Diaphorina citri psyllid: psy787


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MGDKDDEVDGDMISIFHRVDSDQVIYDNKTIKVKMIGKYVMGDLLGEGSYGKVKEMLDSETLCRRAVKIFKKKKLQRIPNGEINVDREIRLLKMLQHRNVIGLVDVFVNDKKQKMYLIMEYCVGGLQDMLDSTPYKKFPIWQAHGYFLQLLDGLEYLHSQGIIHKDIKPGNLLLTLDGTLKISDFGVAESLDMFLHDDTITTSQGSPVFQAPEIANGLPEISGYKVDIWSSGVTL
cccccccccccccccccccccccccccccccccEEEccEEEEEEECccccEEEEEEEEcccccEEEEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEEEEcccccEEEEEEEEcccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEECcccccccccccccccCECcccccccccccHHcccccccccccccEEEccEEc
*********************************KMIGKYVMGDLLGEGSYGKVKEMLDSETLCRRAVKIFKKKKLQRIPNGEINVDREIRLLKMLQHRNVIGLVDVFVNDKKQKMYLIMEYCVGGLQDMLDSTPYKKFPIWQAHGYFLQLLDGLEYLHSQGIIHKDIKPGNLLLTLDGTLKISDFGVAESLDMFLHDDTITTSQGSPVFQAPEIANGLPEISGYKVDIWSSGVTL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDKDDEVDGDMISIFHRVDSDQVIYDNKTIKVKMIGKYVMGDLLGEGSYGKVKEMLDSETLCRRAVKIFKKKKLQRIPNGEINVDREIRLLKMLQHRNVIGLVDVFVNDKKQKMYLIMEYCVGGLQDMLDSTPYKKFPIWQAHGYFLQLLDGLEYLHSQGIIHKDIKPGNLLLTLDGTLKISDFGVAESLDMFLHDDTITTSQGSPVFQAPEIANGLPEISGYKVDIWSSGVTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase STK11 Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, leading to promote their activity: phosphorylates PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3 and SNRK but not MELK. Also phosphorylates non-AMPK family proteins such as STRADA and possibly p53/TP53. Acts as a key upstream regulator of AMPK by mediating phosphorylation and activation of AMPK catalytic subunits PRKAA1 and PRKAA2: it thereby regulates inhibition of signaling pathways that promote cell growth and proliferation when energy levels are low, glucose homeostasis in liver, activation of autophagy when cells undergo nutrient deprivation, B-cell differentiation in the germinal center in response to DNA damage. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton. Required for cortical neurons polarization by mediating phosphorylation and activation of BRSK1 and BRSK2, leading to axon initiation and specification. Involved in DNA damage response: interacts with p53/TP53 and recruited to the CDKN1A/WAF1 promoter to participate in transcription activation. Able to phosphorylate p53/TP53; the relevance of such result in vivo is however unclear. Also acts as a mediator p53/TP53-dependent apoptosis via interaction with p53/TP53: translocates to mitochondrion during apoptosis and regulates p53/TP53-dependent apoptosis pathways.confidentQ9WTK7
Serine/threonine-protein kinase STK11 Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, leading to promote their activity.confidentQ0GGW5
Serine/threonine-protein kinase STK11 Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, leading to promote their activity: phosphorylates PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3 and SNRK but not MELK. Also phosphorylates non-AMPK family proteins such as STRADA and possibly p53/TP53. Acts as a key upstream regulator of AMPK by mediating phosphorylation and activation of AMPK catalytic subunits PRKAA1 and PRKAA2: it thereby regulates inhibition of signaling pathways that promote cell growth and proliferation when energy levels are low, glucose homeostasis in liver, activation of autophagy when cells undergo nutrient deprivation, B-cell differentiation in the germinal center in response to DNA damage. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton. Required for cortical neurons polarization by mediating phosphorylation and activation of BRSK1 and BRSK2, leading to axon initiation and specification. Involved in DNA damage response: interacts with p53/TP53 and recruited to the CDKN1A/WAF1 promoter to participate in transcription activation. Able to phosphorylate p53/TP53; the relevance of such result in vivo is however unclear. Also acts as a mediator p53/TP53-dependent apoptosis via interaction with p53/TP53: translocates to mitochondrion during apoptosis and regulates p53/TP53-dependent apoptosis pathways.confidentD4AE59

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050896 [BP]response to stimulusconfidentGO:0008150
GO:0005575 [CC]cellular_componentconfident
GO:0030295 [MF]protein kinase activator activityprobableGO:0019207, GO:0019887, GO:0030234, GO:0019209, GO:0003674, GO:0008047
GO:0072332 [BP]intrinsic apoptotic signaling pathway by p53 class mediatorprobableGO:0010259, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0006915, GO:0097190, GO:0007569, GO:0097193, GO:0008150, GO:0012501, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050794, GO:0072331, GO:0050789, GO:0044699
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0002039 [MF]p53 bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045860 [BP]positive regulation of protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0010212 [BP]response to ionizing radiationprobableGO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0035173 [MF]histone kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0050772 [BP]positive regulation of axonogenesisprobableGO:0022604, GO:0032502, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051128, GO:0031344, GO:0044699, GO:0031346, GO:0050767, GO:0048869, GO:0060284, GO:0050769, GO:0045664, GO:0010769, GO:0065007, GO:0010720, GO:0048518, GO:0051130, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0010975, GO:0022008, GO:0048699, GO:0050770, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0050789, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0006112 [BP]energy reserve metabolic processprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0097009 [BP]energy homeostasisprobableGO:0032501, GO:0048871, GO:0044707, GO:0042592, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0014074 [BP]response to purine-containing compoundprobableGO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:1901698, GO:0014070
GO:0008286 [BP]insulin receptor signaling pathwayprobableGO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0060070 [BP]canonical Wnt receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0009987, GO:0008150, GO:0050896, GO:0016055, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0004679 [MF]AMP-activated protein kinase activityprobableGO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0045722 [BP]positive regulation of gluconeogenesisprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0010906, GO:0010907, GO:0050789, GO:0080090, GO:0009891, GO:0010565, GO:0065007, GO:0006111, GO:0045913, GO:0009889, GO:0050794, GO:0048518, GO:0008150, GO:0010675, GO:0010676, GO:0043255, GO:0006109, GO:0048522
GO:0030275 [MF]LRR domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0005935 [CC]cellular bud neckprobableGO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0030010 [BP]establishment of cell polarityprobableGO:0008150, GO:0009987, GO:0007163, GO:0044763, GO:0044699
GO:0006914 [BP]autophagyprobableGO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:1901576 [BP]organic substance biosynthetic processprobableGO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0042149 [BP]cellular response to glucose starvationprobableGO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0042593 [BP]glucose homeostasisprobableGO:0033500, GO:0048878, GO:0042592, GO:0008150, GO:0065007, GO:0065008
GO:0001944 [BP]vasculature developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030111 [BP]regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0051896 [BP]regulation of protein kinase B signaling cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0060770 [BP]negative regulation of epithelial cell proliferation involved in prostate gland developmentprobableGO:0042127, GO:0008285, GO:0050678, GO:2000242, GO:2000241, GO:0050793, GO:0050680, GO:0050794, GO:0008150, GO:0060768, GO:0065007, GO:2000026, GO:0051239, GO:0048519, GO:0050789, GO:0048523
GO:0000131 [CC]incipient cellular bud siteprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0001894 [BP]tissue homeostasisprobableGO:0032501, GO:0048871, GO:0044707, GO:0060249, GO:0042592, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0007010 [BP]cytoskeleton organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0009894 [BP]regulation of catabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0060575 [BP]intestinal epithelial cell differentiationprobableGO:0032502, GO:0044767, GO:0060429, GO:0048565, GO:0044707, GO:0048869, GO:0048856, GO:0044763, GO:0009888, GO:0055123, GO:0032501, GO:0008150, GO:0030855, GO:0030154, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0002065
GO:0046320 [BP]regulation of fatty acid oxidationprobableGO:0080090, GO:0019217, GO:0019216, GO:0031323, GO:0010565, GO:0050794, GO:0065007, GO:0008150, GO:0019222, GO:0050789
GO:0046328 [BP]regulation of JNK cascadeprobableGO:0070302, GO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0032872, GO:0009966, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789, GO:0043408
GO:0045201 [BP]maintenance of neuroblast polarityprobableGO:0055059, GO:0030154, GO:0055057, GO:0045196, GO:0048103, GO:0007163, GO:0030011, GO:0007405, GO:0051301, GO:0048869, GO:0007275, GO:0044699, GO:0061351, GO:0032502, GO:0032501, GO:0008283, GO:0009987, GO:0044763, GO:0048731, GO:0022008, GO:0017145, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0072089
GO:0042304 [BP]regulation of fatty acid biosynthetic processprobableGO:0080090, GO:0019217, GO:0019216, GO:0031326, GO:0031323, GO:0009889, GO:0010565, GO:0050794, GO:0065007, GO:0046890, GO:0008150, GO:0019222, GO:0050789
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0033762 [BP]response to glucagon stimulusprobableGO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0043434, GO:0010033
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0007286 [BP]spermatid developmentprobableGO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0050321 [MF]tau-protein kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0043276 [BP]anoikisprobableGO:0010259, GO:0009987, GO:0006915, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005816 [CC]spindle pole bodyprobableGO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051645 [BP]Golgi localizationprobableGO:0009987, GO:0044763, GO:0051640, GO:0008150, GO:0051179, GO:0044699, GO:0051641
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005940 [CC]septin ringprobableGO:0005856, GO:0005737, GO:0043228, GO:0005575, GO:0043232, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0032156, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0030511 [BP]positive regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0090100, GO:0009966, GO:0009967, GO:0048584, GO:0017015, GO:0090092, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WTK, chain C
Confidence level:very confident
Coverage over the Query: 37-235
View the alignment between query and template
View the model in PyMOL
Template: 2GCD, chain A
Confidence level:confident
Coverage over the Query: 9-31,46-234
View the alignment between query and template
View the model in PyMOL