Diaphorina citri psyllid: psy7884


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MFQGFFRRSIQKQIEYRCLRDGKCLVIRLNRNRCQYCRFKKCLAVGMSRDSVRYGRVPKRSRERSDSETGSTRVSTTGAEPPSSLETAGPVQSLPSSTELDTKQLLTYDVILAVSQAHHSNCEYTEEGTRRLVRKPVSLPPSEVSSPEVASSTAECHESQRLWLWQQFAAHVTPSVQRVVEFAKRVPGFCDLSQDDQLILIKMGFFELWIGYVSRLTTDSSLTFSDGMYVTRQQLEVMYD
ccccccHHHHccccEEEEccccccccccccccccHHHHHHHHHHccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccCECcHHHHHHHcc
MFQGFFRRSIQKQIEYRCLRDGKCLVIRLNRNRCQYCRFKKCLAVGMSRD*******************************************************LTYDVILAVSQAHHSNCEY***********************************QRLWLWQQFAAHVTPSVQRVVEFAKRVPGFCDLSQDDQLILIKMGFFELWIGYVSRLTTDSSLTFSDGMYVTRQQLEVMYD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQGFFRRSIQKQIEYRCLRDGKCLVIRLNRNRCQYCRFKKCLAVGMSRDSVRYGRVPKRSRERSDSETGSTRVSTTGAEPPSSLETAGPVQSLPSSTELDTKQLLTYDVILAVSQAHHSNCEYTEEGTRRLVRKPVSLPPSEVSSPEVASSTAECHESQRLWLWQQFAAHVTPSVQRVVEFAKRVPGFCDLSQDDQLILIKMGFFELWIGYVSRLTTDSSLTFSDGMYVTRQQLEVMYD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ecdysone-induced protein 78C Induces the early late puff 78C which triggers puparium formation and development.confidentP45447

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DZY, chain D
Confidence level:very confident
Coverage over the Query: 2-79,99-142,159-236
View the alignment between query and template
View the model in PyMOL
Template: 3FFN, chain A
Confidence level:probable
Coverage over the Query: 8-37,48-102
View the alignment between query and template
View the model in PyMOL