ss_pred             cCCcEEEEEEecCCCCC-ceEEEEECCEE
Q psy7728          35 ENQEITLECLVKNAKPA-AKIVWYRGNTE   62 (65)
Q Consensus        35 ~G~~~~L~C~~~~~~P~-~~i~W~~~~~~   62 (65)
                      .++.++|.|.+.+..|. ..|+|+|||++
T Consensus        15 ~~~~~~L~C~a~gFyP~~i~vtW~k~g~~   43 (95)
T cd04985          15 SSDSVTLGCLATGFLPEPVTFTWNSGSNS   43 (95)
T ss_pred             CCCcEEEEEEEeeEECCCcEEEEeECCEE
Confidence            35668999999998886 56999999986


No 137
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.36  E-value=0.00063  Score=37.10  Aligned_cols=30  Identities=23%  Similarity=0.607  Sum_probs=25.1

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      .+.+.+|++++|.|..... +...+.|||..
T Consensus         7 ~v~~~~G~~v~L~C~~~~~-~~~~v~W~k~~   36 (109)
T cd04983           7 SLSVQEGENVTLNCNYSTS-TFYYLFWYRQY   36 (109)
T ss_pred             ceEEcCCCCEEEEEEECCC-CccEEEEEEEC
Confidence            3578999999999998654 78899999853


No 138
>KOG4194|consensus
Probab=97.35  E-value=0.00041  Score=49.45  Aligned_cols=54  Identities=24%  Similarity=0.462  Sum_probs=44.2

Q ss_pred             CcccCCCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCE
Q psy7728           2 LSRYGPRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus         2 ~~~~~~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      =|-|+..++|+|...|+-..     .++.+++..|+...|.|.+. |.|.|+|.|-|+|.
T Consensus       598 GStysqk~KltV~~~PsFtk-----tP~dltl~tg~mArl~CaAt-G~P~PeIawqkdgg  651 (873)
T KOG4194|consen  598 GSTYSQKAKLTVNQAPSFTK-----TPEDLTLRTGQMARLECAAT-GHPRPEIAWQKDGG  651 (873)
T ss_pred             CcchhheeEEEeeccCcccc-----Ccccceeecccceeeeeecc-CCCCcceeehhcCC
Confidence            36688899999999986532     23457899999999999995 58999999999874


No 139
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.35  E-value=0.00065  Score=37.21  Aligned_cols=30  Identities=13%  Similarity=0.520  Sum_probs=23.8

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEEC
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      .+.+.+|++++|.|...+......+.|||.
T Consensus         9 ~~~v~~G~~v~L~C~~~~~~~~~~~~Wyrq   38 (106)
T cd04980           9 TLSVSPGESATISCKASQSVSSNYLAWYQQ   38 (106)
T ss_pred             cEEECCCCCEEEEEEECCCCCCCcEEEEEE
Confidence            357899999999999864333678999985


No 140
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=97.34  E-value=0.00068  Score=36.39  Aligned_cols=28  Identities=29%  Similarity=0.584  Sum_probs=23.8

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEE
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYR   58 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~   58 (65)
                      .+.+.+|++++|.|.+.+ .|.+.+.||+
T Consensus         6 ~~~v~~G~~v~L~C~~~~-~~~~~v~W~~   33 (95)
T cd05717           6 DVTVVEGGTATLKCRVKN-NDNSSLQWSN   33 (95)
T ss_pred             cEEEcCCCCEEEEEEECC-CCCceEEEeC
Confidence            357899999999999855 5788999986


No 141
>PHA03270 envelope glycoprotein C; Provisional
Probab=97.23  E-value=0.0008  Score=45.85  Aligned_cols=53  Identities=34%  Similarity=0.661  Sum_probs=41.5

Q ss_pred             ccCCCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCC--ceEEEEECCEEc
Q psy7728           4 RYGPRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPA--AKIVWYRGNTEL   63 (65)
Q Consensus         4 ~~~~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~--~~i~W~~~~~~l   63 (65)
                      +++..+.++.+-+|+. .+.  ..    ++.+|+....+|.+.+-.|+  ..++||+||.++
T Consensus       209 ~~~~~VtV~~yr~Psv-sv~--~~----PvL~Ge~Y~AtC~va~YYPp~Sv~lrWf~ng~~V  263 (466)
T PHA03270        209 RYGTWTRVRMFRRPSL-SIR--PH----AVLEGEPFGATCVAANYYPGDRAAFRWFEGGDEV  263 (466)
T ss_pred             eeeeEEEEEEecCCcc-ccc--CC----ccccCCCceEEEEeeeecCCCceEEEEEeCCccc
Confidence            4556677777888863 332  33    68999999999999998887  469999999876


No 142
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=97.19  E-value=0.0014  Score=36.31  Aligned_cols=30  Identities=30%  Similarity=0.592  Sum_probs=24.9

Q ss_pred             eEEeecCCcEEEEEEecCC-CCCceEEEEEC
Q psy7728          30 KIEIRENQEITLECLVKNA-KPAAKIVWYRG   59 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~-~P~~~i~W~~~   59 (65)
                      .+.+.+|++++|.|...+. .+...+.|||.
T Consensus         7 ~~~~~~G~~v~l~C~~~~~~~~~~~v~Wyrq   37 (116)
T cd04982           7 SITREESKSVTISCKVSGIDFSTTYIHWYRQ   37 (116)
T ss_pred             eEEeCCCCCEEEEEEEeCCCccccEEEEEEE
Confidence            4578899999999998652 57889999995


No 143
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=97.15  E-value=0.001  Score=36.67  Aligned_cols=29  Identities=24%  Similarity=0.527  Sum_probs=22.8

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      .+.+|++++|+|...+......+.|||..
T Consensus         2 ~v~~G~~vtL~C~~~~~~~~~~~~Wyrq~   30 (107)
T cd07700           2 LVQTNNTVKLSCEAKGISENTRIYWLRWR   30 (107)
T ss_pred             EEcCCCCEEEEEEEecCCCCCeEEEEEEC
Confidence            57899999999988654445689999853


No 144
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=97.15  E-value=0.00092  Score=33.31  Aligned_cols=19  Identities=37%  Similarity=0.943  Sum_probs=17.4

Q ss_pred             EEEEEEecCCCCCceEEEE
Q psy7728          39 ITLECLVKNAKPAAKIVWY   57 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~   57 (65)
                      ++|+|.+.++.|.+.++|+
T Consensus        18 ~~l~C~~~~~~~~~~~~W~   36 (75)
T PF13927_consen   18 VTLTCSAEGGPPPPSISWY   36 (75)
T ss_dssp             EEEEEEESSEESSEEEEEE
T ss_pred             EEEEEEEccccCCeEEEEE
Confidence            9999999887669999999


No 145
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.05  E-value=0.00052  Score=37.81  Aligned_cols=33  Identities=15%  Similarity=0.334  Sum_probs=25.6

Q ss_pred             EeecCCcEEEEEEecC----CCCCceEEEEECCEEcc
Q psy7728          32 EIRENQEITLECLVKN----AKPAAKIVWYRGNTELK   64 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~----~~P~~~i~W~~~~~~l~   64 (65)
                      .+..|....|+|.-..    .++.+.|+||||++++.
T Consensus         6 ~~~~~~~~~l~Cp~~~~f~~~~~~~~v~WYKd~~~l~   42 (95)
T cd05897           6 ILFTSTSGKLVCPDLSDFTINRTDVELQWYKDSVLLD   42 (95)
T ss_pred             EeccccCcEEECCCHHHcccCCCCCcEEEccCCEECc
Confidence            4677889999996321    35788999999999874


No 146
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=97.01  E-value=0.0024  Score=35.46  Aligned_cols=30  Identities=23%  Similarity=0.595  Sum_probs=24.3

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEEC
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      .+.+.+|+.++|.|..........+.|||.
T Consensus         8 ~v~~~~G~~v~L~C~~~~~~~~~~v~Wyrq   37 (116)
T cd07706           8 DVSVQVGEEVTLNCRYETSWTNYYIFWYKQ   37 (116)
T ss_pred             ceEEcCCCCEEEEEEEeCCCCceEEEEEEE
Confidence            457899999999999765445678999994


No 147
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.99  E-value=0.0016  Score=35.02  Aligned_cols=29  Identities=28%  Similarity=0.621  Sum_probs=23.4

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      .+.+|+.++|.|......+...+.|||..
T Consensus         2 ~v~~G~~v~L~C~~~~~~~~~~v~W~k~~   30 (105)
T cd00099           2 SVSEGESVTLSCTYSGSFSSYYIFWYRQK   30 (105)
T ss_pred             eecCCCCEEEEEEEeCCcCcceEEEEEEC
Confidence            46789999999998654367789999954


No 148
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=96.97  E-value=0.0022  Score=35.86  Aligned_cols=34  Identities=21%  Similarity=0.301  Sum_probs=28.8

Q ss_pred             CeEEeecCCcEEEEEEecCCCCCce-EEEEECCEEc
Q psy7728          29 SKIEIRENQEITLECLVKNAKPAAK-IVWYRGNTEL   63 (65)
Q Consensus        29 ~~~~~~~G~~~~L~C~~~~~~P~~~-i~W~~~~~~l   63 (65)
                      ..+.+.+|+.+.|.|.. .+.|++. +.|.+++..+
T Consensus        11 ~~~~v~~gE~~~L~V~i-eAYP~p~~~~W~~~~~~l   45 (101)
T cd05860          11 TTIFVNAGENLDLIVEY-EAYPKPEHQQWIYMNRTL   45 (101)
T ss_pred             ceEEEECCCCEEEEEEE-EeCCCCeeeEEEcCCccc
Confidence            34689999999999998 5689987 9999998754


No 149
>PHA03269 envelope glycoprotein C; Provisional
Probab=96.92  E-value=0.0023  Score=44.39  Aligned_cols=51  Identities=12%  Similarity=0.291  Sum_probs=38.8

Q ss_pred             CCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCC--ceEEEEECCEEcc
Q psy7728           7 PRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPA--AKIVWYRGNTELK   64 (65)
Q Consensus         7 ~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~--~~i~W~~~~~~l~   64 (65)
                      ..+.+.++-+|+ ..+.  ..    ++.+|+....+|.+.+-.|+  ..++||+||.++.
T Consensus       320 ~~VtV~~yr~Ps-VsV~--p~----PVL~Ge~YkAtC~vA~YYPp~SvrlrWf~ng~~V~  372 (566)
T PHA03269        320 HHITVMSYKRPN-ITVI--GD----PVLLGNPYAAYCKVNKYYPPHSVIVKWTSNFGNIG  372 (566)
T ss_pred             eEEEEEEecCCC-cccc--CC----ccccCCCceEEEEeeeecCCCceEEEEEeCCcccC
Confidence            456677777883 3333  33    68999999999999988887  4699999988763


No 150
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=96.91  E-value=0.0016  Score=35.16  Aligned_cols=29  Identities=14%  Similarity=0.483  Sum_probs=22.3

Q ss_pred             EeecCCcEEEEEEecCC-CCCceEEEEECC
Q psy7728          32 EIRENQEITLECLVKNA-KPAAKIVWYRGN   60 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~-~P~~~i~W~~~~   60 (65)
                      .+.+|++++|.|..... .....|.|||..
T Consensus         2 ~v~~G~~v~l~C~~~~~~~~~~~i~Wy~q~   31 (98)
T cd04984           2 SVSPGETVTITCTGSSGNISGNYVNWYQQK   31 (98)
T ss_pred             ccCCCCCEEEEEEEcCCCcCCCCEEEEEEC
Confidence            47889999999987543 145679999953


No 151
>PHA03271 envelope glycoprotein C; Provisional
Probab=96.89  E-value=0.0031  Score=43.08  Aligned_cols=50  Identities=12%  Similarity=0.375  Sum_probs=37.1

Q ss_pred             EEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCC--ceEEEEECCEEcc
Q psy7728           9 TRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPA--AKIVWYRGNTELK   64 (65)
Q Consensus         9 ~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~--~~i~W~~~~~~l~   64 (65)
                      +.+.|.+.|....+.  +.    ++.+|+....+|.+.+-.|+  ..++||+||.++.
T Consensus       239 ~~~~v~~RPPsVsV~--a~----PVL~Ge~YkAtC~vAnYYPP~SvrlrWf~nG~~V~  290 (490)
T PHA03271        239 IYIRVCQRPASVDVL--AP----PVLSGENYKASCIVRHFYPPGSVYVSWRQNGNIAT  290 (490)
T ss_pred             EEEEEEecCCCcccc--CC----ccccCCCceEEEEeeeecCCCceEEEEEeCCcccc
Confidence            455566655443443  33    68999999999999998887  4699999998763


No 152
>KOG3513|consensus
Probab=96.89  E-value=0.003  Score=46.95  Aligned_cols=54  Identities=22%  Similarity=0.332  Sum_probs=37.9

Q ss_pred             cccCCCEEEEEE-------cCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCE
Q psy7728           3 SRYGPRTRLYQF-------APPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus         3 ~~~~~~~~L~V~-------~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      +.++..+.|.|.       .+|.   |.... +.......|+.+.|.|.+. |+|.|+|.|.|.|.
T Consensus       220 ~v~~~~~~L~~~~~~~~~~~~P~---i~~~~-p~~~~a~~G~~v~LECfA~-G~P~P~i~W~k~~g  280 (1051)
T KOG3513|consen  220 IVQGPPFPLIVRSNNVMREYAPK---ILVPF-PETETALKGQSVKLECFAL-GNPTPQIKWRKVDG  280 (1051)
T ss_pred             cccCCceeEEEcccccccccCCc---cccCC-CCcccccCCCeEEEEEEec-CCCCCcEEEEeCCC
Confidence            346677777772       3443   22111 1245788999999999994 58999999999875


No 153
>PHA03273 envelope glycoprotein C; Provisional
Probab=96.86  E-value=0.0032  Score=43.31  Aligned_cols=49  Identities=16%  Similarity=0.421  Sum_probs=36.8

Q ss_pred             EEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCC--ceEEEEECCEEcc
Q psy7728           9 TRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPA--AKIVWYRGNTELK   64 (65)
Q Consensus         9 ~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~--~~i~W~~~~~~l~   64 (65)
                      +.+..+-+|+. .+  .+.    ++.+|+....+|.+.+-.|+  ..++||+||.++.
T Consensus       230 VtV~~yr~Psv-sv--~~~----PvL~Ge~y~A~C~aa~YYPp~Sv~~rWf~dg~~V~  280 (486)
T PHA03273        230 VTVSTYNAPLV-DL--SVH----PSLKGENYRAVCVVASYFPHSSVKLRWYKNAKEVD  280 (486)
T ss_pred             EEEEEecCCcc-cc--cCC----ccccCCCceEEEEeeeecCCCceEEEEEeCCeecc
Confidence            33444667752 33  333    68999999999999988887  5699999999864


No 154
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=96.83  E-value=0.0023  Score=35.55  Aligned_cols=29  Identities=17%  Similarity=0.415  Sum_probs=24.1

Q ss_pred             ecCCcEEEEEEecCCC-CC-ceEEEEECCEE
Q psy7728          34 RENQEITLECLVKNAK-PA-AKIVWYRGNTE   62 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~-P~-~~i~W~~~~~~   62 (65)
                      ..+..++|+|.+.+.. |. ..++|+++|+.
T Consensus        17 ~~~~~atLtClV~~f~~P~~i~V~W~~~g~~   47 (99)
T cd04986          17 LLGSSASLTCTLSGLRDPEGAVFTWTPSGGK   47 (99)
T ss_pred             CcCCccEEEEEEeccCCCCCeEEEEEECCcc
Confidence            3567889999999988 74 67999999874


No 155
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=96.82  E-value=0.00091  Score=34.72  Aligned_cols=28  Identities=14%  Similarity=0.357  Sum_probs=20.8

Q ss_pred             ecCCcEEEEEEecCCCCCceEEEEECCEEccC
Q psy7728          34 RENQEITLECLVKNAKPAAKIVWYRGNTELKL   65 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~~   65 (65)
                      ..|.+|+|+|-...    ..|.|++|++.+.|
T Consensus         5 isGTtVtlTCP~~~----~~i~W~~n~~~~~g   32 (65)
T cd07692           5 ISGTTVTVTCPLSG----DDIKWKKNDQVSQG   32 (65)
T ss_pred             EeccEEEEECCCCC----CCceEEeCCccCCC
Confidence            35889999996532    23999999877654


No 156
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=96.75  E-value=0.0028  Score=34.67  Aligned_cols=30  Identities=20%  Similarity=0.314  Sum_probs=23.9

Q ss_pred             EeecCCcEEEEEEecC-CCCCceEEEEECCE
Q psy7728          32 EIRENQEITLECLVKN-AKPAAKIVWYRGNT   61 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~-~~P~~~i~W~~~~~   61 (65)
                      .+..|+.++|+|.+.. +.|.+.|+|+--+.
T Consensus        10 ~lL~G~sLtLtl~~~s~s~p~~~i~w~~P~n   40 (88)
T cd07694          10 HVLSGTNLTLTLHGSSNSLPAFKVEWRGPGN   40 (88)
T ss_pred             eeecCCcEEEEEecCCCCCCCccEEEeCCCC
Confidence            5788999999999954 46677999997543


No 157
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=96.61  E-value=0.0049  Score=33.12  Aligned_cols=30  Identities=10%  Similarity=0.217  Sum_probs=24.2

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      +.+.+|++++|.|..........+.|||..
T Consensus         2 v~~~~G~~vtl~C~~~~~~~~~~~~W~r~~   31 (98)
T cd05716           2 VTGELGGSVTIPCPYPPKNRSYEKYWCKWG   31 (98)
T ss_pred             EEEEeCCeEEEEeeCCCCCCCcEeEeECCC
Confidence            467899999999987554567789999974


No 158
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=96.53  E-value=0.0045  Score=34.81  Aligned_cols=32  Identities=13%  Similarity=0.482  Sum_probs=23.3

Q ss_pred             eEEeecCCcEEEEEEecC----------CCCCceEEEEECCE
Q psy7728          30 KIEIRENQEITLECLVKN----------AKPAAKIVWYRGNT   61 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~----------~~P~~~i~W~~~~~   61 (65)
                      ...+.+|+.+.|.|-.-.          ..+..+|+|||++.
T Consensus         9 ~~~~~~GE~v~l~C~~~~~~~~~~~~~~~~~~~~v~WyK~~~   50 (104)
T cd05896           9 KYMVLAGEPVRIKCALFYGYIRTNYSMAQSAGLSLMWYKSSG   50 (104)
T ss_pred             eEEEcCCCeEEEECCCccccccccccccccCCceEEEEECCC
Confidence            357899999999997511          11245899999964


No 159
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=96.52  E-value=0.0084  Score=32.94  Aligned_cols=30  Identities=23%  Similarity=0.350  Sum_probs=23.6

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEEEECCE
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      +.+.+|++++|+|.+.+. ....+.||+-++
T Consensus         7 vtv~~G~ta~L~C~v~~~-~~~~v~w~~~~~   36 (95)
T cd05881           7 VTVVEGEVAIISCRVKNN-DDSVIQLLNPNR   36 (95)
T ss_pred             eEEcCCCcEEEEEEEccC-CccEEEEEecCC
Confidence            578999999999999764 456678887653


No 160
>KOG3515|consensus
Probab=96.50  E-value=0.002  Score=46.42  Aligned_cols=47  Identities=28%  Similarity=0.550  Sum_probs=35.1

Q ss_pred             cCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          15 APPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        15 ~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .+..++.+.+.+.  .-.+.+|+.+.|.|.+.+++|.++++||++.+..
T Consensus       202 ~~~~~~~~~~~~~--~qsF~~g~~inlvc~~~gg~P~~~~~w~~~s~~~  248 (741)
T KOG3515|consen  202 APCKGIGITGAQE--QQSFTEGQTINLVCNAQGGNPSQQQTWYKDSRPQ  248 (741)
T ss_pred             cccccceecchhh--cCcccccceEEEEehhhcCCcchhhhhccccccc
Confidence            3444444443322  1368899999999999999999999999998764


No 161
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.43  E-value=0.0073  Score=28.40  Aligned_cols=24  Identities=33%  Similarity=0.814  Sum_probs=20.1

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      ++|.|.+.+ .|...+.|++++...
T Consensus         1 ~~l~C~~~~-~~~~~~~W~~~~~~~   24 (74)
T cd00096           1 VTLTCLASG-PPPPTITWLKNGKPL   24 (74)
T ss_pred             CEEEEEecC-CCCCcEEEEECCEEC
Confidence            378999977 789999999998653


No 162
>PHA02785 IL-beta-binding protein; Provisional
Probab=96.37  E-value=0.0035  Score=40.87  Aligned_cols=30  Identities=20%  Similarity=0.337  Sum_probs=25.1

Q ss_pred             EeecCCcEEEEEEec----CCCCCceEEEEECCE
Q psy7728          32 EIRENQEITLECLVK----NAKPAAKIVWYRGNT   61 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~----~~~P~~~i~W~~~~~   61 (65)
                      ...+|+.+.|.|...    .+.|.++|+|||+|.
T Consensus        37 ~~~~ge~~~l~C~~~~~~~~g~p~~~i~W~K~g~   70 (326)
T PHA02785         37 MELENEPVILPCPQINTLSSGYNILDILWEKRGA   70 (326)
T ss_pred             hhhcCCCEEEECCCccccccCCCCceEEEEECCC
Confidence            467899999999862    567899999999975


No 163
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig2_Nectin-1_like: domain similar to the second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. Nectins also heterophilically trans-interact with other CAMs such as nectin-like molecules (necls); nectin-1 for example, has been shown to trans-interact with necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is associ
Probab=96.37  E-value=0.0052  Score=34.19  Aligned_cols=19  Identities=26%  Similarity=0.662  Sum_probs=16.9

Q ss_pred             EEEEEecCCCCCceEEEEE
Q psy7728          40 TLECLVKNAKPAAKIVWYR   58 (65)
Q Consensus        40 ~L~C~~~~~~P~~~i~W~~   58 (65)
                      ...|.+.+|+|++.|+|.-
T Consensus        24 VA~CiSa~GrPpa~ItW~t   42 (98)
T cd05890          24 VATCVSANGKPPSVVRWDT   42 (98)
T ss_pred             EEEEEcCCCcCCcEeEEEc
Confidence            3599999999999999974


No 164
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=96.34  E-value=0.014  Score=32.51  Aligned_cols=30  Identities=13%  Similarity=0.473  Sum_probs=22.1

Q ss_pred             eEEeecCCcEEEEEEecCCCC---CceEEEEEC
Q psy7728          30 KIEIRENQEITLECLVKNAKP---AAKIVWYRG   59 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P---~~~i~W~~~   59 (65)
                      .+.+.+|+.++|.|......+   ...|.||+.
T Consensus         7 ~v~v~~G~~vtL~C~~s~~~~~~~~~~v~W~~~   39 (116)
T cd05715           7 EVYAVNGSDVRLKCTFSSSEPISDDISVTWSFQ   39 (116)
T ss_pred             eEEEEcCCCeEEEeEEeCCCCcCCceEEEEEEe
Confidence            357889999999998754332   246999873


No 165
>PF06832 BiPBP_C:  Penicillin-Binding Protein C-terminus Family;  InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs). A variable length loop region separates this region from the transpeptidase unit (IPR001460 from INTERPRO). It is predicted to be a beta fold.
Probab=96.23  E-value=0.05  Score=29.06  Aligned_cols=45  Identities=22%  Similarity=0.380  Sum_probs=25.2

Q ss_pred             EEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          10 RLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        10 ~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .|.+..|+....+...+.     ..+..  .|.+.+.++.+  .+.||.||+.+
T Consensus        10 ~l~I~~P~~g~~~~~~~~-----~~~~~--~l~l~a~~~~~--~~~W~vdg~~~   54 (89)
T PF06832_consen   10 PLRITSPPDGAVLALDPG-----IPERQ--PLVLKAAGGRG--PVYWFVDGEPL   54 (89)
T ss_pred             CCEEEecCCCCEEEeCCC-----CCccc--eEEEEEeCCCC--cEEEEECCEEc
Confidence            455666665544432221     01234  44445545533  99999999987


No 166
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=96.21  E-value=0.013  Score=36.10  Aligned_cols=32  Identities=22%  Similarity=0.484  Sum_probs=25.9

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEECCE
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      .+.+.+|++++|.|.-..+.....++|+|..+
T Consensus        24 ~v~V~ege~VtLsCs~t~s~~~~qVtWkK~~~   55 (189)
T PHA02987         24 KITVSEHVNVKISCNKTSSFNSILITWKKNNK   55 (189)
T ss_pred             EEEEcCCCCEEEEEecCCCCccceEEEEEcCC
Confidence            35789999999999975455678899999753


No 167
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=96.21  E-value=0.0062  Score=32.06  Aligned_cols=25  Identities=24%  Similarity=0.538  Sum_probs=20.6

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECCE
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      |++++|.|.... .+...|.||++..
T Consensus         1 G~~VtL~c~~~~-~~~~~i~W~~~~~   25 (92)
T cd05741           1 GESVTLPVSNLP-ENLQEITWYKGKD   25 (92)
T ss_pred             CCcEEEEcccCC-CCCEEEEEECCCC
Confidence            789999998765 5677999999864


No 168
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=96.19  E-value=0.012  Score=31.33  Aligned_cols=27  Identities=11%  Similarity=0.407  Sum_probs=21.4

Q ss_pred             CCcEEEEEEecCC-CCCceEEEEECCEE
Q psy7728          36 NQEITLECLVKNA-KPAAKIVWYRGNTE   62 (65)
Q Consensus        36 G~~~~L~C~~~~~-~P~~~i~W~~~~~~   62 (65)
                      |++++|+|.+.+. .|...+.|...++.
T Consensus         1 Ge~~~L~C~~~~~~~~~~~~~W~~p~~~   28 (86)
T cd05862           1 GEKLVLNCTARTELNVGIDFQWDYPGKK   28 (86)
T ss_pred             CCcEEEEEEEEeCCCCcEEEEEEcCCcc
Confidence            7889999999743 56678999987753


No 169
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=96.07  E-value=0.021  Score=32.05  Aligned_cols=29  Identities=17%  Similarity=0.367  Sum_probs=22.3

Q ss_pred             EEeecCCcEEEEEEecCCC-CCceEEEEEC
Q psy7728          31 IEIRENQEITLECLVKNAK-PAAKIVWYRG   59 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~-P~~~i~W~~~   59 (65)
                      +.+.+|++++|.|...+.. -...+.|||.
T Consensus         7 ~~v~~G~~vtL~C~~~~~~~~~~~~~WYkQ   36 (117)
T cd04981           7 GLVKPGQSLKLSCKASGFTFTSYGVNWVRQ   36 (117)
T ss_pred             eEEcCCCCEEEEEEEeCCCcccceEEEEEE
Confidence            5789999999999875432 2456999995


No 170
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=96.00  E-value=0.022  Score=30.41  Aligned_cols=30  Identities=23%  Similarity=0.670  Sum_probs=24.0

Q ss_pred             eEEeecCCcEEEEEEecCCCCCceEEEEEC
Q psy7728          30 KIEIRENQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      .+.+.+|++++|.|..........+.||+.
T Consensus        10 ~v~~~~G~~v~L~C~~~~~~~~~~v~W~~~   39 (114)
T PF07686_consen   10 PVTVQEGESVTLPCSYSSSSNQSSVYWYRQ   39 (114)
T ss_dssp             EEEEETTSEEEEEEEEESSSSGSEEEEEEE
T ss_pred             eEEEecCCCEEEEEEEeCCCCcceEEEEEE
Confidence            357899999999999872235678999994


No 171
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=96.00  E-value=0.015  Score=31.96  Aligned_cols=28  Identities=21%  Similarity=0.407  Sum_probs=21.5

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      .+.+|+.++|+|..... -...+.|||..
T Consensus         2 ~v~~G~~vtL~C~~~~~-~~~~v~Wyrq~   29 (104)
T cd05720           2 DAELGQKVELKCEVLNS-SPTGCSWLFQP   29 (104)
T ss_pred             cccCCCeEEEEEEecCC-CCCcEEEEEeC
Confidence            36789999999987543 34569999964


No 172
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=95.95  E-value=0.028  Score=31.43  Aligned_cols=29  Identities=21%  Similarity=0.554  Sum_probs=21.5

Q ss_pred             eEEeecCCcEEEEEEecCCCC---CceEEEEE
Q psy7728          30 KIEIRENQEITLECLVKNAKP---AAKIVWYR   58 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~P---~~~i~W~~   58 (65)
                      .+.+.+|+.++|.|.-....+   ...|.||+
T Consensus         7 ~v~~~~G~~v~L~C~~s~~~~~~~~~~i~W~~   38 (115)
T cd05880           7 EVEAVNGTDVRLKCTFSSSAPIGDTLVITWNF   38 (115)
T ss_pred             eEEEEcCCCEEEEEEEEeCCCCCCcEEEEEEE
Confidence            467899999999998644322   23699985


No 173
>KOG4222|consensus
Probab=95.92  E-value=0.016  Score=43.64  Aligned_cols=56  Identities=16%  Similarity=0.343  Sum_probs=41.8

Q ss_pred             CCcccCCCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEE
Q psy7728           1 MLSRYGPRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTE   62 (65)
Q Consensus         1 ~~~~~~~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~   62 (65)
                      +++..+..+.|+|.+||+-..=. ...    .+.-|..++|.|.+.+ +|++.+.|.|.|..
T Consensus       300 ~vG~l~asa~ltV~apP~f~kkp-~dq----~v~lg~~vt~pc~~~g-nP~PavfW~keg~q  355 (1281)
T KOG4222|consen  300 LVGGLEASATLTVQAPPSFGKKP-RDQ----KVALGGTVTFPCETLG-NPPPAVFWLKEGSQ  355 (1281)
T ss_pred             cccccccccceEEecCccccccc-Ccc----ccccCceEEeeeecCC-CCCcceEEeccCcc
Confidence            45667788999999999743211 111    4566889999999964 79999999998754


No 174
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=95.89  E-value=0.019  Score=31.18  Aligned_cols=26  Identities=15%  Similarity=0.387  Sum_probs=19.1

Q ss_pred             cCCcEEEEEEecCC-----CCCceEEEEECC
Q psy7728          35 ENQEITLECLVKNA-----KPAAKIVWYRGN   60 (65)
Q Consensus        35 ~G~~~~L~C~~~~~-----~P~~~i~W~~~~   60 (65)
                      .|++++|.|.....     .....|.|||..
T Consensus         1 ~G~~vtL~C~~~~~~~~~~~~~~~v~W~k~~   31 (106)
T cd05877           1 RGGNVTLPCRYHYEPELSAPRKIRVKWTKLE   31 (106)
T ss_pred             CCCcEEEEeEeECCCcCCCCccceEEEEEec
Confidence            48999999986543     234579999964


No 175
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=95.88  E-value=0.022  Score=31.71  Aligned_cols=27  Identities=19%  Similarity=0.432  Sum_probs=20.8

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEEC
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      .+.+|+.+.|.|.-.. .+...|+|||+
T Consensus         9 ~~~~G~~V~L~v~~~p-~~~~~~~W~kg   35 (105)
T cd05774           9 QVAEGENVLLLVHNLP-ENLLAYAWYKG   35 (105)
T ss_pred             cccCCCCEEEEecCCC-CCceEEEEEcC
Confidence            5788999999997522 34458999997


No 176
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=95.76  E-value=0.02  Score=35.89  Aligned_cols=33  Identities=15%  Similarity=0.328  Sum_probs=25.5

Q ss_pred             eEEeecCCcEEEEEEecCCC----------CCceEEEEECCEE
Q psy7728          30 KIEIRENQEITLECLVKNAK----------PAAKIVWYRGNTE   62 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~~----------P~~~i~W~~~~~~   62 (65)
                      .+.+.+|+++.|.|.+.+..          ....+.|+|++..
T Consensus        31 ~~~v~eGe~v~L~C~~~~~~~~~~~~~~~~~~~~V~W~k~~s~   73 (227)
T PHA02826         31 PVYAKFGDPMVLLCTGKHYKKSIFFDKTFITSYNVTWSKTDSL   73 (227)
T ss_pred             eEEecCCCCEEEEccccccccccccccccCCCccEEEEeCCeE
Confidence            35789999999999985521          2458999999854


No 177
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=95.45  E-value=0.014  Score=31.65  Aligned_cols=27  Identities=15%  Similarity=0.261  Sum_probs=20.6

Q ss_pred             cCCcEEEEEEecCCCCCceEEEEECCE
Q psy7728          35 ENQEITLECLVKNAKPAAKIVWYRGNT   61 (65)
Q Consensus        35 ~G~~~~L~C~~~~~~P~~~i~W~~~~~   61 (65)
                      .|++|+|.|..........|.||++..
T Consensus         3 ~G~sVtL~c~~~~~~~~~~v~W~~~~~   29 (97)
T cd05775           3 LGGSVTLPLNIPDGTEIESITWSFNTS   29 (97)
T ss_pred             cCCeEEEeCCCCCCcEEEEEEEecCCE
Confidence            589999999775434567899998753


No 178
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=95.02  E-value=0.1  Score=29.15  Aligned_cols=32  Identities=16%  Similarity=0.547  Sum_probs=22.6

Q ss_pred             CeEEeecCCcEEEEEEecCCC----C-CceEEEEECC
Q psy7728          29 SKIEIRENQEITLECLVKNAK----P-AAKIVWYRGN   60 (65)
Q Consensus        29 ~~~~~~~G~~~~L~C~~~~~~----P-~~~i~W~~~~   60 (65)
                      ..+.+.+|+.++|.|.-....    + ...+.|||..
T Consensus         7 ~~v~~~~G~~VtL~C~f~~~~~~~~~~~~~~~Wykq~   43 (119)
T cd05712           7 KSVSVQEGLCVLIPCSFSYPADWPVSNGVHGIWYKGH   43 (119)
T ss_pred             CEEEEeccccEEEEEEeeCcccccCCCceEEEEEeCC
Confidence            346789999999999643221    1 3569999964


No 179
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=94.83  E-value=0.039  Score=29.29  Aligned_cols=24  Identities=21%  Similarity=0.527  Sum_probs=17.7

Q ss_pred             CcEEEEEEecCCC--CCceEEEEECC
Q psy7728          37 QEITLECLVKNAK--PAAKIVWYRGN   60 (65)
Q Consensus        37 ~~~~L~C~~~~~~--P~~~i~W~~~~   60 (65)
                      ++++|.|......  ....|.|||..
T Consensus         1 ~~v~L~C~~~~~~~~~~~~v~W~k~~   26 (98)
T cd05718           1 ESVTLECSFPVPGPVQITQVTWMKIT   26 (98)
T ss_pred             CCEEEEeEeeCCCCceEEEEEEeeEC
Confidence            4689999876543  34579999964


No 180
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=94.73  E-value=0.059  Score=28.98  Aligned_cols=24  Identities=17%  Similarity=0.455  Sum_probs=17.5

Q ss_pred             CCcEEEEEEecCCCCCceEEEEEC
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      |++++|.|.-......-.|.|+|.
T Consensus         1 G~~vtL~C~~~~~~~~~~v~W~k~   24 (97)
T cd05846           1 GGNVTLSCNLTLPEEVLQVTWQKI   24 (97)
T ss_pred             CCcEEEEEEeCCCCeeEEEEEEEc
Confidence            788999998543333347999985


No 181
>KOG4222|consensus
Probab=94.33  E-value=0.047  Score=41.33  Aligned_cols=56  Identities=14%  Similarity=0.285  Sum_probs=43.4

Q ss_pred             cCCCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEECCEEcc
Q psy7728           5 YGPRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus         5 ~~~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      +++.+.|.|.+-+++-.+....    +.+..|+.+.|.|.-..+.|.+.++|.|+|+++.
T Consensus       119 vSr~a~L~vavlrddfrv~prd----~~~a~ge~avlEcgpP~ghpeptvSw~Kdg~pl~  174 (1281)
T KOG4222|consen  119 VSRGASLIVAVLRDDFRVSPRD----VQAAVGEEAVLECGPPRGHPEPTVSWVKDGKPLD  174 (1281)
T ss_pred             eecCceEEEEEechhcccCccc----ccccccceeEEeccCCCCCCCCcceeecCCCccc
Confidence            3556778887777665443222    4678899999999999999999999999998863


No 182
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=94.29  E-value=0.11  Score=28.22  Aligned_cols=24  Identities=21%  Similarity=0.433  Sum_probs=18.8

Q ss_pred             CCcEEEEEEecCCC-----CCceEEEEEC
Q psy7728          36 NQEITLECLVKNAK-----PAAKIVWYRG   59 (65)
Q Consensus        36 G~~~~L~C~~~~~~-----P~~~i~W~~~   59 (65)
                      |+.++|.|.-....     -...|.|+|.
T Consensus         2 G~~V~L~C~~~~~~~~~~~~~~~i~W~k~   30 (106)
T cd05714           2 GGNVTLPCRFHLEPALSAPHGPRIKWTKL   30 (106)
T ss_pred             CCCEEEeEEeECCcccCCCCCcEEEEEEe
Confidence            88999999875432     2568999997


No 183
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=94.12  E-value=0.055  Score=28.37  Aligned_cols=19  Identities=32%  Similarity=0.728  Sum_probs=14.6

Q ss_pred             CcEEEEEEecCCCCCceEEEEECC
Q psy7728          37 QEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        37 ~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      +.|.|+|.+     ..+|+||++.
T Consensus         7 ~~V~L~C~~-----~tsi~W~kG~   25 (69)
T cd07691           7 GKVFLKCNG-----ATNITWKKGK   25 (69)
T ss_pred             ceEEEEecC-----CCcEEEecCc
Confidence            568999965     3679999943


No 184
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=94.10  E-value=0.11  Score=29.19  Aligned_cols=24  Identities=13%  Similarity=0.409  Sum_probs=18.5

Q ss_pred             CCcEEEEEEecCCCC-----------CceEEEEEC
Q psy7728          36 NQEITLECLVKNAKP-----------AAKIVWYRG   59 (65)
Q Consensus        36 G~~~~L~C~~~~~~P-----------~~~i~W~~~   59 (65)
                      |++++|.|.-....+           ...|.|||.
T Consensus         2 G~~VtLpC~~~~~~~~~~~~~~~~~~~~~I~W~k~   36 (112)
T cd05900           2 GSSLLIPCYFQDPIAKDPGAPTVAPLSPRIKWSFI   36 (112)
T ss_pred             CCcEEEeeEEeCCcCccccccccCCCCCEEEEEEe
Confidence            889999998765432           358999984


No 185
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=94.10  E-value=0.12  Score=28.71  Aligned_cols=24  Identities=17%  Similarity=0.450  Sum_probs=18.4

Q ss_pred             CCcEEEEEEecCCCC---------CceEEEEEC
Q psy7728          36 NQEITLECLVKNAKP---------AAKIVWYRG   59 (65)
Q Consensus        36 G~~~~L~C~~~~~~P---------~~~i~W~~~   59 (65)
                      |+.++|.|.-....+         ...|.|||.
T Consensus         2 G~~V~LpC~~~~~~~~~~~~~~~~~~~i~W~k~   34 (110)
T cd05878           2 SSSVLLPCYFTLPPALPPPSNAPESPRIKWTKL   34 (110)
T ss_pred             CCCEEEeeEeeCCccccccccCCCCCEEEEEEe
Confidence            789999998865432         367999995


No 186
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=93.85  E-value=0.17  Score=27.03  Aligned_cols=25  Identities=20%  Similarity=0.610  Sum_probs=16.9

Q ss_pred             CCcEEEEEEecCCCCC--ceEEEEECC
Q psy7728          36 NQEITLECLVKNAKPA--AKIVWYRGN   60 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~--~~i~W~~~~   60 (65)
                      |++++|.|........  ..|.|||..
T Consensus         1 G~~v~L~C~~~~~~~~~~~~v~W~k~~   27 (100)
T cd05713           1 GEDAELPCHLSPKMSAEHMEVRWFRSQ   27 (100)
T ss_pred             CCcEEEEeEEcCCCCCCeeEEEEEECC
Confidence            6889999987533221  358898864


No 187
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=93.60  E-value=0.28  Score=27.67  Aligned_cols=26  Identities=15%  Similarity=0.381  Sum_probs=20.3

Q ss_pred             EEeecCCcEEEEEEecCCC---CCceEEE
Q psy7728          31 IEIRENQEITLECLVKNAK---PAAKIVW   56 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~---P~~~i~W   56 (65)
                      +.+..|+.++|.|.-....   +..+|+|
T Consensus         8 v~a~~G~~v~L~C~f~~~~~~~~~~~v~W   36 (116)
T cd05879           8 VYGTVGSDVTLSCSFWSSEWISDDISFTW   36 (116)
T ss_pred             EEEEcCCcEEEEEEEecCCCCCCcEEEEE
Confidence            4678899999999986532   3468999


No 188
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=93.00  E-value=0.36  Score=27.59  Aligned_cols=29  Identities=14%  Similarity=0.174  Sum_probs=22.1

Q ss_pred             EEeecCCcEEEEEEecCC-CCC-ceEEEEEC
Q psy7728          31 IEIRENQEITLECLVKNA-KPA-AKIVWYRG   59 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~-~P~-~~i~W~~~   59 (65)
                      +.+..|..++|+|...+. ... -.++|+|+
T Consensus         8 ~lv~p~~sv~LsC~~sg~~~s~e~~~~wvRq   38 (115)
T cd05721           8 VLASSNGAASLVCEYTYNGFSKEFRASLLKG   38 (115)
T ss_pred             eEEcCCCCEEEEEEecCCccccEEEEEEEEe
Confidence            467788899999998663 333 47999986


No 189
>PF06328 Lep_receptor_Ig:  Ig-like C2-type domain;  InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) []. The two cysteine residues form a disulphide bridge.; PDB: 3L5H_A 1P9M_A 1I1R_A 2D9Q_B.
Probab=92.43  E-value=0.68  Score=25.11  Aligned_cols=33  Identities=21%  Similarity=0.463  Sum_probs=24.5

Q ss_pred             EeecCCcEEEEEEecCCC----CCceEEEEECCEEcc
Q psy7728          32 EIRENQEITLECLVKNAK----PAAKIVWYRGNTELK   64 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~----P~~~i~W~~~~~~l~   64 (65)
                      .+.-|++++.+|....+-    .+..|-|..|+..+.
T Consensus        14 vv~lGS~vtasC~l~~~c~~~~~a~~I~Wkln~~~iP   50 (89)
T PF06328_consen   14 VVSLGSNVTASCVLKQNCSHSVNASQIVWKLNGEKIP   50 (89)
T ss_dssp             EEETTS-EEEEEEE-CCCHCT-STTCEEEECSSCEST
T ss_pred             EEeCCCCEEEEEEEECCCCCCcccceEEEEECCEECC
Confidence            467899999999988653    567899999887653


No 190
>PHA03052 Hypothetical protein; Provisional
Probab=91.93  E-value=0.81  Score=23.96  Aligned_cols=33  Identities=21%  Similarity=0.414  Sum_probs=26.1

Q ss_pred             EEeecCCcEEEEEEecCCCC--CceEEEEECCEEc
Q psy7728          31 IEIRENQEITLECLVKNAKP--AAKIVWYRGNTEL   63 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P--~~~i~W~~~~~~l   63 (65)
                      +.+.-|+.+++.|.+.-++|  .+.+.|--|+..+
T Consensus         7 i~~slGs~ltI~Ckv~lg~g~~~a~V~W~~N~~~~   41 (69)
T PHA03052          7 IVTSLGSNLTITCKVSLRPPTTDADVFWISNGMYY   41 (69)
T ss_pred             EEEEccCCceEeEEEEecCCCcceEEEEEeCCcEE
Confidence            56778999999999986654  4678898888665


No 191
>smart00406 IGv Immunoglobulin V-Type.
Probab=91.83  E-value=0.37  Score=24.09  Aligned_cols=23  Identities=22%  Similarity=0.419  Sum_probs=16.1

Q ss_pred             cEEEEEEecCCCCC-ceEEEEECC
Q psy7728          38 EITLECLVKNAKPA-AKIVWYRGN   60 (65)
Q Consensus        38 ~~~L~C~~~~~~P~-~~i~W~~~~   60 (65)
                      +++|.|........ ..+.||+..
T Consensus         1 ~v~l~C~~~~~~~~~~~v~W~~~~   24 (81)
T smart00406        1 SVTLSCKASGFTFSSYYVSWVRQP   24 (81)
T ss_pred             CEEEEEEEeccccceeEEEEEEeC
Confidence            47899988654322 479999964


No 192
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=91.19  E-value=0.23  Score=33.17  Aligned_cols=22  Identities=27%  Similarity=0.626  Sum_probs=19.5

Q ss_pred             cEEEEEEecCCCCCc-eEEEEEC
Q psy7728          38 EITLECLVKNAKPAA-KIVWYRG   59 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~-~i~W~~~   59 (65)
                      .++|+|.+.+..|.. .|+|.||
T Consensus       216 ~~tL~C~A~GFYP~~I~v~W~kd  238 (338)
T PHA02865        216 NTTLFCTFDSHYPSSVAAKWYNS  238 (338)
T ss_pred             CceEEEEEEeEeCCccEEEEEec
Confidence            579999999999874 6999999


No 193
>PF09085 Adhes-Ig_like:  Adhesion molecule, immunoglobulin-like;  InterPro: IPR015169 This domain is found in mucosal vascular addressin cell adhesion molecule 1 proteins (MAdCAM-1). These are cell adhesion molecules expressed on the endothelium in mucosa that guide the specific homing of lymphocytes into mucosal tissues. MAdCAM-1 belongs to a subclass of the immunoglobulin superfamily (IgSF), the members of which are ligands for integrins []. The crystal structure of this domain has been reported; it adopts an immunoglobulin-like beta-sandwich structure, with seven strands arranged in two beta-sheets in a Greek-key topology [, ].; GO: 0007155 cell adhesion, 0016020 membrane; PDB: 1GSM_A 1BQS_A.
Probab=90.58  E-value=0.33  Score=27.26  Aligned_cols=34  Identities=21%  Similarity=0.382  Sum_probs=22.9

Q ss_pred             EeecCCcEEEEEEecCCCCC----ceEEEEECCEEccC
Q psy7728          32 EIRENQEITLECLVKNAKPA----AKIVWYRGNTELKL   65 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~----~~i~W~~~~~~l~~   65 (65)
                      .+..|...++.|++.+-.|+    -+++|+.+++++.|
T Consensus        12 ~LVpg~dqevaCTAhnVtP~~p~~LSfslllGdqeLeg   49 (110)
T PF09085_consen   12 ALVPGRDQEVACTAHNVTPADPDALSFSLLLGDQELEG   49 (110)
T ss_dssp             SB-TT--SEEEEEEEEEB--STTTEEEEEEETTEE-TT
T ss_pred             HhccCCCceeeeeeccccCCCCCeEEeeeeeCceeecc
Confidence            46788888999998765553    36999999999876


No 194
>PF11049 KSHV_K1:  Glycoprotein K1 of Kaposi's sarcoma-associated herpes virus;  InterPro: IPR021022  This is a highly glycosylated cytoplasmic and membrane protein similar to the immunoglobulin receptor family that is expressed as an inducible early-lytic-cycle gene product in primary effusion lymphoma cell-lines. This domain would appear to be the cytoplasmic region of the protein []. 
Probab=89.74  E-value=0.19  Score=26.26  Aligned_cols=21  Identities=43%  Similarity=0.828  Sum_probs=14.9

Q ss_pred             EEEEEecCCCCCceEEEEECCEEc
Q psy7728          40 TLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        40 ~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +|+|-+..+-|   |+||-||..+
T Consensus         2 tltC~s~~sLP---iswYcN~TRL   22 (71)
T PF11049_consen    2 TLTCPSNASLP---ISWYCNGTRL   22 (71)
T ss_pred             ceecCCCCCCc---ccEEECCcee
Confidence            68887754444   7899988654


No 195
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=88.05  E-value=0.93  Score=24.77  Aligned_cols=23  Identities=17%  Similarity=0.557  Sum_probs=18.0

Q ss_pred             CcEEEEEEecCCCCCceEEEEEC
Q psy7728          37 QEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        37 ~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      +.++|.|.........+++|.|-
T Consensus         1 ~~vtL~C~~~~~~~~~qV~W~k~   23 (96)
T cd05889           1 EKMKLECVYPKTGVLIQVSWTKH   23 (96)
T ss_pred             CCEEEEeEcCCCCcEEEEEEEEc
Confidence            36899999865556788999985


No 196
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=86.51  E-value=1.3  Score=24.19  Aligned_cols=23  Identities=17%  Similarity=0.495  Sum_probs=17.7

Q ss_pred             CcEEEEEEecCCCCCceEEEEEC
Q psy7728          37 QEITLECLVKNAKPAAKIVWYRG   59 (65)
Q Consensus        37 ~~~~L~C~~~~~~P~~~i~W~~~   59 (65)
                      ++++|.|+-.......+++|.|-
T Consensus         1 ~~vtL~C~~~~~~~~~qV~W~k~   23 (96)
T cd05887           1 KNVTLKCRIQVNETITQSSWEKI   23 (96)
T ss_pred             CCEEEEEEecCCCcEEEEEEEEc
Confidence            46899999865556678999884


No 197
>PHA03112 IL-18 binding protein; Provisional
Probab=85.22  E-value=2  Score=25.50  Aligned_cols=30  Identities=30%  Similarity=0.582  Sum_probs=24.2

Q ss_pred             EEeecCCcEEEEEEecCCCCC-ceEEEEECC
Q psy7728          31 IEIRENQEITLECLVKNAKPA-AKIVWYRGN   60 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~-~~i~W~~~~   60 (65)
                      ++..+++++.|+|.+.+-.|. .-+-|.+++
T Consensus        33 vp~k~~~~vvL~C~gcs~fp~fS~lYWl~gn   63 (141)
T PHA03112         33 IPTKETEKVVLECRGCSYFPKFSYVYWLIGN   63 (141)
T ss_pred             cccCCCCEEEEEEECccCCCCceEEEEEcCC
Confidence            356789999999999855576 779999776


No 198
>KOG1480|consensus
Probab=83.84  E-value=0.29  Score=36.05  Aligned_cols=32  Identities=22%  Similarity=0.613  Sum_probs=28.2

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .+.++..+.|.|+...+.|++.+.||+|+..+
T Consensus       140 ~V~~~s~~~l~cr~pe~~paae~~w~k~e~~~  171 (909)
T KOG1480|consen  140 EVQEETTLQLPCRPPEGDPKAEVEWLKNEVVI  171 (909)
T ss_pred             eecccccccccccCcccchhhhhhccccCCCC
Confidence            57778889999999999999999999998654


No 199
>PF02440 Adeno_E3_CR1:  Adenovirus E3 region protein CR1;  InterPro: IPR003471 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D virus) 49 Kd protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=83.10  E-value=1.9  Score=22.11  Aligned_cols=20  Identities=25%  Similarity=0.707  Sum_probs=13.8

Q ss_pred             eecCCcEEEEEEecCCCCCceEEEE
Q psy7728          33 IRENQEITLECLVKNAKPAAKIVWY   57 (65)
Q Consensus        33 ~~~G~~~~L~C~~~~~~P~~~i~W~   57 (65)
                      +..|++++|.     |.|...++||
T Consensus         2 v~~G~N~TL~-----Gp~~~~V~Wy   21 (63)
T PF02440_consen    2 VTVGSNVTLV-----GPPDGPVTWY   21 (63)
T ss_pred             EeEcCcEEEe-----CCCCCceEEE
Confidence            3567888883     3456779998


No 200
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=83.01  E-value=3.1  Score=22.39  Aligned_cols=22  Identities=18%  Similarity=0.549  Sum_probs=15.3

Q ss_pred             cEEEEEEecCCCC--CceEEEEEC
Q psy7728          38 EITLECLVKNAKP--AAKIVWYRG   59 (65)
Q Consensus        38 ~~~L~C~~~~~~P--~~~i~W~~~   59 (65)
                      +++|.|.-....+  ...|.|+|.
T Consensus         2 ~v~L~C~~~~~~~~~~~~v~W~k~   25 (100)
T cd05888           2 DTRLPCRYNVSDGETVVQVLWIRE   25 (100)
T ss_pred             CEEEEeEEecCCCCcEEEEEEEEc
Confidence            5799998754321  348999994


No 201
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=80.14  E-value=4.4  Score=22.61  Aligned_cols=24  Identities=17%  Similarity=0.455  Sum_probs=16.4

Q ss_pred             CCcEEEEEEecCC------CCCceEEEEEC
Q psy7728          36 NQEITLECLVKNA------KPAAKIVWYRG   59 (65)
Q Consensus        36 G~~~~L~C~~~~~------~P~~~i~W~~~   59 (65)
                      |.+++|.|.-.-.      ...+.|.|+|.
T Consensus         2 ~~~v~LpC~~~~~p~~~~~~~~~~I~W~k~   31 (110)
T cd05902           2 SSSVLLPCVFTLPPSASSPPEGPRIKWTKL   31 (110)
T ss_pred             CCcEEEeeEEEcCccccCCCCCCEEEEEEe
Confidence            6788999984321      12368999985


No 202
>PF04668 Tsg:  Twisted gastrulation (Tsg) protein conserved region;  InterPro: IPR006761 Tsg was identified in Drosophila melanogaster as being required to specify the dorsal-most structures in the embryo, for example the amnioserosa. Biochemical experiments have revealed three key properties of Tsg: it can synergistically inhibit Dpp/BMP action in both D. melanogaster and vertebrates by forming a tripartite complete between itself, SOG/chordin and a BMP ligand;  Tsg seems to enhance the Tld/BMP-1-mediated cleavage rate of SOG/chordin and may change the preference of site utilisation;  Tsg can promote the dissociation of chordin cysteine-rich-containing fragments from the ligand to inhibit BMP signalling [, ]. 
Probab=80.03  E-value=0.47  Score=27.81  Aligned_cols=11  Identities=18%  Similarity=0.598  Sum_probs=9.3

Q ss_pred             CCceEEEEECC
Q psy7728          50 PAAKIVWYRGN   60 (65)
Q Consensus        50 P~~~i~W~~~~   60 (65)
                      -+..++||+||
T Consensus        98 GAssYRWFHdg  108 (132)
T PF04668_consen   98 GASSYRWFHDG  108 (132)
T ss_pred             Ccccceeeccc
Confidence            37889999997


No 203
>PHA03376 BARF1; Provisional
Probab=78.63  E-value=3.2  Score=26.17  Aligned_cols=29  Identities=14%  Similarity=0.408  Sum_probs=21.4

Q ss_pred             EEeecCCcEEEEEEecCC--CCCceEEEEEC
Q psy7728          31 IEIRENQEITLECLVKNA--KPAAKIVWYRG   59 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~--~P~~~i~W~~~   59 (65)
                      +...-|+.++|+|.-...  -+.-.|.|||.
T Consensus        21 Vta~VGEda~LsC~lnp~ssa~~MrIrWqKs   51 (221)
T PHA03376         21 VTAFLGERVTLTSYWRRVSLGPEIEVSWFKL   51 (221)
T ss_pred             hhheeCCcEEEEecccCccCCCceEEEEEec
Confidence            467789999999976411  24457999995


No 204
>PHA03376 BARF1; Provisional
Probab=77.52  E-value=2.4  Score=26.69  Aligned_cols=24  Identities=25%  Similarity=0.483  Sum_probs=19.7

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECC
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      -+..+++|. .++.|.|.++|.-|.
T Consensus       139 ~~~~~i~C~-sggfP~P~~~Wle~~  162 (221)
T PHA03376        139 FSVLTVTCT-VNAFPHPHVQWLMPE  162 (221)
T ss_pred             CCeeEEEEe-cCCcCCchheecccc
Confidence            355689999 588999999998763


No 205
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=73.85  E-value=4.3  Score=23.68  Aligned_cols=30  Identities=20%  Similarity=0.475  Sum_probs=18.6

Q ss_pred             ecCCcEEEEEEecCCC----CCceEEEEECCEEc
Q psy7728          34 RENQEITLECLVKNAK----PAAKIVWYRGNTEL   63 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~----P~~~i~W~~~~~~l   63 (65)
                      .=++++.|.|.+.+-.    +.-.|+|..+|+.+
T Consensus        25 ~CN~tV~IPC~v~n~~~~ni~~m~VkWk~~~~~I   58 (130)
T PF08204_consen   25 VCNDTVVIPCFVNNLEANNISEMYVKWKFKNKDI   58 (130)
T ss_dssp             TT-SEEEE--BBSS---SSGGGEEEEEEETTEEE
T ss_pred             ecCCCEEEEeEeccccccccceEEEEEEECCeEE
Confidence            4468899999985421    33459999999864


No 206
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=66.30  E-value=14  Score=20.97  Aligned_cols=24  Identities=21%  Similarity=0.480  Sum_probs=15.0

Q ss_pred             CCcEEEEEEecCCC--C--------CceEEEEEC
Q psy7728          36 NQEITLECLVKNAK--P--------AAKIVWYRG   59 (65)
Q Consensus        36 G~~~~L~C~~~~~~--P--------~~~i~W~~~   59 (65)
                      |.+++|-|+-.-..  |        ...|.|++-
T Consensus         2 ~g~v~LPC~f~~~p~~p~~~~~~~~~~rIkW~~~   35 (117)
T cd05901           2 SGSVVLPCRFSTLPTLPPSVITTSEFLRIKWTKI   35 (117)
T ss_pred             CCCEEEeeEEEecCCCCCcccCCCCCcEEEEEEe
Confidence            46778888765321  1        237899873


No 207
>PF08239 SH3_3:  Bacterial SH3 domain;  InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. A homologue of the SH3 domain has been found in a number of different bacterial proteins including glycyl-glycine endopeptidase, bacteriocin and some hypothetical proteins.; PDB: 3PVQ_B 3NPF_B 3H41_A 2KQ8_A 2KRS_A 2KYB_A 2KT8_A.
Probab=55.88  E-value=21  Score=16.65  Aligned_cols=36  Identities=19%  Similarity=0.313  Sum_probs=21.9

Q ss_pred             EEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCCCCceEEEEE
Q psy7728          11 LYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAKPAAKIVWYR   58 (65)
Q Consensus        11 L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~   58 (65)
                      |+|...|..-      ......+..|+.+++.+...++.      |++
T Consensus         3 ~nvR~~p~~~------s~~i~~l~~g~~v~v~~~~~~~~------W~~   38 (55)
T PF08239_consen    3 LNVRSGPSTN------SPVIGQLPKGEKVTVLGESGDGN------WYK   38 (55)
T ss_dssp             EEEESSSSTT------STEEEEEETTSEEEEEEEETT--------EEE
T ss_pred             EEEEeCCCCC------ChhhEEEeCCCEEEEEEEcCCcE------EEE
Confidence            5666666431      11122678999999988876543      776


No 208
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=55.56  E-value=28  Score=18.88  Aligned_cols=22  Identities=23%  Similarity=0.652  Sum_probs=15.0

Q ss_pred             cEEEEEEecCCCCCc---eEEEEEC
Q psy7728          38 EITLECLVKNAKPAA---KIVWYRG   59 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~---~i~W~~~   59 (65)
                      .++|.|.=....|..   +|+|.+-
T Consensus         2 ~v~L~C~f~~~~~~~~~~~V~W~k~   26 (99)
T cd05886           2 DVVLHCSFINPLPPVKITQVTWQKL   26 (99)
T ss_pred             cEEEEeEeecCCCCCCeEEEEEEEC
Confidence            578999876443422   6999874


No 209
>PHA02982 hypothetical protein; Provisional
Probab=50.32  E-value=14  Score=23.70  Aligned_cols=29  Identities=28%  Similarity=0.615  Sum_probs=22.7

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      ...-++++.|.|.-+++.--....|+.++
T Consensus        35 ~a~vd~~V~L~C~~~~~~~i~~~~W~~~~   63 (251)
T PHA02982         35 NATVDQEVKLQCLFKDADEISRAMWKGDA   63 (251)
T ss_pred             hccCCCcEEEEecCCCcchhhhheeeCCC
Confidence            35668999999997766666778999864


No 210
>TIGR02073 PBP_1c penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function.
Probab=45.31  E-value=1.1e+02  Score=22.55  Aligned_cols=25  Identities=16%  Similarity=0.351  Sum_probs=18.2

Q ss_pred             CcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          37 QEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        37 ~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      +.+.|.+.+.+  ..+.+.||.||+.+
T Consensus       665 ~~~~~~~~~~~--~~~~~~W~~dg~~~  689 (727)
T TIGR02073       665 AALLLVLIAAG--GASGLYWFLDGKLL  689 (727)
T ss_pred             ccceEEEEecC--CCCceEEEECCEEe
Confidence            34556666643  56789999999986


No 211
>PF02124 Marek_A:  Marek's disease glycoprotein A;  InterPro: IPR001038  Equid herpesvirus 1 (Equine herpesvirus 1, EHV-1) glycoprotein 13 (EHV-1 gp13) has the characteristic features of a membrane-spanning protein: an N-terminal signal sequence; a hydrophobic membrane anchor region; a charged C-terminal cytoplasmic tail; and an exterior domain with nine potential N-glycosylation sites []. EHV-1 gp13 is the structural homologue of the gC-like glycoproteins of the Human herpesvirus 1 (HHV-1) and Human herpesvirus 2 (HHV-2) (gC-1 and gC-2 respectively), Pseudorabies virus (strain Indiana-Funkhauser/Becker) (PRV) (gIII) and Human herpesvirus 3 (HHV-3) (gp66).  Secretory glycoprotein GP57-65 precursor (glycoprotein A - GA) is similar to Herpesvirus glycoprotein C, and belongs to the immunoglobulin gene superfamily [, ]. GA is thought to play an immunoevasive role in the pathogenesis of Marek's disease. It is a candidate for causing the early-stage immunosuppression that occurs after MDHV infection.
Probab=40.73  E-value=90  Score=19.75  Aligned_cols=47  Identities=11%  Similarity=0.371  Sum_probs=25.7

Q ss_pred             cccCCCEEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEEEEecCCC-CCceEEEEECCEE
Q psy7728           3 SRYGPRTRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLECLVKNAK-PAAKIVWYRGNTE   62 (65)
Q Consensus         3 ~~~~~~~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~C~~~~~~-P~~~i~W~~~~~~   62 (65)
                      +|++..+.=.|+.+|.   |.       +.+.+|   ...|.+.--. ....|.|+-++..
T Consensus        69 ~r~~a~~~P~Vy~~P~---vs-------v~F~~g---~AVC~A~CVP~~~v~l~W~v~d~~  116 (211)
T PF02124_consen   69 TRFNATATPSVYPKPR---VS-------VRFEDG---YAVCTARCVPRGNVTLRWSVGDDP  116 (211)
T ss_pred             eEeecccccceecCCE---EE-------EEecCC---EEEEEcceeeCCCeEEEEEECCcc
Confidence            4555555566666663   22       234344   4556553221 2378999988753


No 212
>PF03921 ICAM_N:  Intercellular adhesion molecule (ICAM), N-terminal domain;  InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily. They are important in inflammation, immune responses and in intracellular signalling events []. The ICAM family consists of five members, designated ICAM-1 to ICAM-5. They are known to bind to leucocyte integrins CD11/CD18 during inflammation and in immune responses. In addition, ICAMs may exist in soluble forms in human plasma, due to activation and proteolysis mechanisms at cell surfaces. ICAM-1 (CD54) contains five Ig-like domains. It is expressed on leucocytes, endothelial and epithelial cells, and is upregulated in response to bacterial invasion. The protein is a ligand for lymphocyte-function associated (LFA) antigens and also a receptor for CD11a,b/CD18, fibrinogen, human rhinovirus and Plasmodium falciparum-infected erythrocytes. ICAM-1 binding sites for CD11a/CD18 and its other binding partners are located in the first domain and are overlapping. ICAM-1 domain 2 seems to play an important role in maintaining the conformation of domain 1 and particularly the structural integrity of the LFA-1 ligand-binding site []. The 3-dimensional atomic structure of the tandem N-terminal Ig-like domains (D1 and D2) of ICAM-1 has been determined to 2.2A resolution and fitted into a cryoelectron microscopy reconstruction of a rhinovirus-ICAM-1 complex []. Extensive charge interactions between ICAM-1 and human rhinovirusesare largely conserved in major and minor receptor groups of rhinoviruses. The interaction of ICAMs with LFA-1 is mediated by a divalent cation bound to the insertion (I)-domain on the alpha chain of LFA-1 and the carboxyl group of a conserved glutamic acid residue on ICAMs. ICAM-2 (CD102) has two Ig-like domains. It is expressed on endothelial cells, leucocytes and platelets, and binds to CD11a'b/CD18. The protein is refractory to proinflammatory cytokines, and plays an important role in the adhesion of leucocytes to the uninduced endothelium []. ICAM-3 (CD50) contains five Ig-like domains and binds to leucocyte integrins CD11a'd/CD18. The protein plays an important role in the immune response and perhaps in signal transduction []. ICAM-4 (LW blood group Ag) is red blood cell (RBC) specific and binds to CD11a'b/CD18. It is associated with the RBC Rh antigens and could be important in retaining immature red cells in the bone marrow, or in the uptake of senescent cells into the spleen []. ICAM-5 (telencephalin) has nine Ig-like domains and is confined to the telencephalon of the brain. The role of this CD11a/CD18 binding molecule is not yet known []. VCAM-1 was first described as a cytokine-inducible endothelial adhesion molecule. It can bind to leucocyte integrin VL-4 (very late antigen-4) to recruit leucocytes to sites of inflammation []. The predominant form of VCAM-1 in vivo has an N-terminal extracellular region comprising seven Ig-like domains []. A conserved integrin-binding motif has been identified in domains 1 and 4, variants of which are present in the N-terminal domain of all members of the integrin-binding subgroup of the immunoglobulin superfamily. The structure of a VLA-4-binding fragment comprising the first two domains of VCAM-1 has been determined to 1.8A resolution. The integrin-binding motif is exposed and forms the N-terminal region of the loop between beta-strands C and D of domain 1 []. VCAM-1 domains 1 and 2 are structurally similar to ICAM-1 and ICAM-2 []. This entry represents the N-terminal domain of ICAM proteins such as ICAM-2, ICAM-3 and ICAM-4.; PDB: 3BN3_B 1T0P_B 1ZXQ_A 3TCX_A 1MQ8_A 1Z7Z_I 1IC1_A 1IAM_A.
Probab=37.94  E-value=61  Score=17.66  Aligned_cols=25  Identities=16%  Similarity=0.260  Sum_probs=16.9

Q ss_pred             EEeecCCcEEEEEEecCCCCCceEEE
Q psy7728          31 IEIRENQEITLECLVKNAKPAAKIVW   56 (65)
Q Consensus        31 ~~~~~G~~~~L~C~~~~~~P~~~i~W   56 (65)
                      ..+..|+.+.++|.+.=..| ..+.|
T Consensus        13 ~vV~~G~Sv~VNCStsC~~p-~~~GL   37 (91)
T PF03921_consen   13 PVVPPGGSVWVNCSTSCPQP-EKIGL   37 (91)
T ss_dssp             EEEETTEEEEEEEEESSSS--SEEEE
T ss_pred             cEECCCCCEEEEEcCCCCCC-CcceE
Confidence            36788999999999854444 23444


No 213
>PRK14051 negative regulator GrlR; Provisional
Probab=37.77  E-value=50  Score=18.93  Aligned_cols=16  Identities=25%  Similarity=0.684  Sum_probs=12.7

Q ss_pred             eecCCcEEEEEEecCC
Q psy7728          33 IRENQEITLECLVKNA   48 (65)
Q Consensus        33 ~~~G~~~~L~C~~~~~   48 (65)
                      ...|..++|.|.+++.
T Consensus        80 ~sn~~~~~l~~HV~~N   95 (123)
T PRK14051         80 LSNDNNLTLHCHVRGN   95 (123)
T ss_pred             eeCCCCeEEEEEEcCC
Confidence            4567889999999763


No 214
>KOG1026|consensus
Probab=34.62  E-value=38  Score=25.39  Aligned_cols=31  Identities=23%  Similarity=0.441  Sum_probs=25.9

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .+..|..+++.|+.. +.|.+.+.||.++...
T Consensus       203 ~v~~~~~~~~~c~~~-~~~vp~~~~~~~~~~~  233 (774)
T KOG1026|consen  203 TVEEGSSITLKCSQA-GIPVPCHYWFPNCLAS  233 (774)
T ss_pred             hhcccchheeeeecc-cCCCcceeeecccccc
Confidence            567889999999985 5799999999987543


No 215
>PHA03298 envelope glycoprotein L; Provisional
Probab=34.61  E-value=29  Score=20.61  Aligned_cols=13  Identities=31%  Similarity=0.797  Sum_probs=10.7

Q ss_pred             CCceEEEEECCEE
Q psy7728          50 PAAKIVWYRGNTE   62 (65)
Q Consensus        50 P~~~i~W~~~~~~   62 (65)
                      |+--|-|||+|..
T Consensus        94 ~pEvI~wyksGtA  106 (167)
T PHA03298         94 NPEAIFWYKNGTA  106 (167)
T ss_pred             CceeEEEecCCce
Confidence            6677999999864


No 216
>PHA00008 J DNA packaging protein
Probab=34.17  E-value=36  Score=14.27  Aligned_cols=15  Identities=27%  Similarity=0.758  Sum_probs=9.9

Q ss_pred             CCCceEEEEECCEEc
Q psy7728          49 KPAAKIVWYRGNTEL   63 (65)
Q Consensus        49 ~P~~~i~W~~~~~~l   63 (65)
                      +-...--||.+|.+.
T Consensus        11 r~KGARLWYVGGtQf   25 (26)
T PHA00008         11 RRKGARLWYVGGTQF   25 (26)
T ss_pred             ccCceEEEEeccEEc
Confidence            334455799988764


No 217
>PF07467 BLIP:  Beta-lactamase inhibitor (BLIP);  InterPro: IPR009099 The beta-lactamase-inhibitor protein (BLIP) is produced by Streptomyces species. BLIP acts as a potent inhibitor of beta-lactamases such as TEM-1, which is the most widespread resistance enzyme to penicillin antibiotics. BLIP binds competitively to TEM-1 and makes direct contacts with TEM-1 active site residues. BLIP is able to inhibit a variety of class A beta-lactamases, possibly through flexibility of its two domains. The two tandemly repeated domains of BLIP have an alpha(2)-beta(4) structure, the beta-hairpin loop from domain 1 inserting into the active site of beta-lactamase []. BLIP shows no sequence similarity with BLIP-II, even though both bind to and inhibit TEM-1 [].; PDB: 3GMY_B 3GMX_B 3C4O_B 1XXM_C 1S0W_D 3N4I_B 3C7U_B 2G2W_B 3C7V_D 3E2K_C ....
Probab=33.33  E-value=1.1e+02  Score=19.00  Aligned_cols=30  Identities=7%  Similarity=0.056  Sum_probs=22.7

Q ss_pred             eecCCcEEEEEEec-CCCCCceEEEEECCEE
Q psy7728          33 IRENQEITLECLVK-NAKPAAKIVWYRGNTE   62 (65)
Q Consensus        33 ~~~G~~~~L~C~~~-~~~P~~~i~W~~~~~~   62 (65)
                      ...|-...+.|.+. +..++...-||-||..
T Consensus       145 s~~G~~~~~~C~s~~~~~~~~a~f~fTDGvL  175 (183)
T PF07467_consen  145 STAGWEESYQCTSATGEFYPSAYFHFTDGVL  175 (183)
T ss_dssp             S-TT-EEEEEEESSSSSTSSEEEEEEETTEE
T ss_pred             CCCCceEEEEecccccccCCceEEEEecceE
Confidence            46788889999987 5567777889999864


No 218
>COG3822 ABC-type sugar transport system, auxiliary component [General function prediction only]
Probab=31.36  E-value=1e+02  Score=19.53  Aligned_cols=25  Identities=20%  Similarity=0.377  Sum_probs=16.1

Q ss_pred             CCeEEeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          28 NSKIEIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        28 ~~~~~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      ++.+.+.+|++++|        ||-...||..+
T Consensus       152 g~~lkL~PGesitL--------~Pg~~HsFwae  176 (225)
T COG3822         152 GSQLKLSPGESITL--------PPGLYHSFWAE  176 (225)
T ss_pred             ceeEEECCCCcEec--------CCCceeeeeec
Confidence            34556666766665        56677888753


No 219
>PF00801 PKD:  PKD domain;  InterPro: IPR000601 The PKD (Polycystic Kidney Disease) domain was first identified in the Polycystic Kidney Disease protein, polycystin-1 (PDK1 gene), and contains an Ig-like fold consisting of a beta-sandwich of seven strands in two sheets with a Greek key topology, although some members have additional strands []. Polycystin-1 is a large cell-surface glycoprotein involved in adhesive protein-protein and protein-carbohydrate interactions; however it is not clear if the PKD domain mediates any of these interactions.  PKD domains are also found in other proteins, usually in the extracellular parts of proteins involved in interactions with other proteins. For example, domains with a PKD-type fold are found in archaeal surface layer proteins that protect the cell from extreme environments [], and in the human VPS10 domain-containing receptor SorCS2 [].; PDB: 1B4R_A 2KZW_A 2C4X_A 2C26_A 2Y72_B 3JQU_A 3JS7_B 1WGO_A 1L0Q_A.
Probab=30.29  E-value=70  Score=15.60  Aligned_cols=28  Identities=14%  Similarity=0.271  Sum_probs=19.3

Q ss_pred             EeecCCcEEEEEEecCCCCCceEEEEECC
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      .+..|+.++|+... .......+.|.-++
T Consensus         7 ~~~~g~~v~f~~~~-~~g~~~~y~W~fgd   34 (69)
T PF00801_consen    7 YVPTGQPVTFTASS-SDGSPVTYSWDFGD   34 (69)
T ss_dssp             CEBTTSEEEEEETT-TTSSECEEEEE-SS
T ss_pred             EEcCCCEEEEEEEc-cCCCCeEEEEEECC
Confidence            46778888998876 22345678888776


No 220
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane]
Probab=30.16  E-value=1.5e+02  Score=22.30  Aligned_cols=24  Identities=21%  Similarity=0.515  Sum_probs=17.4

Q ss_pred             EEEEEEecCCCCCceEEEEECCEEcc
Q psy7728          39 ITLECLVKNAKPAAKIVWYRGNTELK   64 (65)
Q Consensus        39 ~~L~C~~~~~~P~~~i~W~~~~~~l~   64 (65)
                      ++|.-.+.++  ...+.||-||.++.
T Consensus       672 ~~l~l~~~g~--~~~~~W~lng~~l~  695 (733)
T COG4953         672 VTLKLIAQGG--RGPIYWFLNGEPLG  695 (733)
T ss_pred             eEEEEEcCCC--cceeEEEeCCcCcc
Confidence            5666665443  57799999998874


No 221
>PRK11240 penicillin-binding protein 1C; Provisional
Probab=28.54  E-value=2.6e+02  Score=21.02  Aligned_cols=24  Identities=25%  Similarity=0.362  Sum_probs=18.5

Q ss_pred             cEEEEEEecCCCCCceEEEEECCEEc
Q psy7728          38 EITLECLVKNAKPAAKIVWYRGNTEL   63 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~~i~W~~~~~~l   63 (65)
                      .+.|.+.+.+  +...+.||.||+.+
T Consensus       713 ~~~l~~~~~~--~~~~~~W~~d~~~~  736 (772)
T PRK11240        713 EATLPLSTSG--GAGRRWWFLNGEPL  736 (772)
T ss_pred             ceeEEEEccC--CCceEEEEECCEEc
Confidence            4667777643  57899999999876


No 222
>TIGR03000 plancto_dom_1 Planctomycetes uncharacterized domain TIGR03000. Domains described by this model are found, so far, only in the Planctomycetes (Pirellula sp. strain 1 and Gemmata obscuriglobus), in up to six proteins per genome, and may be duplicated within a protein. The function is unknown.
Probab=26.83  E-value=1.1e+02  Score=16.22  Aligned_cols=31  Identities=6%  Similarity=0.082  Sum_probs=17.0

Q ss_pred             EEEEEEcCCCccEEEeCCCCCeEEeecCCcEEEE
Q psy7728           9 TRLYQFAPPSSIEIVGHPSNSKIEIRENQEITLE   42 (65)
Q Consensus         9 ~~L~V~~pP~~~~i~~~~~~~~~~~~~G~~~~L~   42 (65)
                      ..+.+.+.++...+...   ..+.+.+|+.++++
T Consensus        44 Y~v~a~~~~dG~~~t~~---~~V~vrAGd~~~v~   74 (75)
T TIGR03000        44 YTVTAEYDRDGRILTRT---RTVVVRAGDTVTVD   74 (75)
T ss_pred             EEEEEEEecCCcEEEEE---EEEEEcCCceEEee
Confidence            44555555555444322   23567777777664


No 223
>PF14041 Lipoprotein_21:  LppP/LprE lipoprotein
Probab=26.72  E-value=1.1e+02  Score=16.19  Aligned_cols=13  Identities=0%  Similarity=0.327  Sum_probs=6.0

Q ss_pred             CCceEEEEECCEE
Q psy7728          50 PAAKIVWYRGNTE   62 (65)
Q Consensus        50 P~~~i~W~~~~~~   62 (65)
                      |+-.+-.|++|+-
T Consensus        24 ~~~~vl~Fh~G~f   36 (89)
T PF14041_consen   24 SPQQVLFFHDGEF   36 (89)
T ss_pred             CCeEEEEEECCEE
Confidence            3444445554443


No 224
>cd02175 GH16_lichenase lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages.  Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica.  This protein is found not only in bacteria but also in anaerobic fungi.  This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
Probab=26.30  E-value=71  Score=19.41  Aligned_cols=13  Identities=23%  Similarity=0.552  Sum_probs=10.3

Q ss_pred             CceEEEEECCEEc
Q psy7728          51 AAKIVWYRGNTEL   63 (65)
Q Consensus        51 ~~~i~W~~~~~~l   63 (65)
                      +..|+||.||+.+
T Consensus       149 ~~~i~~yvDg~~v  161 (212)
T cd02175         149 PDSIRWYVDGELV  161 (212)
T ss_pred             CCEEEEEECCEEE
Confidence            4579999999865


No 225
>TIGR02934 nifT_nitrog probable nitrogen fixation protein FixT. This largely uncharacterized protein family is assigned a role in nitrogen fixation by two criteria. First, its gene occurs, generally, among genes essential for expression of active nitrogenase. Second, its phylogenetic profile closely matches that of nitrogen-fixing bacteria. However, mutational studies in Klebsiella pneumoniae failed to demonstrate any phenotype for deletion or overexpression of the protein.
Probab=25.82  E-value=1.1e+02  Score=15.88  Aligned_cols=20  Identities=25%  Similarity=0.489  Sum_probs=13.5

Q ss_pred             CCcccCCCEEEEEEcCCCccE
Q psy7728           1 MLSRYGPRTRLYQFAPPSSIE   21 (65)
Q Consensus         1 ~~~~~~~~~~L~V~~pP~~~~   21 (65)
                      || |.+..-.|.+++|-++.+
T Consensus         4 mi-R~~~~g~l~~YvpKKDLE   23 (67)
T TIGR02934         4 MI-RRNRAGELSAYVPKKDLE   23 (67)
T ss_pred             EE-EeCCCCCEEEEEECCcch
Confidence            56 555556789998876653


No 226
>COG4118 Phd Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning]
Probab=25.55  E-value=43  Score=17.96  Aligned_cols=21  Identities=29%  Similarity=0.711  Sum_probs=14.5

Q ss_pred             EeecCCcEEEEEEecCCCCCceEE
Q psy7728          32 EIRENQEITLECLVKNAKPAAKIV   55 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~~~i~   55 (65)
                      .+.+|+.++++   ..|+|.|.|.
T Consensus        20 rV~aGEev~IT---~~G~PVAriv   40 (84)
T COG4118          20 RVRAGEEVIIT---KRGRPVARLV   40 (84)
T ss_pred             HHhCCCEEEEe---eCCeEEEEEe
Confidence            46788888875   3567777654


No 227
>PF10430 Ig_Tie2_1:  Tie-2 Ig-like domain 1;  InterPro: IPR018941 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   Angiogenesis is a physiological process whereby new blood vessels are formed from existing ones. It is essential for tissue repair and regeneration during wound healing but also plays important roles in many pathological processes including tumor growth and metastasis [, ]. Angiogenesis is regulated in part by the receptor protein tyrosine kinase Tie2 and its ligands, the angiopoietins. The angiopoietin-binding site is harbord by the N-terminal two immunoglobulin-like (Ig-like) domains of Tie2 []. The angiopoietin-1 receptor contains the Tie-2 Ig-like domain. This protein is a tyrosine-kinase transmembrane receptor for angiopoietin 1. It probably regulates endothelial cell proliferation, differentiation and guides the proper patterning of endothelial cells during blood vessel formation. Tie2 contains not two but three immunoglobulin domains. They fold together with the three epidermal growth factor domains to form a compact, arrowhead-shaped structure [].; GO: 0004714 transmembrane receptor protein tyrosine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation, 0007169 transmembrane receptor protein tyrosine kinase signaling pathway, 0005887 integral to plasma membrane; PDB: 2GY7_B 2GY5_A.
Probab=25.15  E-value=1.3e+02  Score=16.67  Aligned_cols=26  Identities=23%  Similarity=0.376  Sum_probs=12.0

Q ss_pred             eecCCcEEEEEEecCCCCCceEEEEE
Q psy7728          33 IRENQEITLECLVKNAKPAAKIVWYR   58 (65)
Q Consensus        33 ~~~G~~~~L~C~~~~~~P~~~i~W~~   58 (65)
                      +....+..|+|.+.+=.+...|+--|
T Consensus        12 lvs~~etSL~Ci~s~W~s~esitigr   37 (96)
T PF10430_consen   12 LVSNSETSLTCIASDWSSHESITIGR   37 (96)
T ss_dssp             EE-SS-EEEEEEE-SS--SS--EEEE
T ss_pred             ccccCceeEEEEecCCcCCCcEEecc
Confidence            44445558888887656665565444


No 228
>PHA03042 CD47-like protein; Provisional
Probab=24.65  E-value=1.2e+02  Score=20.11  Aligned_cols=28  Identities=21%  Similarity=0.347  Sum_probs=20.6

Q ss_pred             ecCCcEEEEEEecCCCC------CceEEEEECCEEc
Q psy7728          34 RENQEITLECLVKNAKP------AAKIVWYRGNTEL   63 (65)
Q Consensus        34 ~~G~~~~L~C~~~~~~P------~~~i~W~~~~~~l   63 (65)
                      .=++++.+.|.+.  ++      .-.+.|..||+.+
T Consensus        29 ~CN~TV~IpC~v~--n~~~~ni~~~~V~Wkf~~~~I   62 (286)
T PHA03042         29 TCNKTIVIVCNLN--LLIYYNISNIHINWKFNNKVI   62 (286)
T ss_pred             ecCceEEEEeecC--ChhhcCccceEEEEEeCCeeE
Confidence            4468899999984  34      3349999998764


No 229
>PF12158 DUF3592:  Protein of unknown function (DUF3592);  InterPro: IPR021994  This family of proteins is functionally uncharacterised.This family of proteins is found in bacteria, archaea, eukaryotes and viruses. Proteins in this family are typically between 150 and 242 amino acids in length. 
Probab=24.58  E-value=62  Score=17.99  Aligned_cols=16  Identities=13%  Similarity=0.092  Sum_probs=11.6

Q ss_pred             CCEEEEEEcCCCccEE
Q psy7728           7 PRTRLYQFAPPSSIEI   22 (65)
Q Consensus         7 ~~~~L~V~~pP~~~~i   22 (65)
                      ..-.++|++.|++|.-
T Consensus        94 ~G~~V~V~Y~P~~P~~  109 (148)
T PF12158_consen   94 IGDTVTVYYNPNNPEE  109 (148)
T ss_pred             CcCEEEEEECCcCCCe
Confidence            3457888888888753


No 230
>PF09186 DUF1949:  Domain of unknown function (DUF1949);  InterPro: IPR015269 Members of this entry are a set of functionally uncharacterised hypothetical bacterial proteins. They adopt a ferredoxin-like fold, with a beta-alpha-beta-beta-alpha-beta arrangement [].   This entry contains the protein Impact, which is a translational regulator that ensures constant high levels of translation under amino acid starvation. It acts by interacting with Gcn1/Gcn1L1, thereby preventing activation of Gcn2 protein kinases (EIF2AK1 to 4) and subsequent down-regulation of protein synthesis. It is evolutionary conserved from eukaryotes to archaea []. ; PDB: 2CVE_A 1VI7_A.
Probab=24.12  E-value=75  Score=14.64  Aligned_cols=16  Identities=19%  Similarity=0.233  Sum_probs=11.9

Q ss_pred             ccCCCEEEEEEcCCCc
Q psy7728           4 RYGPRTRLYQFAPPSS   19 (65)
Q Consensus         4 ~~~~~~~L~V~~pP~~   19 (65)
                      .|+..+.++|.++++.
T Consensus        26 ~y~~~V~~~v~v~~~~   41 (56)
T PF09186_consen   26 DYTDDVTLTVAVPEEE   41 (56)
T ss_dssp             EECTTEEEEEEEECCC
T ss_pred             eecceEEEEEEECHHH
Confidence            4677788888887754


No 231
>PRK13244 protease inhibitor protein; Provisional
Probab=23.68  E-value=1.1e+02  Score=18.33  Aligned_cols=10  Identities=30%  Similarity=0.594  Sum_probs=7.5

Q ss_pred             cEEEEEEecC
Q psy7728          38 EITLECLVKN   47 (65)
Q Consensus        38 ~~~L~C~~~~   47 (65)
                      .++|+|.-.+
T Consensus        61 avtLtC~P~~   70 (145)
T PRK13244         61 AVTLTCAPTA   70 (145)
T ss_pred             EEEEEECCCC
Confidence            5789998644


No 232
>PF15531 Toxin_51:  Putative toxin 51
Probab=23.14  E-value=52  Score=19.23  Aligned_cols=15  Identities=13%  Similarity=0.293  Sum_probs=11.0

Q ss_pred             CCCCceEEEEECCEE
Q psy7728          48 AKPAAKIVWYRGNTE   62 (65)
Q Consensus        48 ~~P~~~i~W~~~~~~   62 (65)
                      .++=-+|+||.+++.
T Consensus       113 ~R~WdSI~fY~~~~~  127 (128)
T PF15531_consen  113 DRSWDSIKFYMNGKK  127 (128)
T ss_pred             cCCcceeEEEecccc
Confidence            356678999988764


No 233
>cd00146 PKD polycystic kidney disease I (PKD) domain; similar to other cell-surface modules, with an IG-like fold; domain probably functions as a ligand binding site in protein-protein or protein-carbohydrate interactions; a single instance of the repeat is presented here. The domain is also found in microbial collagenases and chitinases.
Probab=22.98  E-value=1.1e+02  Score=15.09  Aligned_cols=25  Identities=12%  Similarity=0.248  Sum_probs=17.6

Q ss_pred             CCcEEEEEEecCCCCCceEEEEECC
Q psy7728          36 NQEITLECLVKNAKPAAKIVWYRGN   60 (65)
Q Consensus        36 G~~~~L~C~~~~~~P~~~i~W~~~~   60 (65)
                      |..+.+......+.....+.|..++
T Consensus        14 ~~~v~~~~~~~~~~~~~~~~W~fgd   38 (81)
T cd00146          14 GASVTFSASDSSGGSIVSYKWDFGD   38 (81)
T ss_pred             CccEEEEEEeCCCCCEEEEEEEeCC
Confidence            7778888777554345678887765


No 234
>PF00722 Glyco_hydro_16:  Glycosyl hydrolases family 16;  InterPro: IPR000757 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 16 GH16 from CAZY comprises enzymes with a number of known activities; lichenase (3.2.1.73 from EC); xyloglucan xyloglucosyltransferase (2.4.1.207 from EC); agarase (3.2.1.81 from EC); kappa-carrageenase (3.2.1.83 from EC); endo-beta-1,3-glucanase (3.2.1.39 from EC); endo-beta-1,3-1,4-glucanase (3.2.1.6 from EC); endo-beta-galactosidase (3.2.1.103 from EC).; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3DGT_A 2CL2_A 2WLQ_A 2WNE_A 2W39_A 2W52_A 3ILN_A 4DFS_A 1UMZ_A 1UN1_B ....
Probab=22.88  E-value=95  Score=18.02  Aligned_cols=13  Identities=15%  Similarity=0.342  Sum_probs=10.3

Q ss_pred             CceEEEEECCEEc
Q psy7728          51 AAKIVWYRGNTEL   63 (65)
Q Consensus        51 ~~~i~W~~~~~~l   63 (65)
                      +..|.||.||+.+
T Consensus       129 ~~~i~fyiDg~~~  141 (185)
T PF00722_consen  129 PDRIRFYIDGKLV  141 (185)
T ss_dssp             TTEEEEEETTEEE
T ss_pred             cCeEEEEECCEEE
Confidence            4588999999875


No 235
>PF01200 Ribosomal_S28e:  Ribosomal protein S28e;  InterPro: IPR000289 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  A number of eukaryotic and archaebacterial ribosomal proteins can be grouped on the basis of sequence similarities. Examples are:  Mammalian S28 [] Plant S28 [] Fungi S33 [] Archaebacterial S28e.   These proteins have from 64 to 78 amino acids and a highly conserved C-terminal region.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZ6_Y 2XZN_1 2XZM_1 1NY4_A 1NE3_A 3U5C_c 3U5G_c 3O30_R 3O2Z_R 3IZB_Y.
Probab=22.84  E-value=1e+02  Score=16.08  Aligned_cols=10  Identities=40%  Similarity=0.627  Sum_probs=6.1

Q ss_pred             EeecCCcEEE
Q psy7728          32 EIRENQEITL   41 (65)
Q Consensus        32 ~~~~G~~~~L   41 (65)
                      ++.+||-+.|
T Consensus        49 PVr~GDil~L   58 (69)
T PF01200_consen   49 PVREGDILTL   58 (69)
T ss_dssp             TTSTT-EEEE
T ss_pred             CcccCcEEEE
Confidence            5677777666


No 236
>cd08023 GH16_laminarinase_like Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
Probab=22.68  E-value=92  Score=19.04  Aligned_cols=13  Identities=23%  Similarity=0.371  Sum_probs=10.3

Q ss_pred             CceEEEEECCEEc
Q psy7728          51 AAKIVWYRGNTEL   63 (65)
Q Consensus        51 ~~~i~W~~~~~~l   63 (65)
                      +..|+||.||+++
T Consensus       169 p~~i~~yvDG~~v  181 (235)
T cd08023         169 PDKITFYVDGKLY  181 (235)
T ss_pred             CCEEEEEECCEEE
Confidence            3579999999875


No 237
>PF10856 DUF2678:  Protein of unknown function (DUF2678);  InterPro: IPR022564  This family of proteins has no known function. 
Probab=22.38  E-value=34  Score=19.73  Aligned_cols=9  Identities=44%  Similarity=1.040  Sum_probs=7.3

Q ss_pred             eEEEEECCE
Q psy7728          53 KIVWYRGNT   61 (65)
Q Consensus        53 ~i~W~~~~~   61 (65)
                      -|.|||+|.
T Consensus        78 LI~WYR~gd   86 (118)
T PF10856_consen   78 LIFWYRQGD   86 (118)
T ss_pred             heeehhcCC
Confidence            589999875


No 238
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=22.23  E-value=2e+02  Score=19.67  Aligned_cols=28  Identities=14%  Similarity=0.394  Sum_probs=21.2

Q ss_pred             CCeEEeecCCcEEEEEEecCCCCC-ceEEEE
Q psy7728          28 NSKIEIRENQEITLECLVKNAKPA-AKIVWY   57 (65)
Q Consensus        28 ~~~~~~~~G~~~~L~C~~~~~~P~-~~i~W~   57 (65)
                      +..+.+.+|+.++|+|.-.  .+. ..+.|.
T Consensus        63 gP~i~~~~Gd~v~l~~~N~--l~~~t~vh~H   91 (451)
T COG2132          63 GPTIRVKKGDTVTLDLTNR--LLVDTSVHWH   91 (451)
T ss_pred             CceEEEecCCEEEEEEEeC--CCCCceEEEc
Confidence            3457899999999999753  355 888885


No 239
>cd00413 Glyco_hydrolase_16 glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
Probab=22.14  E-value=96  Score=18.36  Aligned_cols=12  Identities=17%  Similarity=0.407  Sum_probs=10.0

Q ss_pred             ceEEEEECCEEc
Q psy7728          52 AKIVWYRGNTEL   63 (65)
Q Consensus        52 ~~i~W~~~~~~l   63 (65)
                      ..|+||.||+++
T Consensus       154 ~~i~~yvDG~~~  165 (210)
T cd00413         154 GEITFYVDGVLV  165 (210)
T ss_pred             CEEEEEECCEEE
Confidence            689999999875


No 240
>PF03712 Cu2_monoox_C:  Copper type II ascorbate-dependent monooxygenase, C-terminal domain; PDB: 1YI9_A 3MLL_A 1SDW_A 3MID_A 1YIP_A 3PHM_A 3MIC_A 3MIB_A 1OPM_A 3MIG_A ....
Probab=22.06  E-value=1.6e+02  Score=17.25  Aligned_cols=19  Identities=21%  Similarity=0.450  Sum_probs=13.1

Q ss_pred             eEEeecCCcEEEEEEecCC
Q psy7728          30 KIEIRENQEITLECLVKNA   48 (65)
Q Consensus        30 ~~~~~~G~~~~L~C~~~~~   48 (65)
                      .+.+..|+.+..+|.=..+
T Consensus        86 ~v~i~~GD~l~~~C~Ydns  104 (156)
T PF03712_consen   86 PVTIPPGDTLRTECTYDNS  104 (156)
T ss_dssp             EEEE-TT-EEEEEEEEE-T
T ss_pred             ceEecCCCEEEEEEEEeCC
Confidence            3689999999999986553


No 241
>cd02183 GH16_fungal_CRH1_transglycosylase glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
Probab=21.29  E-value=1e+02  Score=18.99  Aligned_cols=13  Identities=23%  Similarity=0.670  Sum_probs=10.1

Q ss_pred             CceEEEEECCEEc
Q psy7728          51 AAKIVWYRGNTEL   63 (65)
Q Consensus        51 ~~~i~W~~~~~~l   63 (65)
                      +-.|+||.||+.+
T Consensus       126 pd~I~~yVDG~~v  138 (203)
T cd02183         126 KDRITWYIDGKVV  138 (203)
T ss_pred             cCEEEEEECCEEE
Confidence            4578999998865


No 242
>PF11515 Cul7:  Mouse development and cellular proliferation protein Cullin-7;  InterPro: IPR021097 The CPH domain is found in the Cullin-7, PARC and HERC2 proteins, which are all components of known or predicted E3-ubiquitin ligases. The CPH domain is a protein-protein interaction module that binds the teramerisation domain of the tumour suppressor protein p53 []. Structurally it forms a beta-barrel fold similar to the SH3, Tudor and KOW and domains. Unlike the SH3 and Tudor domains, which bind to small peptides, the CPH domain appears to bind to an extended surface on p53.; PDB: 2JUF_A 2JNG_A.
Probab=21.20  E-value=1.1e+02  Score=16.39  Aligned_cols=31  Identities=13%  Similarity=0.188  Sum_probs=20.6

Q ss_pred             EeecCCcEEEEEEecCCCCC--ceEEEEECCEE
Q psy7728          32 EIRENQEITLECLVKNAKPA--AKIVWYRGNTE   62 (65)
Q Consensus        32 ~~~~G~~~~L~C~~~~~~P~--~~i~W~~~~~~   62 (65)
                      .+.+|+.-.......++.|+  .++.|-.-|..
T Consensus        32 eV~~GD~G~V~k~~~dg~~~lnvqv~W~~~G~t   64 (78)
T PF11515_consen   32 EVRAGDEGEVFKQDRDGLHDLNVQVDWQSKGRT   64 (78)
T ss_dssp             TB-TT-EEE-EEEE-TTSSE--EEEEETTTTEE
T ss_pred             cccccccceeEeeccCCCCCcceEEEeeecCce
Confidence            36789998877777788888  88888766653


No 243
>PF01681 C6:  C6 domain;  InterPro: IPR002601 This domain of unknown function is found at the C terminus in a number of Caenorhabditis elegans and Caenorhabditis briggsae proteins. It may be an extracellular domain. Most copies of the C6 domain contain six conserved cysteine residues. However some copies of the domain are missing cysteine residues 1 and 3 suggesting that these form a disulphide bridge. In Q19522 from SWISSPROT there are 18 copies of the domain.
Probab=20.70  E-value=1.5e+02  Score=15.58  Aligned_cols=20  Identities=25%  Similarity=0.478  Sum_probs=12.7

Q ss_pred             cEEEEEEecCCCCCceEEEEE-CCEEcc
Q psy7728          38 EITLECLVKNAKPAAKIVWYR-GNTELK   64 (65)
Q Consensus        38 ~~~L~C~~~~~~P~~~i~W~~-~~~~l~   64 (65)
                      .++|+|.+ ++      .|.. .++.+.
T Consensus        68 t~~ltCn~-~g------~W~y~~g~~It   88 (92)
T PF01681_consen   68 TITLTCNA-DG------QWVYTYGRVIT   88 (92)
T ss_pred             EEEEEecC-CC------EEEECCCEEEE
Confidence            46788843 33      5888 777653


No 244
>cd04457 S1_S28E S1_S28E: S28E, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. S28E protein is a component of the 30S ribosomal subunit. S28E is highly conserved among archaea and eukaryotes. S28E may control precursor RNA splicing and turnover in mRNA maturation process but its function in the ribosome is largely unknown. The structure contains an OB-fold found in many oligosaccharide and nucleic acid binding proteins. This implies that S28E might be involved in protein synthesis.
Probab=20.46  E-value=1.4e+02  Score=15.17  Aligned_cols=10  Identities=30%  Similarity=0.524  Sum_probs=7.8

Q ss_pred             EeecCCcEEE
Q psy7728          32 EIRENQEITL   41 (65)
Q Consensus        32 ~~~~G~~~~L   41 (65)
                      ++..||-+.|
T Consensus        40 PVr~GDIl~L   49 (60)
T cd04457          40 PVREGDILML   49 (60)
T ss_pred             CcccCcEEee
Confidence            6788888776


No 245
>PRK10380 hypothetical protein; Provisional
Probab=20.40  E-value=1.4e+02  Score=15.16  Aligned_cols=13  Identities=31%  Similarity=1.032  Sum_probs=9.9

Q ss_pred             cCCCCCceEEEEE
Q psy7728          46 KNAKPAAKIVWYR   58 (65)
Q Consensus        46 ~~~~P~~~i~W~~   58 (65)
                      ..|.|.-.++||.
T Consensus        17 ekG~~g~~vtwye   29 (63)
T PRK10380         17 EKGKPGQTVTWYQ   29 (63)
T ss_pred             ecCCCCceEEEEE
Confidence            4567888899985


Done!