Diaphorina citri psyllid: psy7868


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MGRYYIQHKVYISTQRNKKEEKNDFHGEDLIVTPFAQILASLRSVRNNFLSLTNVPTAKILCLTAYNEGIYPQPLCKLLNINPVWSAVPDDAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLKVSQHNQHSH
cccEEEEEEEEEEECccccccccccccccCEEccHHHHHHHHHHHHHHHHHHcccccccHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccc
**RYYIQHKVYIS***********FHGEDLIVTPFAQILASLRSVRNNFLSLTNVP****************************WSAVPDDAYLKLSIETMEELDWCLDQLETIQTH*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRYYIQHKVYISTQRNKKEEKNDFHGEDLIVTPFAQILASLRSVRNNFLSLTNVPTAKILCLTAYNEGIYPQPLCKLLNINPVWSAVPDDAYLKLSIETMEELDWCLDQLETIQTHRSVSDMASLKVSQHNQHSH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
cAMP-specific 3',5'-cyclic phosphodiesterase 4D Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.confidentP14270
cAMP-specific 3',5'-cyclic phosphodiesterase 4D Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.confidentQ08499
cAMP-specific 3',5'-cyclic phosphodiesterase Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes (By similarity). Vital for female fertility. Required for learning/memory.confidentP12252

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008277 [BP]regulation of G-protein coupled receptor protein signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0061028 [BP]establishment of endothelial barrierprobableGO:0032502, GO:0044699, GO:0030154, GO:0003158, GO:0060429, GO:0048468, GO:0009888, GO:0044767, GO:0044763, GO:0048869, GO:0030855, GO:0001885, GO:0008150, GO:0009987, GO:0045446, GO:0002064, GO:0048856
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010738 [BP]regulation of protein kinase A signaling cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004115 [MF]3',5'-cyclic-AMP phosphodiesterase activityprobableGO:0016787, GO:0008081, GO:0004114, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004112
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0030016 [CC]myofibrilprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0050877 [BP]neurological system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0030552 [MF]cAMP bindingprobableGO:0043168, GO:0030551, GO:0030554, GO:0097159, GO:0003674, GO:0043167, GO:0036094, GO:0032559, GO:0032553, GO:0032555, GO:0017076, GO:0000166, GO:1901363, GO:1901265, GO:0005488
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0050900 [BP]leukocyte migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0002376, GO:0051674, GO:0008150, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0045202 [CC]synapseprobableGO:0005575
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043623 [BP]cellular protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0071840
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted