BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy7793
         (316 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CH0|A Chain A, Crystal Structure Of Glycerophosphoryl Diester
           Phosphodiesterase (Yp_677622.1) From Cytophaga
           Hutchinsonii Atcc 33406 At 1.50 A Resolution
          Length = 272

 Score = 29.3 bits (64), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 76  IKDPFRPVARWKGKLEKRVQYMIEVLAQVRKDNFKDFPDVIEDLDLVPEEDKFTHL 131
           +K  FR +     KL  ++QY  E+ + V  DN  D P++    DLV  E K  H+
Sbjct: 113 VKPLFRELIETAEKLSAKIQYNGEIKSTVEGDNI-DHPNIALFCDLVVAEIKKAHI 167


>pdb|3KAJ|A Chain A, Apoenzyme Structure Of Homoglutathione Synthetase From
           Glycine Max In Open Conformation
 pdb|3KAJ|B Chain B, Apoenzyme Structure Of Homoglutathione Synthetase From
           Glycine Max In Open Conformation
 pdb|3KAK|A Chain A, Structure Of Homoglutathione Synthetase From Glycine Max
           In Open Conformation With Gamma-Glutamyl-Cysteine Bound.
 pdb|3KAK|B Chain B, Structure Of Homoglutathione Synthetase From Glycine Max
           In Open Conformation With Gamma-Glutamyl-Cysteine Bound.
 pdb|3KAL|A Chain A, Structure Of Homoglutathione Synthetase From Glycine Max
           In Closed Conformation With Homoglutathione, Adp, A
           Sulfate Ion, And Three Magnesium Ions Bound
 pdb|3KAL|B Chain B, Structure Of Homoglutathione Synthetase From Glycine Max
           In Closed Conformation With Homoglutathione, Adp, A
           Sulfate Ion, And Three Magnesium Ions Bound
          Length = 499

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 8/45 (17%)

Query: 222 HRLDINKLRNVAKFFAHQLFTDAIGWHVLSCIHLNEEETTSSGRI 266
           HR+D   L+N+          DA+ W  L+C+ + ++    SGR+
Sbjct: 32  HRIDQKLLQNI--------VYDALVWSTLNCLLVGDKSVQRSGRV 68


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,754,532
Number of Sequences: 62578
Number of extensions: 351253
Number of successful extensions: 1160
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 1159
Number of HSP's gapped (non-prelim): 10
length of query: 316
length of database: 14,973,337
effective HSP length: 99
effective length of query: 217
effective length of database: 8,778,115
effective search space: 1904850955
effective search space used: 1904850955
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 51 (24.3 bits)