Diaphorina citri psyllid: psy7847

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MLGLRPGPISSWIKKTCEDENDFRLFCGDLGNDVTDELLIRTFSKYPSFLKAKVVRDKRTNKTKGFGFVSFKDPQDFIRANKEMNDDFRLFCGDLGNDVTDELLIRTFSKYPSFLKAKVVRDKRTNKTKGFGFVSFKDPQDFIRANKEMNEFPHLFVGDLKTRSSITLKG
cccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEECccHHHHHHHHHHHcccccEEEccccccccHHHHHHHHccccccEEEEEEECccccccccEEEEEEccHHHHHHHHHHHcccccEEEccccccccccccc
*******************ENDFRLFCGDLGNDVTDELLIRTFSKYPSFLKAKVVRDKRTNKTKGFGFVSFKDPQDFIRANKEMNDDFRLFCGDLGNDVTDELLIRTFSKYPSFLKAKVVRDKRTNKTKGFGFVSFKDPQDFIRANKEMNEFPHLFVGDLKTRS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGLRPGPISSWIKKTCEDENDFRLFCGDLGNDVTDELLIRTFSKYPSFLKAKVVRDKRTNKTKGFGFVSFKDPQDFIRANKEMNDDFRLFCGDLGNDVTDELLIRTFSKYPSFLKAKVVRDKRTNKTKGFGFVSFKDPQDFIRANKEMNEFPHLFVGDLKTRSSITLKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA-binding protein 42 Binds (via the RRM domain) to the 3'-untranslated region (UTR) of CDKN1A mRNA.confidentQ0P5L0
RNA-binding protein 42 Binds (via the RRM domain) to the 3'-untranslated region (UTR) of CDKN1A mRNA.confidentQ9BTD8
RNA-binding protein 42 Binds (via the RRM domain) to the 3'-untranslated region (UTR) of CDKN1A mRNA.confidentQ91V81

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0008143 [MF]poly(A) RNA bindingprobableGO:0005488, GO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0003729
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L3K, chain A
Confidence level:very confident
Coverage over the Query: 17-168
View the alignment between query and template
View the model in PyMOL