Diaphorina citri psyllid: psy7943

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MRRLSLLFLLISPLVVFADDVTEEDGVLVLTQDNFQSSIEKHDHILVEFYAPWCGHCKQLVPEYSKAALQLATDGHDIKLAKVDATQHTALAEQYGVRGYPTLKFFKKRSIIEYGEVTSVEYCYQRNWHKRAVTSVIIRKTS
cHHHHHHHHHHHHHHHccccccccccEEEEccccHHHHHHccccEEEEEEcccccHHcHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHccccccccEEEEccccccccccccccHHcccccccHHHHHHHHHHHcc
*RRLSLLFLLISPLVVFADDVTEEDGVLVLTQDNFQSSIEKHDHILVEFYAPWCGHCKQLVPEYSKAALQLATDGHDIKLAKVDATQHTALAEQYGVRGYPTLKFFKKRSIIEYGEVTSVEYCYQRNWHKRAVTSVIIRK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRLSLLFLLISPLVVFADDVTEEDGVLVLTQDNFQSSIEKHDHILVEFYAPWCGHCKQLVPEYSKAALQLATDGHDIKLAKVDATQHTALAEQYGVRGYPTLKFFKKRSIIEYGEVTSVEYCYQRNWHKRAVTSVIIRKTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein disulfide-isomerase This multifunctional protein catalyzes the formation, breakage and rearrangement of disulfide bonds. At the cell surface, seems to act as a reductase that cleaves disulfide bonds of proteins attached to the cell. May therefore cause structural modifications of exofacial proteins. Inside the cell, seems to form/rearrange disulfide bonds of nascent proteins. At high concentrations, functions as a chaperone that inhibits aggregation of misfolded proteins. At low concentrations, facilitates aggregation (anti-chaperone activity). May be involved with other chaperones in the structural modification of the TG precursor in hormone biogenesis. Also acts a structural subunit of various enzymes such as prolyl 4-hydroxylase and microsomal triacylglycerol transfer protein MTTP.confidentQ8R4U2
Protein disulfide-isomerase This multifunctional protein catalyzes the formation, breakage and rearrangement of disulfide bonds. At the cell surface, seems to act as a reductase that cleaves disulfide bonds of proteins attached to the cell. May therefore cause structural modifications of exofacial proteins. Inside the cell, seems to form/rearrange disulfide bonds of nascent proteins. At high concentrations, functions as a chaperone that inhibits aggregation of misfolded proteins. At low concentrations, facilitates aggregation (anti-chaperone activity). May be involved with other chaperones in the structural modification of the TG precursor in hormone biogenesis. Also acts a structural subunit of various enzymes such as prolyl 4-hydroxylase and microsomal triacylglycerol transfer protein MTTP.confidentQ5R5B6
Protein disulfide-isomerase Participates in the folding of proteins containing disulfide bonds.confidentP54399

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0009055 [MF]electron carrier activityprobableGO:0003674
GO:0004656 [MF]procollagen-proline 4-dioxygenase activityprobableGO:0051213, GO:0003824, GO:0019798, GO:0016705, GO:0016706, GO:0003674, GO:0031545, GO:0031543, GO:0016491
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0042175 [CC]nuclear outer membrane-endoplasmic reticulum membrane networkprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0018401 [BP]peptidyl-proline hydroxylation to 4-hydroxy-L-prolineprobableGO:0019752, GO:0006807, GO:0044281, GO:0043170, GO:1901360, GO:0044267, GO:0044710, GO:0044260, GO:0006520, GO:0018193, GO:0071704, GO:0046483, GO:1901605, GO:0009987, GO:0006464, GO:0032787, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0043436, GO:0018208, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:0019538, GO:0019471, GO:0044237, GO:0019511
GO:0006986 [BP]response to unfolded proteinprobableGO:0050896, GO:0006950, GO:0035966, GO:0008150, GO:0042221, GO:0010033
GO:0008104 [BP]protein localizationprobableGO:0033036, GO:0008150, GO:0051179
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0006109 [BP]regulation of carbohydrate metabolic processprobableGO:0008150, GO:0065007, GO:0080090, GO:0019222, GO:0050789
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0004857 [MF]enzyme inhibitor activityprobableGO:0030234, GO:0003674
GO:0009505 [CC]plant-type cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944
GO:0003810 [MF]protein-glutamine gamma-glutamyltransferase activityprobableGO:0016746, GO:0016740, GO:0016755, GO:0003674, GO:0003824
GO:0051641 [BP]cellular localizationprobableGO:0008150, GO:0009987, GO:0044763, GO:0051179, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0009534 [CC]chloroplast thylakoidprobableGO:0009579, GO:0005737, GO:0031984, GO:0005575, GO:0043231, GO:0044464, GO:0031976, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0009536, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0034976 [BP]response to endoplasmic reticulum stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003756 [MF]protein disulfide isomerase activityprobableGO:0016853, GO:0003824, GO:0003674, GO:0016864, GO:0016862, GO:0016860
GO:0060187 [CC]cell poleprobableGO:0005575, GO:0044464, GO:0005623
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0016671 [MF]oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptorprobableGO:0003824, GO:0003674, GO:0016667, GO:0016491
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005791 [CC]rough endoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005793 [CC]endoplasmic reticulum-Golgi intermediate compartmentprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0070732 [CC]spindle envelopeprobableGO:0005575, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0005623, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0043086 [BP]negative regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0080058 [BP]protein deglutathionylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015035 [MF]protein disulfide oxidoreductase activityprobableGO:0003824, GO:0016491, GO:0003674, GO:0016667, GO:0015036

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 26-138
View the alignment between query and template
View the model in PyMOL