Diaphorina citri psyllid: psy7743

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MAAYLSELYKCQVVEQNLKLKNRYSRNQRSSPYDIGQSKHHARELRQKILQGVDQMSLFSHEECLVLERNIDEVSSLAEQGQYKPCTVDRAPLRNKYFFGEGYTYGSQLVRKGLGNERLYPEGEVDPRLSLGL
cHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccc
***YLSELYKCQVVEQNL*****************************KILQGVDQMSLFSHEECLVLERNIDEVSSLAEQGQYKPCTVDRAPLRNKYFFGEGYTYGSQLVRKGLGN******GEVDPRLSLGL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAYLSELYKCQVVEQNLKLKNRYSRNQRSSPYDIGQSKHHARELRQKILQGVDQMSLFSHEECLVLERNIDEVSSLAEQGQYKPCTVDRAPLRNKYFFGEGYTYGSQLVRKGLGNERLYPEGEVDPRLSLGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA demethylase ALKBH5 Dioxygenase that demethylates RNA by oxidative demethylation: specifically demethylates N(6)-methyladenosine (m(6)A) RNA, the most prevalent internal modification of messenger RNA (mRNA) in higher eukaryotes. Requires molecular oxygen, alpha-ketoglutarate and iron.confidentQ08BA6
RNA demethylase ALKBH5 Dioxygenase that demethylates RNA by oxidative demethylation: specifically demethylates N(6)-methyladenosine (m(6)A) RNA, the most prevalent internal modification of messenger RNA (mRNA) in higher eukaryotes. Requires molecular oxygen, alpha-ketoglutarate and iron. Demethylation of m(6)A mRNA affects mRNA processing and export and is required for spermatogenesis.confidentE1BH29
RNA demethylase ALKBH5 Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.confidentQ3TSG4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035553 [BP]oxidative single-stranded RNA demethylationprobableGO:0035513, GO:0009451, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044710, GO:0044260, GO:0071704, GO:0016070, GO:0044238, GO:0009987, GO:0006725, GO:0043412, GO:0008150, GO:0008152, GO:0055114, GO:0046483, GO:0070988, GO:0070989, GO:0044237, GO:0043170
GO:0016607 [CC]nuclear speckprobableGO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0016706 [MF]oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donorsprobableGO:0003824, GO:0016705, GO:0003674, GO:0051213, GO:0016491
GO:0035515 [MF]oxidative RNA demethylase activityprobableGO:0032451, GO:0003824, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted