BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy7793
(316 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3CH0|A Chain A, Crystal Structure Of Glycerophosphoryl Diester
Phosphodiesterase (Yp_677622.1) From Cytophaga
Hutchinsonii Atcc 33406 At 1.50 A Resolution
Length = 272
Score = 29.3 bits (64), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
Query: 76 IKDPFRPVARWKGKLEKRVQYMIEVLAQVRKDNFKDFPDVIEDLDLVPEEDKFTHL 131
+K FR + KL ++QY E+ + V DN D P++ DLV E K H+
Sbjct: 113 VKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNI-DHPNIALFCDLVVAEIKKAHI 167
>pdb|3KAJ|A Chain A, Apoenzyme Structure Of Homoglutathione Synthetase From
Glycine Max In Open Conformation
pdb|3KAJ|B Chain B, Apoenzyme Structure Of Homoglutathione Synthetase From
Glycine Max In Open Conformation
pdb|3KAK|A Chain A, Structure Of Homoglutathione Synthetase From Glycine Max
In Open Conformation With Gamma-Glutamyl-Cysteine Bound.
pdb|3KAK|B Chain B, Structure Of Homoglutathione Synthetase From Glycine Max
In Open Conformation With Gamma-Glutamyl-Cysteine Bound.
pdb|3KAL|A Chain A, Structure Of Homoglutathione Synthetase From Glycine Max
In Closed Conformation With Homoglutathione, Adp, A
Sulfate Ion, And Three Magnesium Ions Bound
pdb|3KAL|B Chain B, Structure Of Homoglutathione Synthetase From Glycine Max
In Closed Conformation With Homoglutathione, Adp, A
Sulfate Ion, And Three Magnesium Ions Bound
Length = 499
Score = 28.1 bits (61), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 8/45 (17%)
Query: 222 HRLDINKLRNVAKFFAHQLFTDAIGWHVLSCIHLNEEETTSSGRI 266
HR+D L+N+ DA+ W L+C+ + ++ SGR+
Sbjct: 32 HRIDQKLLQNI--------VYDALVWSTLNCLLVGDKSVQRSGRV 68
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.140 0.412
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,754,532
Number of Sequences: 62578
Number of extensions: 351253
Number of successful extensions: 1160
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 1159
Number of HSP's gapped (non-prelim): 10
length of query: 316
length of database: 14,973,337
effective HSP length: 99
effective length of query: 217
effective length of database: 8,778,115
effective search space: 1904850955
effective search space used: 1904850955
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 51 (24.3 bits)