Diaphorina citri psyllid: psy7875


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MCARQLYLIRSTCQDYLMLQVESFDPQLGGKYRGLFQAVTTIVKEEGVRALWKGHVPAQSLSITYGCVQFATFELMSQYISAGTPTILTLVSSDFLCGILGSTIATMYSGTLNAFYLICRDKPTILFRGLTPTLLQVAPQGGIQFTVYNILSHLFSLSDYLSSSSAASNPDPQTERRVLSPLGSLMAGSVAGLTSKVAIYPLDLAKKRIQVQGFDDARRDFGKETESDLRKPSLGNTAAFDSRRPSVADTSEGSRSQTPHSDTRSYRERLKDRIQTVKP
cccccHHHHHHHcccEEEEEEEEcccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccEEEccHHcccccccccccccccHHHHHHHHHHHccccc
MCARQLYLIRSTCQDYLMLQVESFDPQLGGKYRGLFQAVTTIVKEEGVRALWKGHVPAQSLSITYGCVQFATFELMSQYISAGTPTILTLVSSDFLCGILGSTIATMYSGTLNAFYLICRDKPTILFRGLTPTLLQVAPQGGIQFTVYNILSHLFSLSDYLSSSS**********RRVLSPLGSLMAGSVAGLTSKVAIYPLDLAKKRIQVQGF*****DFGKETESDLRKPSLGNTAAFDSRRPSVADTSEGSRSQTPHSDTRSYRERLKDRIQ****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCARQLYLIRSTCQDYLMLQVESFDPQLGGKYRGLFQAVTTIVKEEGVRALWKGHVPAQSLSITYGCVQFATFELMSQYISAGTPTILTLVSSDFLCGILGSTIATMYSGTLNAFYLICRDKPTILFRGLTPTLLQVAPQGGIQFTVYNILSHLFSLSDYLSSSSAASNPDPQTERRVLSPLGSLMAGSVAGLTSKVAIYPLDLAKKRIQVQGFDDARRDFGKETESDLRKPSLGNTAAFDSRRPSVADTSEGSRSQTPHSDTRSYRERLKDRIQTVKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial thiamine pyrophosphate carrier Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.confidentQ9DAM5
Mitochondrial thiamine pyrophosphate carrier Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria.confidentQ29RM1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0015619 [MF]thiamine pyrophosphate-transporting ATPase activityprobableGO:0003674, GO:0016887, GO:0016820, GO:0042626, GO:1901682, GO:0051183, GO:0042623, GO:1901474, GO:0045118, GO:0015399, GO:0022892, GO:0022804, GO:0016787, GO:0005215, GO:0017111, GO:0003824, GO:0015234, GO:0022891, GO:0016818, GO:0090422, GO:0043492, GO:0016817, GO:0090482, GO:0022857, GO:0090484, GO:0016462, GO:0015405
GO:0030974 [BP]thiamine pyrophosphate transportprobableGO:0015893, GO:0042221, GO:0006810, GO:0051181, GO:0044765, GO:0006812, GO:0006811, GO:0071702, GO:0072348, GO:0015711, GO:0051179, GO:0071705, GO:0006820, GO:0015695, GO:0008150, GO:0015748, GO:0045117, GO:0042493, GO:0051234, GO:0050896, GO:0044699
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 2-159,178-263
View the alignment between query and template
View the model in PyMOL