Query         psy7944
Match_columns 231
No_of_seqs    121 out of 178
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:48:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7944.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7944hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0241|consensus               99.9 8.5E-25 1.8E-29  221.6   4.4  148   26-186   721-872 (1714)
  2 PF12423 KIF1B:  Kinesin protei  99.4 3.3E-13 7.2E-18   92.4   3.2   44   40-86      2-45  (45)
  3 KOG0245|consensus               99.3 7.9E-14 1.7E-18  143.4  -1.6   97   27-131   737-834 (1221)
  4 cd04042 C2A_MCTP_PRT C2 domain  91.9    0.28 6.1E-06   37.8   4.4   43   80-122    75-118 (121)
  5 PF09308 LuxQ-periplasm:  LuxQ,  83.8     1.3 2.9E-05   40.4   3.8   26   97-122   125-151 (238)
  6 cd04044 C2A_Tricalbin-like C2   83.4     1.4 3.1E-05   33.4   3.4   43   80-122    79-121 (124)
  7 PF11618 DUF3250:  Protein of u  81.0     2.3 5.1E-05   34.0   3.9   42   81-122    60-103 (107)
  8 cd08678 C2_C21orf25-like C2 do  80.2     5.4 0.00012   31.0   5.6   47   81-127    74-123 (126)
  9 cd08690 C2_Freud-1 C2 domain f  79.2     2.8 6.1E-05   35.4   4.0   42   81-122    94-135 (155)
 10 cd08682 C2_Rab11-FIP_classI C2  79.1     2.6 5.7E-05   32.8   3.5   42   81-122    80-126 (126)
 11 cd08373 C2A_Ferlin C2 domain f  77.9     5.7 0.00012   30.8   5.1   44   81-124    72-116 (127)
 12 cd08681 C2_fungal_Inn1p-like C  77.2     3.9 8.4E-05   31.1   3.9   41   81-122    77-117 (118)
 13 PLN03008 Phospholipase D delta  69.8     7.9 0.00017   41.3   5.2   58   82-139   132-192 (868)
 14 cd08377 C2C_MCTP_PRT C2 domain  68.4      11 0.00025   28.4   4.6   42   80-123    75-118 (119)
 15 cd08400 C2_Ras_p21A1 C2 domain  66.4      12 0.00027   29.3   4.6   44   80-123    76-122 (126)
 16 cd04033 C2_NEDD4_NEDD4L C2 dom  65.3      15 0.00033   28.4   4.9   43   81-123    82-132 (133)
 17 cd04025 C2B_RasA1_RasA4 C2 dom  64.4      13 0.00028   28.5   4.3   41   81-121    76-122 (123)
 18 cd04051 C2_SRC2_like C2 domain  64.2     9.4  0.0002   29.3   3.5   39   81-119    82-125 (125)
 19 cd04013 C2_SynGAP_like C2 doma  62.4      15 0.00033   30.6   4.7   45   80-124    85-139 (146)
 20 PLN02352 phospholipase D epsil  61.2      17 0.00036   38.3   5.6   77   81-157    84-163 (758)
 21 PF14827 Cache_3:  Sensory doma  59.5      15 0.00033   28.5   3.9   26   97-122    87-112 (116)
 22 PF14924 DUF4497:  Protein of u  58.7      17 0.00037   28.7   4.1   45   79-123    45-103 (112)
 23 cd04036 C2_cPLA2 C2 domain pre  56.7      15 0.00033   28.1   3.5   38   81-121    78-115 (119)
 24 cd04022 C2A_MCTP_PRT_plant C2   55.7      30 0.00064   26.8   5.0   43   81-123    80-125 (127)
 25 PLN02270 phospholipase D alpha  55.5      17 0.00037   38.6   4.6   57   82-138   103-162 (808)
 26 cd08378 C2B_MCTP_PRT_plant C2   55.2      21 0.00046   27.9   4.1   42   81-122    71-118 (121)
 27 cd04040 C2D_Tricalbin-like C2   53.8      14  0.0003   27.8   2.8   38   81-118    76-113 (115)
 28 cd04015 C2_plant_PLD C2 domain  53.5      19 0.00042   29.7   3.8   41   82-122   113-156 (158)
 29 cd00275 C2_PLC_like C2 domain   53.0      32 0.00069   26.1   4.7   40   80-122    85-126 (128)
 30 cd08401 C2A_RasA2_RasA3 C2 dom  51.5      42 0.00092   26.2   5.3   42   81-122    77-120 (121)
 31 PF00571 CBS:  CBS domain CBS d  50.1      19 0.00042   23.5   2.7   18  101-118    30-47  (57)
 32 cd04016 C2_Tollip C2 domain pr  48.0      37  0.0008   27.2   4.5   40   82-121    78-119 (121)
 33 cd08391 C2A_C2C_Synaptotagmin_  44.3      32  0.0007   25.8   3.5   39   81-122    82-120 (121)
 34 cd04054 C2A_Rasal1_RasA4 C2 do  42.3      50  0.0011   25.5   4.4   42   81-122    76-120 (121)
 35 cd04046 C2_Calpain C2 domain p  39.6      42 0.00092   26.1   3.6   42   81-124    77-122 (126)
 36 cd04019 C2C_MCTP_PRT_plant C2   38.9      41 0.00088   27.7   3.6   43   82-124    78-132 (150)
 37 PF11141 DUF2914:  Protein of u  37.6      55  0.0012   23.9   3.7   25   97-121    41-65  (66)
 38 cd04021 C2_E3_ubiquitin_ligase  37.4      73  0.0016   24.9   4.7   42   80-121    75-124 (125)
 39 cd04014 C2_PKC_epsilon C2 doma  36.1      67  0.0015   25.0   4.3   37   81-122    89-127 (132)
 40 cd08379 C2D_MCTP_PRT_plant C2   35.3      40 0.00088   27.2   3.0   40   80-119    83-125 (126)
 41 smart00116 CBS Domain in cysta  35.2      35 0.00076   19.9   2.0   19  101-119    23-41  (49)
 42 PF02743 Cache_1:  Cache domain  34.5      66  0.0014   22.9   3.7   23  100-122    15-37  (81)
 43 cd04024 C2A_Synaptotagmin-like  33.9      66  0.0014   24.4   3.8   42   81-122    79-127 (128)
 44 cd04610 CBS_pair_ParBc_assoc T  32.9      47   0.001   23.5   2.7   18  102-119    84-101 (107)
 45 COG2947 Uncharacterized conser  32.8      22 0.00047   30.8   1.1   61   67-129    76-143 (156)
 46 cd04627 CBS_pair_14 The CBS do  31.3      53  0.0011   24.3   2.8   18  102-119   100-117 (123)
 47 cd08375 C2_Intersectin C2 doma  30.6      86  0.0019   25.2   4.1   38   82-122    92-134 (136)
 48 cd08376 C2B_MCTP_PRT C2 domain  28.9 1.1E+02  0.0024   23.0   4.3   38   81-122    76-113 (116)
 49 PF08151 FerI:  FerI (NUC094) d  27.5      75  0.0016   24.0   3.1   17  110-126    28-44  (72)
 50 KOG3837|consensus               27.2      50  0.0011   33.2   2.6   46   81-126   460-508 (523)
 51 cd04600 CBS_pair_HPP_assoc Thi  26.2      68  0.0015   23.4   2.6   19  101-119   100-118 (124)
 52 PF09151 DUF1936:  Domain of un  25.5      53  0.0011   21.9   1.7   12  103-114    12-23  (36)
 53 cd04583 CBS_pair_ABC_OpuCA_ass  23.5      86  0.0019   22.1   2.7   18  102-119    86-103 (109)
 54 COG3290 CitA Signal transducti  23.4      77  0.0017   32.4   3.2   52   72-123   111-162 (537)
 55 cd04642 CBS_pair_29 The CBS do  23.4      93   0.002   23.1   3.0   17  102-118   103-119 (126)
 56 PF08275 Toprim_N:  DNA primase  23.2      64  0.0014   26.0   2.1   30  103-135    80-109 (128)
 57 cd04641 CBS_pair_28 The CBS do  23.1      96  0.0021   22.8   3.0   19  101-119    96-114 (120)
 58 cd04635 CBS_pair_22 The CBS do  23.0      86  0.0019   22.8   2.7   18  102-119    99-116 (122)
 59 cd04607 CBS_pair_NTP_transfera  22.6      98  0.0021   22.3   2.9   19  101-119    89-107 (113)
 60 cd04620 CBS_pair_7 The CBS dom  22.4      98  0.0021   22.3   2.9   18  102-119    92-109 (115)
 61 cd04624 CBS_pair_11 The CBS do  22.2   1E+02  0.0022   22.0   2.9   18  102-119    89-106 (112)
 62 cd08382 C2_Smurf-like C2 domai  22.1 1.5E+02  0.0032   23.0   3.9   41   81-121    77-122 (123)
 63 cd04590 CBS_pair_CorC_HlyC_ass  21.9      98  0.0021   22.1   2.7   18  101-118    87-104 (111)
 64 cd04603 CBS_pair_KefB_assoc Th  21.6      99  0.0021   22.5   2.7   17  102-118    88-104 (111)
 65 cd02205 CBS_pair The CBS domai  21.4 1.1E+02  0.0024   20.9   2.9   19  101-119    89-107 (113)
 66 cd04617 CBS_pair_4 The CBS dom  21.4      92   0.002   22.9   2.5   18  102-119    92-112 (118)
 67 cd04596 CBS_pair_DRTGG_assoc T  20.6 1.1E+02  0.0023   22.0   2.7   18  102-119    85-102 (108)
 68 cd04601 CBS_pair_IMPDH This cd  20.4 1.1E+02  0.0025   21.5   2.8   18  102-119    87-104 (110)
 69 cd04619 CBS_pair_6 The CBS dom  20.1 1.2E+02  0.0025   22.2   2.8   18  102-119    91-108 (114)

No 1  
>KOG0241|consensus
Probab=99.90  E-value=8.5e-25  Score=221.60  Aligned_cols=148  Identities=21%  Similarity=0.278  Sum_probs=114.7

Q ss_pred             cccccccccCcCcccchHHHHHHhhhhcccCCCCCCCccCCCCCCCCCCCCCCCceeEEeeeeeeccccccccccceeEE
Q psy7944          26 CLNPKFSFTNLLPSRQRLEMMREMYHNEAEMSPTSPDYNIESLTGGDPFYDRFPWFRLVGRAFVYLSNLMYPIPLIQKVA  105 (231)
Q Consensus        26 ~~s~lWSleKL~~~~nRL~~MREMYq~~~e~~~~~~d~~~~~~~~~DPFYD~~p~fsLIGrA~VyLsnLly~V~L~~~Vp  105 (231)
                      .++++|+++||   ++||.+||+|||+|.++-..   .........|||||.+++|+|||+|+|||++|||+|.|+|+||
T Consensus       721 ~gsQiWt~ekL---enkLiDMRd~Yqe~ke~~~~---~~~~~~k~~DPFyesQEnhnLiGVANvFLE~LF~DvkL~Y~vP  794 (1714)
T KOG0241|consen  721 KGSQIWTIEKL---ENKLIDMRDLYQEWKEKVPP---AKRLYGKRGDPFYESQENHNLIGVANVFLEVLFHDVKLQYAVP  794 (1714)
T ss_pred             CCceeeeHHHh---HhHHhhHHHHHHHHHhcCCc---hhhhccccCCccccccccccchhhHHHHHHHHHhhheeccccc
Confidence            35899999999   99999999999999976542   2345677899999999999999999999999999999999999


Q ss_pred             EEcCCCCeeEEEEEEEEEecCCCcccccccccccccccccccccccccCcceee---cCCCCCCCcccCCCc-eeeeecc
Q psy7944         106 IVNEKGDVKGHLKIAVQIVTDEESTDLTGTVKQSARIIFDDDQQTGRNNKKAVE---DSGHQGDKVEENPPC-TSSMYAF  181 (231)
Q Consensus       106 IVsekGEVkG~LrVeVqpisd~e~~d~~~gv~qSakisfd~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~-~~~~~~~  181 (231)
                      ||||+|||+|+|||+|.++++.++.+..+| ..-+..+  .+....+|-.+|-.   ..-|.--.    --+ +|-+|.|
T Consensus       795 IIsQqGEVAGRLhVev~Rv~gq~~~~~~gg-dev~e~~--~~~~~~~~~ltCrVkIk~AtGLP~~----LSnFVFCqYtF  867 (1714)
T KOG0241|consen  795 IISQQGEVAGRLHVEVMRVTGQVPERVVGG-DEVVESS--GEIIHRVKKLTCRVKIKEATGLPLN----LSNFVFCQYTF  867 (1714)
T ss_pred             eecccccccceeEEEEEEeccccchhhccc-cccccCC--CccccccceEEEEEEEeeccCCccc----ccceEEEEeee
Confidence            999999999999999999999987765543 3324333  33333455555544   44444333    233 7777887


Q ss_pred             cCCCC
Q psy7944         182 PEENG  186 (231)
Q Consensus       182 ~~~~~  186 (231)
                      =++.-
T Consensus       868 w~~~E  872 (1714)
T KOG0241|consen  868 WDQQE  872 (1714)
T ss_pred             ccccc
Confidence            66543


No 2  
>PF12423 KIF1B:  Kinesin protein 1B;  InterPro: IPR022140  This domain family is found in eukaryotes, and is approximately 50 amino acids in length. The family is found in association with PF00225 from PFAM, PF00498 from PFAM. KIF1B is an anterograde motor for transport of mitochondria in axons of neuronal cells. 
Probab=99.37  E-value=3.3e-13  Score=92.37  Aligned_cols=44  Identities=32%  Similarity=0.398  Sum_probs=34.3

Q ss_pred             cchHHHHHHhhhhcccCCCCCCCccCCCCCCCCCCCCCCCceeEEee
Q psy7944          40 RQRLEMMREMYHNEAEMSPTSPDYNIESLTGGDPFYDRFPWFRLVGR   86 (231)
Q Consensus        40 ~nRL~~MREMYq~~~e~~~~~~d~~~~~~~~~DPFYD~~p~fsLIGr   86 (231)
                      +|||++||||||++.+...   +.....+.+.|||||++|||+|||+
T Consensus         2 ~nRl~~MRemYq~~~~~~~---~~~~~~~~~~DPF~e~~e~~~lIGv   45 (45)
T PF12423_consen    2 ENRLFDMREMYQQYKENDF---PEYDQHFKEDDPFYEPQENHSLIGV   45 (45)
T ss_pred             ccHHHHHHHHHHHHHhcCC---ccccccCCCCCCCCCCCccccccCc
Confidence            7999999999999842111   1112367889999999999999996


No 3  
>KOG0245|consensus
Probab=99.34  E-value=7.9e-14  Score=143.36  Aligned_cols=97  Identities=46%  Similarity=0.741  Sum_probs=88.6

Q ss_pred             ccccccccCcCcccchHHHHHHhhhhcccCCCCCCCccCCCCCCCCCCCCCCCceeEEeeeeeeccccccccccceeEEE
Q psy7944          27 LNPKFSFTNLLPSRQRLEMMREMYHNEAEMSPTSPDYNIESLTGGDPFYDRFPWFRLVGRAFVYLSNLMYPIPLIQKVAI  106 (231)
Q Consensus        27 ~s~lWSleKL~~~~nRL~~MREMYq~~~e~~~~~~d~~~~~~~~~DPFYD~~p~fsLIGrA~VyLsnLly~V~L~~~VpI  106 (231)
                      ..++|+.+|+       ..||+||....++.....+..++..++.||||++++|+.++| ++|||++|+|++|+.++++|
T Consensus       737 ~t~~w~~ekl-------~~~R~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~g-~~~~l~~l~~~~~l~~~~~~  808 (1221)
T KOG0245|consen  737 ATHLWSKEKL-------DMIRELGEQEAEMATSDGDESEDIATGSDPFYERRHWFKLLG-ILVRLSSLAYPVPLIAKKAI  808 (1221)
T ss_pred             hHHHHHHHHH-------HHHHHhchhhhhhcccCCCccccccccCCccccchhHHHHHH-HHHHHHhcccchhHHHhhhh
Confidence            3689999999       899999999998887777767888999999999999999999 89999999999999999999


Q ss_pred             EcCCCCeeEEEEEEEEEec-CCCccc
Q psy7944         107 VNEKGDVKGHLKIAVQIVT-DEESTD  131 (231)
Q Consensus       107 VsekGEVkG~LrVeVqpis-d~e~~d  131 (231)
                      ++.+|+++|.|+|++++++ +++.+|
T Consensus       809 ~~~~g~~kg~lt~~~~~~~~d~e~~d  834 (1221)
T KOG0245|consen  809 VELQGQEKGMLTVAVQPVEADDEELD  834 (1221)
T ss_pred             hhhhccccceeeeeccccccCCcccc
Confidence            9999999999999999994 666555


No 4  
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protein
Probab=91.87  E-value=0.28  Score=37.85  Aligned_cols=43  Identities=26%  Similarity=0.305  Sum_probs=38.0

Q ss_pred             ceeEEeeeeeeccccccccccceeEEEEcCCC-CeeEEEEEEEE
Q psy7944          80 WFRLVGRAFVYLSNLMYPIPLIQKVAIVNEKG-DVKGHLKIAVQ  122 (231)
Q Consensus        80 ~fsLIGrA~VyLsnLly~V~L~~~VpIVsekG-EVkG~LrVeVq  122 (231)
                      ...+||.+.+.|+.|...-+.+..+++.+.+| +..|.|+|+|.
T Consensus        75 ~~~~iG~~~~~l~~l~~~~~~~~~~~L~~~~~~~~~G~l~l~~~  118 (121)
T cd04042          75 TDDFMGSAFVDLSTLELNKPTEVKLKLEDPNSDEDLGYISLVVT  118 (121)
T ss_pred             CCcceEEEEEEHHHcCCCCCeEEEEECCCCCCccCceEEEEEEE
Confidence            34689999999999998889999999998876 78899999886


No 5  
>PF09308 LuxQ-periplasm:  LuxQ, periplasmic;  InterPro: IPR015387 This entry represents the periplasmic sensor domain of the prokaryotic protein LuxQ, that assumes a structure consisting of two tandem Per/ARNT/Simple-minded (PAS) folds []. ; GO: 0004673 protein histidine kinase activity, 0016791 phosphatase activity; PDB: 2HJ9_C 2HJE_A 1ZHH_B 3C30_A 3C38_A.
Probab=83.83  E-value=1.3  Score=40.37  Aligned_cols=26  Identities=31%  Similarity=0.512  Sum_probs=21.6

Q ss_pred             ccccceeEEEEcC-CCCeeEEEEEEEE
Q psy7944          97 PIPLIQKVAIVNE-KGDVKGHLKIAVQ  122 (231)
Q Consensus        97 ~V~L~~~VpIVse-kGEVkG~LrVeVq  122 (231)
                      ..-|..++||++. +|||.|+|-++|.
T Consensus       125 ~~lLvRR~pIi~~~tGEVlG~Ly~gvV  151 (238)
T PF09308_consen  125 RYLLVRRTPIIDPKTGEVLGYLYIGVV  151 (238)
T ss_dssp             EEEEEEEEEEE-TTTSBEEEEEEEEEE
T ss_pred             eEEEEeecceeeCCCCeEEEEEEEEEE
Confidence            3457789999997 9999999999984


No 6  
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  
Probab=83.41  E-value=1.4  Score=33.39  Aligned_cols=43  Identities=21%  Similarity=0.165  Sum_probs=31.8

Q ss_pred             ceeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEEEEEE
Q psy7944          80 WFRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        80 ~fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      ...+||.+.+.|+.|...-........+..+|...|.|+|.++
T Consensus        79 ~d~~iG~~~~~l~~l~~~~~~~~~~~~~~~~~k~~G~i~~~l~  121 (124)
T cd04044          79 KDKLIGTAEFDLSSLLQNPEQENLTKNLLRNGKPVGELNYDLR  121 (124)
T ss_pred             CCceeEEEEEEHHHhccCccccCcchhhhcCCccceEEEEEEE
Confidence            3578999999999998665543333333468888999999986


No 7  
>PF11618 DUF3250:  Protein of unknown function (DUF3250);  InterPro: IPR021656  This family of proteins represents a protein with unknown function. It may be the C2 domain from KIAA1005 however this cannot be confirmed. ; PDB: 2YRB_A.
Probab=81.03  E-value=2.3  Score=33.99  Aligned_cols=42  Identities=17%  Similarity=0.240  Sum_probs=33.0

Q ss_pred             eeEEeeeeeeccccccccc--cceeEEEEcCCCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIP--LIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~--L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      |.+||++.+.|..|+....  +..++.+++-.|++.|.|++.++
T Consensus        60 ~~tla~~~i~l~~ll~~~~~~i~~~~~l~g~~~~~~g~l~y~~r  103 (107)
T PF11618_consen   60 FETLAAGQISLRPLLESNGERIHGSATLVGVSGEDFGTLEYWIR  103 (107)
T ss_dssp             EEEEEEEEE--SHHHH--S--EEEEEEE-BSSS-TSEEEEEEEE
T ss_pred             eEEEEEEEeechhhhcCCCceEEEEEEEeccCCCeEEEEEEEEE
Confidence            7899999999999997765  88899999999999999999886


No 8  
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein. The members in this cd are named after the Human C21orf25 which contains a single C2 domain.  Several other members contain a C1 domain downstream of the C2 domain.  No other information on this protein is currently known. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a 
Probab=80.16  E-value=5.4  Score=31.04  Aligned_cols=47  Identities=15%  Similarity=0.174  Sum_probs=36.9

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcC---CCCeeEEEEEEEEEecCC
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNE---KGDVKGHLKIAVQIVTDE  127 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVse---kGEVkG~LrVeVqpisd~  127 (231)
                      ..+||.+.+.|+.|.-.-.....+|+-..   .+.+.|.|+++++-+..+
T Consensus        74 ~~~lG~~~i~l~~l~~~~~~~~~~~L~~~~~~~~~~~G~l~l~~~~~~~~  123 (126)
T cd08678          74 SKFLGLAIVPFDELRKNPSGRQIFPLQGRPYEGDSVSGSITVEFLFMEPA  123 (126)
T ss_pred             CceEEEEEEeHHHhccCCceeEEEEecCCCCCCCCcceEEEEEEEEeccc
Confidence            57899999999998865556677787755   356899999999877544


No 9  
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1). Freud-1 is a novel calcium-regulated repressor that negatively regulates basal 5-HT1A receptor expression in neurons.  It may also play a role in the altered regulation of 5-HT1A receptors associated with anxiety or major depression. Freud-1 contains two DM-14 basic repeats, a helix-loop-helix DNA binding domain, and a C2 domain. The Freud-1 C2 domain is thought to be calcium insensitive and it lacks several acidic residues that mediate calcium binding of the PKC C2 domain. In addition, it contains a poly-basic insert that is not present in calcium-dependent C2 domains and may function as a nuclear localization signal. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules tha
Probab=79.24  E-value=2.8  Score=35.37  Aligned_cols=42  Identities=24%  Similarity=0.352  Sum_probs=38.0

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      ..+||.|.+.|+.|-......+.+++.+.+-.+-|.|+|.|+
T Consensus        94 D~~iG~~~i~L~~l~~~~~~~~~~~L~~~~k~~Gg~l~v~ir  135 (155)
T cd08690          94 DKLLGTAQVKLEPLETKCEIHESVDLMDGRKATGGKLEVKVR  135 (155)
T ss_pred             CCeeEEEEEEcccccccCcceEEEEhhhCCCCcCCEEEEEEE
Confidence            468999999999998888889999999887788999999995


No 10 
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I. Rab GTPases recruit various effector proteins to organelles and vesicles.  Rab11-family interacting proteins (FIPs) are involved in mediating the role of Rab11. FIPs can be divided into three classes: class I FIPs (Rip11a, Rip11b, RCP, and FIP2) which contain a C2 domain after N-terminus of the protein, class II FIPs (FIP3 and FIP4) which contain two EF-hands and a proline rich region, and class III FIPs (FIP1) which exhibits no homology to known protein domains. All FIP proteins contain a highly conserved, 20-amino acid motif at the C-terminus of the protein, known as Rab11/25 binding domain (RBD).  Class I FIPs are thought to bind to endocytic membranes via their C2 domain, which interacts directly with phospholipids. Class II FIPs do not have any membrane binding domains leaving much to speculate about the mechanism involving FIP3 and FIP4 interactions with endocytic membranes. The member
Probab=79.06  E-value=2.6  Score=32.76  Aligned_cols=42  Identities=14%  Similarity=0.266  Sum_probs=31.8

Q ss_pred             eeEEeeeeeeccccc--cccccceeEEEEcCCC---CeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLM--YPIPLIQKVAIVNEKG---DVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLl--y~V~L~~~VpIVsekG---EVkG~LrVeVq  122 (231)
                      ..+||++.+.|+.|.  -..+...-.++-+.+|   ...|.|+|.+|
T Consensus        80 d~~iG~~~i~l~~l~~~~~~~~~~W~~L~~~~~~~~~~~Gei~l~~~  126 (126)
T cd08682          80 DKFLGQVSIPLNDLDEDKGRRRTRWFKLESKPGKDDKERGEIEVDIQ  126 (126)
T ss_pred             CceeEEEEEEHHHhhccCCCcccEEEECcCCCCCCccccceEEEEeC
Confidence            457999999999987  4455666777776544   47799999875


No 11 
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin. Ferlins are involved in vesicle fusion events.  Ferlins and other proteins, such as Synaptotagmins, are implicated in facilitating the fusion process when cell membranes fuse together.  There are six known human Ferlins: Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these genes can lead to a wide range of diseases including muscular dystrophy (dysferlin), deafness (otoferlin), and infertility (fer-1, fertilization factor-1).  Structurally they have 6 tandem C2 domains, designated as (C2A-C2F) and a single C-terminal transmembrane domain, though there is a new study that disputes this and claims that there are actually 7 tandem C2 domains with another C2 domain inserted between C2D and C2E.   In a subset of them (Dysferlin, Myoferlin, and Fer1) there is an additional conserved domain called DysF. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=77.94  E-value=5.7  Score=30.80  Aligned_cols=44  Identities=23%  Similarity=0.291  Sum_probs=36.3

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcCCCC-eeEEEEEEEEEe
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGD-VKGHLKIAVQIV  124 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVsekGE-VkG~LrVeVqpi  124 (231)
                      ..+||.+.+.|+.|.-.-.....+|+.+.+|. ..|.|++++.-.
T Consensus        72 d~~iG~~~~~l~~l~~~~~~~~~~~L~~~~~~~~~~~l~l~~~~~  116 (127)
T cd08373          72 NRLIGSATVSLQDLVSEGLLEVTEPLLDSNGRPTGATISLEVSYQ  116 (127)
T ss_pred             CceEEEEEEEhhHcccCCceEEEEeCcCCCCCcccEEEEEEEEEe
Confidence            46899999999999877777778899887666 479999988755


No 12 
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins. Saccharomyces cerevisiae Inn1 associates with the contractile actomyosin ring at the end of mitosis and is needed for cytokinesis. The C2 domain of Inn1, located at the N-terminus, is required for ingression of the plasma membrane. The C-terminus is relatively unstructured and contains eight PXXP motifs that are thought to mediate interaction of Inn1 with other proteins with SH3 domains in the cytokinesis proteins Hof1 (an F-BAR protein) and Cyk3 (whose overexpression can restore primary septum formation in Inn1Delta cells) as well as recruiting Inn1 to the bud-neck by binding to Cyk3. Inn1 and Cyk3 appear to cooperate in activating chitin synthase Chs2 for primary septum formation, which allows coordination of actomyosin ring contraction with ingression of the cleavage furrow. It is thought that the C2 domain of Inn1 helps to preserve the link between the actomyosin ring and the plasma membrane, contr
Probab=77.25  E-value=3.9  Score=31.10  Aligned_cols=41  Identities=20%  Similarity=0.161  Sum_probs=32.3

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      ..+||.+.+.|+.++..-...+-.++.. +|...|.|+++++
T Consensus        77 ~~~iG~~~~~l~~~~~~~~~~~w~~L~~-~~~~~G~i~l~l~  117 (118)
T cd08681          77 PDLIGDTEVDLSPALKEGEFDDWYELTL-KGRYAGEVYLELT  117 (118)
T ss_pred             CcceEEEEEecHHHhhcCCCCCcEEecc-CCcEeeEEEEEEE
Confidence            4689999999999876656677777764 6778899999875


No 13 
>PLN03008 Phospholipase D delta
Probab=69.79  E-value=7.9  Score=41.26  Aligned_cols=58  Identities=7%  Similarity=0.125  Sum_probs=47.1

Q ss_pred             eEEeeeeeeccccccccccceeEEEEcCCCCee---EEEEEEEEEecCCCccccccccccc
Q psy7944          82 RLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVK---GHLKIAVQIVTDEESTDLTGTVKQS  139 (231)
Q Consensus        82 sLIGrA~VyLsnLly~V~L~~~VpIVsekGEVk---G~LrVeVqpisd~e~~d~~~gv~qS  139 (231)
                      .+||+|.|.|+.|.-....+.-++|++..|.-.   |.|+|+++-..-++.+-|..||...
T Consensus       132 D~IG~a~IPL~~L~~Ge~vd~Wl~Ll~~~~kp~k~~~kl~v~lqf~pv~~~~~~~~gv~~~  192 (868)
T PLN03008        132 QIIGTAKIPVRDIASGERISGWFPVLGASGKPPKAETAIFIDMKFTPFDQIHSYRCGIAGD  192 (868)
T ss_pred             ceeEEEEEEHHHcCCCCceEEEEEccccCCCCCCCCcEEEEEEEEEEccccccccccccCC
Confidence            589999999999999999999999999876544   6899998777555556677776554


No 14 
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  The cds in this family contain multiple C2 domains as well as a C-terminal PRT domain.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal tran
Probab=68.35  E-value=11  Score=28.38  Aligned_cols=42  Identities=12%  Similarity=0.204  Sum_probs=31.5

Q ss_pred             ceeEEeeeeeeccccccccccceeEEEEcC--CCCeeEEEEEEEEE
Q psy7944          80 WFRLVGRAFVYLSNLMYPIPLIQKVAIVNE--KGDVKGHLKIAVQI  123 (231)
Q Consensus        80 ~fsLIGrA~VyLsnLly~V~L~~~VpIVse--kGEVkG~LrVeVqp  123 (231)
                      ...+||++.+.|..+....+  ...++.+.  ++.++|.+.++++-
T Consensus        75 ~~~~iG~~~~~l~~~~~~~~--~~~~l~~~~~~~~~~G~i~l~~~~  118 (119)
T cd08377          75 KPEFLGKVAIPLLSIKNGER--KWYALKDKKLRTRAKGSILLEMDV  118 (119)
T ss_pred             CCceeeEEEEEHHHCCCCCc--eEEECcccCCCCceeeEEEEEEEe
Confidence            45789999999999876543  55666665  45689999998864


No 15 
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1). RasA1 is a GAP1 (GTPase activating protein 1), a Ras-specific GAP member, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA1 contains a C2 domain,  a Ras-GAP domain, a pleckstrin homology (PH)-like domain, a SH3 domain, and 2 SH2 domains. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficki
Probab=66.38  E-value=12  Score=29.32  Aligned_cols=44  Identities=18%  Similarity=0.086  Sum_probs=31.3

Q ss_pred             ceeEEeeeeeeccccccccccceeEEEEcCC---CCeeEEEEEEEEE
Q psy7944          80 WFRLVGRAFVYLSNLMYPIPLIQKVAIVNEK---GDVKGHLKIAVQI  123 (231)
Q Consensus        80 ~fsLIGrA~VyLsnLly~V~L~~~VpIVsek---GEVkG~LrVeVqp  123 (231)
                      ...+||.+.+.|+.+...-..+.-.++...+   +...|.|++.++-
T Consensus        76 ~d~~iG~v~i~l~~l~~~~~~~~W~~L~~~~~~~~~~~G~i~l~l~~  122 (126)
T cd08400          76 KDSEIAEVTVQLSKLQNGQETDEWYPLSSASPLKGGEWGSLRIRARY  122 (126)
T ss_pred             CCCeEEEEEEEHhHccCCCcccEeEEcccCCCCCCCcCcEEEEEEEE
Confidence            3467888888888887766667777776653   4566888887764


No 16 
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42). Nedd4 and Nedd4-2 are two of the nine members of the Human Nedd4 family.  All vertebrates appear to have both Nedd4 and Nedd4-2 genes. They are thought to participate in the regulation of epithelial Na+ channel (ENaC) activity. They also have identical specificity for ubiquitin conjugating enzymes (E2).  Nedd4 and Nedd4-2 are composed of a C2 domain, 2-4 WW domains, and a ubiquitin ligase Hect domain. Their WW domains can bind PPxY (PY) or LPSY motifs, and in vitro studies suggest that WW3 and WW4 of both proteins bind PY motifs in the key substrates, with WW3 generally exhibiting higher affinity. Most Nedd4 family members, especially Nedd4-2, also have multiple splice variants, which might play different roles in regulating their substrates. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangemen
Probab=65.31  E-value=15  Score=28.42  Aligned_cols=43  Identities=28%  Similarity=0.338  Sum_probs=31.1

Q ss_pred             eeEEeeeeeeccccccccccc------eeEEEE--cCCCCeeEEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLI------QKVAIV--NEKGDVKGHLKIAVQI  123 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~------~~VpIV--sekGEVkG~LrVeVqp  123 (231)
                      ..+||.+.+.|+.+....+-.      .-.++-  +.+|+++|.|++++.-
T Consensus        82 ~~~iG~~~i~l~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~G~l~~~~~~  132 (133)
T cd04033          82 DDFLGQVEVPLNNLPTETPGNERRYTFKDYLLRPRSSKSRVKGHLRLYMAY  132 (133)
T ss_pred             CCeeEEEEEEHHHCCCcCccccccccchheeeeecCCCCcceeEEEEEEee
Confidence            468999999999998654421      223333  4478899999999863


No 17 
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4. RasA1 and RasA4 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  Both proteins contain two C2 domains,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such a
Probab=64.40  E-value=13  Score=28.54  Aligned_cols=41  Identities=17%  Similarity=0.238  Sum_probs=27.9

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEc------CCCCeeEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVN------EKGDVKGHLKIAV  121 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVs------ekGEVkG~LrVeV  121 (231)
                      ..+||.+.+.|+.+.-.-....-..+..      .+|...|.|+|.|
T Consensus        76 ~~~iG~~~~~l~~l~~~~~~~~w~~L~~~~~~~~~~~~~~G~l~~~~  122 (123)
T cd04025          76 NDFLGKVVFSIQTLQQAKQEEGWFRLLPDPRAEEESGGNLGSLRLKV  122 (123)
T ss_pred             CcEeEEEEEEHHHcccCCCCCCEEECCCCCCCCccccCceEEEEEEe
Confidence            4689999999888863322333344443      4788889999887


No 18 
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins. SRC2 production is a response to pathogen infiltration.  The initial response of increased Ca2+ concentrations are coupled to downstream signal transduction pathways via calcium binding proteins.  SRC2 contains a single C2 domain which localizes to the plasma membrane and is involved in Ca2+ dependent protein binding. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such 
Probab=64.24  E-value=9.4  Score=29.34  Aligned_cols=39  Identities=21%  Similarity=0.272  Sum_probs=31.2

Q ss_pred             eeEEeeeeeecccccccccc-----ceeEEEEcCCCCeeEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPL-----IQKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L-----~~~VpIVsekGEVkG~LrV  119 (231)
                      ..+||.+.+.|..++..-+.     ....++....|..+|.|++
T Consensus        82 ~~~lG~~~i~l~~l~~~~~~~~~~~~~~~~l~~~~g~~~G~~~~  125 (125)
T cd04051          82 DKLIGEVRVPLKDLLDGASPAGELRFLSYQLRRPSGKPQGVLNF  125 (125)
T ss_pred             CCcEEEEEEEHHHhhcccCCCCcceeEEEEeECCCCCcCeEEeC
Confidence            46899999999999865553     4567888889999999874


No 19 
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family. SynGAP, GAP1, RasGAP, and neurofibromin are all members of the Ras-specific GAP (GTPase-activating protein) family.  SynGAP regulates the MAP kinase signaling pathway and is critical for cognition and synapse function.  Mutations in this gene causes mental retardation in humans.   SynGAP contains a PH-like domain, a C2 domain, and a  Ras-GAP domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at leas
Probab=62.41  E-value=15  Score=30.64  Aligned_cols=45  Identities=11%  Similarity=0.128  Sum_probs=36.2

Q ss_pred             ceeEEeeeeeeccccccccccceeEEEEcCCCCe----------eEEEEEEEEEe
Q psy7944          80 WFRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDV----------KGHLKIAVQIV  124 (231)
Q Consensus        80 ~fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEV----------kG~LrVeVqpi  124 (231)
                      ...+||++.|.|+.|.-.-..+.-.||...+|.-          .|.|||.++-.
T Consensus        85 ~~~~IG~V~Ip~~~l~~~~~ve~Wfpl~~~~~~~~~~~~~~~~~~~~lrik~rf~  139 (146)
T cd04013          85 KSQLIGTVNIPVTDVSSRQFVEKWYPVSTPKGNGKSGGKEGKGESPSIRIKARYQ  139 (146)
T ss_pred             CCcEEEEEEEEHHHhcCCCcccEEEEeecCCCCCccccccccCCCCEEEEEEEEE
Confidence            4578999999999999888899999999987764          25777777654


No 20 
>PLN02352 phospholipase D epsilon
Probab=61.21  E-value=17  Score=38.34  Aligned_cols=77  Identities=10%  Similarity=0.136  Sum_probs=54.1

Q ss_pred             eeEEeeeeeeccccccccc-cceeEEEEcCCCCee-E-EEEEEEEEecCCCcccccccccccccccccccccccccCcce
Q psy7944          81 FRLVGRAFVYLSNLMYPIP-LIQKVAIVNEKGDVK-G-HLKIAVQIVTDEESTDLTGTVKQSARIIFDDDQQTGRNNKKA  157 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~-L~~~VpIVsekGEVk-G-~LrVeVqpisd~e~~d~~~gv~qSakisfd~~~~~~~~~~~~  157 (231)
                      -.+||+|.++.+-|+-.-. .+.-+||++..|... | .|+|.+|-..-+..+.|..||+.+..----.-+|-..+.-..
T Consensus        84 ~~~ig~~~~p~~~~~~g~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~gvp~~~f~~r~g~~v  163 (758)
T PLN02352         84 CSILGRFHIQAHQIVTEASFINGFFPLIMENGKPNPELKLRFMLWFRPAELEPTWCKILENGSFQGLRNATFPQRSNCHV  163 (758)
T ss_pred             CeEEEEEEEEHHHhhCCCcccceEEEcccCCCCCCCCCEEEEEEEEEEhhhCcchhhcccCCCcCCcCCcccccCCCCEE
Confidence            4689999999999988744 999999999977654 4 788888777556667788888665222222344444444333


No 21 
>PF14827 Cache_3:  Sensory domain of two-component sensor kinase; PDB: 1OJG_A 3BY8_A 1P0Z_I 2V9A_A 2J80_B.
Probab=59.54  E-value=15  Score=28.47  Aligned_cols=26  Identities=19%  Similarity=0.280  Sum_probs=20.4

Q ss_pred             ccccceeEEEEcCCCCeeEEEEEEEE
Q psy7944          97 PIPLIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        97 ~V~L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      ..-+.-.+||.|..|++.|.+.|.+.
T Consensus        87 ~~~~~~~~PV~d~~g~viG~V~VG~~  112 (116)
T PF14827_consen   87 GPSLRAFAPVYDSDGKVIGVVSVGVS  112 (116)
T ss_dssp             CEEEEEEEEEE-TTS-EEEEEEEEEE
T ss_pred             ceEEEEEEeeECCCCcEEEEEEEEEE
Confidence            44677889999999999999999874


No 22 
>PF14924 DUF4497:  Protein of unknown function (DUF4497)
Probab=58.69  E-value=17  Score=28.67  Aligned_cols=45  Identities=18%  Similarity=0.369  Sum_probs=36.6

Q ss_pred             CceeEEeeeeeecccccccc--------------ccceeEEEEcCCCCeeEEEEEEEEE
Q psy7944          79 PWFRLVGRAFVYLSNLMYPI--------------PLIQKVAIVNEKGDVKGHLKIAVQI  123 (231)
Q Consensus        79 p~fsLIGrA~VyLsnLly~V--------------~L~~~VpIVsekGEVkG~LrVeVqp  123 (231)
                      +...+||.+.+.|..++..+              .+....|+.++.|+..|.+.+.|+-
T Consensus        45 ~~~~liG~~~i~l~~~~~~i~~~~~~~~~~p~s~~~k~~f~L~~~~~~~~G~I~l~iRL  103 (112)
T PF14924_consen   45 PPPMLIGSCPISLAEAFNRILKDSAECNGQPSSKTIKGTFPLFDENGNPVGEISLYIRL  103 (112)
T ss_pred             CccceeeEEEecHHHHHHHHHHHHHhhccCCCchhhcceeEeecCCCceeeeEEEEEEE
Confidence            34578999999998887322              3667899999999999999999864


No 23 
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2). A single copy of the C2 domain is present in cPLA2 which releases arachidonic acid from membranes initiating the biosynthesis of potent inflammatory mediators such as prostaglandins, leukotrienes, and platelet-activating factor.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants o
Probab=56.71  E-value=15  Score=28.07  Aligned_cols=38  Identities=16%  Similarity=0.193  Sum_probs=28.8

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAV  121 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~LrVeV  121 (231)
                      ..+||.+.+.|+.|....+....+++-.+ |  +|.|+|++
T Consensus        78 ~~~iG~~~~~l~~l~~g~~~~~~~~L~~~-~--~g~l~~~~  115 (119)
T cd04036          78 DDHLGTVLFDVSKLKLGEKVRVTFSLNPQ-G--KEELEVEF  115 (119)
T ss_pred             CcccEEEEEEHHHCCCCCcEEEEEECCCC-C--CceEEEEE
Confidence            46899999999999887788888887554 2  55666655


No 24 
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates
Probab=55.72  E-value=30  Score=26.85  Aligned_cols=43  Identities=16%  Similarity=0.293  Sum_probs=30.7

Q ss_pred             eeEEeeeeeeccccc-cccccceeEEEEcC--CCCeeEEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLM-YPIPLIQKVAIVNE--KGDVKGHLKIAVQI  123 (231)
Q Consensus        81 fsLIGrA~VyLsnLl-y~V~L~~~VpIVse--kGEVkG~LrVeVqp  123 (231)
                      ..+||.+.+.|+.|. ..-....-.++-..  .+.+.|.|+|+++-
T Consensus        80 d~~lG~v~i~l~~l~~~~~~~~~w~~L~~~~~~~~~~G~l~l~~~~  125 (127)
T cd04022          80 RSFLGRVRISGTSFVPPSEAVVQRYPLEKRGLFSRVRGEIGLKVYI  125 (127)
T ss_pred             CCeeeEEEEcHHHcCCCCCccceEeEeeeCCCCCCccEEEEEEEEE
Confidence            468999999999887 33344455566543  45689999998874


No 25 
>PLN02270 phospholipase D alpha
Probab=55.52  E-value=17  Score=38.60  Aligned_cols=57  Identities=14%  Similarity=0.309  Sum_probs=44.4

Q ss_pred             eEEeeeeeeccccccccccceeEEEEcCCCCee-E--EEEEEEEEecCCCcccccccccc
Q psy7944          82 RLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVK-G--HLKIAVQIVTDEESTDLTGTVKQ  138 (231)
Q Consensus        82 sLIGrA~VyLsnLly~V~L~~~VpIVsekGEVk-G--~LrVeVqpisd~e~~d~~~gv~q  138 (231)
                      .+||+|.++.+-|+-.-+++.-+||++..|... |  .|||.+|-..-+.++-|..||..
T Consensus       103 ~~ig~~~~p~~~~~~g~~i~~~~~~~~~~~~p~~~~~~~~~~~~f~~~~~~~~~~~gv~~  162 (808)
T PLN02270        103 TLIGRAYIPVEEILDGEEVDRWVEILDNDKNPIHGGSKIHVKLQYFEVTKDRNWGRGIRS  162 (808)
T ss_pred             eEEEEEEEEHHHhcCCCccccEEeccCCCCCcCCCCCEEEEEEEEEEcccCcchhcccCC
Confidence            489999999999998889999999999987754 3  67777766544445667777644


No 26 
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphate
Probab=55.17  E-value=21  Score=27.92  Aligned_cols=42  Identities=29%  Similarity=0.326  Sum_probs=31.3

Q ss_pred             eeEEeeeeeeccccccccc-----cceeEEEEcCCC-CeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIP-----LIQKVAIVNEKG-DVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~-----L~~~VpIVsekG-EVkG~LrVeVq  122 (231)
                      ..+||++.+.|+.+....+     ...-.++.+.+| .++|.|++.|+
T Consensus        71 ~~~lG~~~i~l~~l~~~~~~~~~~~~~W~~L~~~~~~~~~G~i~l~~~  118 (121)
T cd08378          71 DDFLGGVCFDLSEVPTRVPPDSPLAPQWYRLEDKKGGRVGGELMLAVW  118 (121)
T ss_pred             CceeeeEEEEhHhCcCCCCCCCCCCcceEEccCCCCCccceEEEEEEE
Confidence            4679999999999875432     335567777653 78899999886


No 27 
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins. 5 to 6 copies of the C2 domain are present in Tricalbin, a yeast homolog of Synaptotagmin, which is involved in membrane trafficking and sorting.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. 
Probab=53.79  E-value=14  Score=27.78  Aligned_cols=38  Identities=21%  Similarity=0.213  Sum_probs=28.6

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLK  118 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~Lr  118 (231)
                      ..+||.+.+.|.++.-.-.....+|+....|...|.|-
T Consensus        76 ~~~iG~~~~~l~~l~~~~~~~~~~~L~~~g~~~~~~~~  113 (115)
T cd04040          76 DDLLGSAYIDLSDLEPEETTELTLPLDGQGGGKLGAVF  113 (115)
T ss_pred             CCceEEEEEEHHHcCCCCcEEEEEECcCCCCccCceEE
Confidence            45788888888888776667778888777776667663


No 28 
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD). PLD hydrolyzes terminal phosphodiester bonds in diester glycerophospholipids resulting in the degradation of phospholipids.  In vitro PLD transfers phosphatidic acid to primary alcohols.  In plants PLD plays a role in germination, seedling growth, phosphatidylinositol metabolism, and changes in phospholipid composition.  There is a single Ca(2+)/phospholipid-binding C2 domain in PLD. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins whic
Probab=53.53  E-value=19  Score=29.73  Aligned_cols=41  Identities=22%  Similarity=0.530  Sum_probs=28.2

Q ss_pred             eEEeeeeeeccccccccccceeEEEEcCCCC--e-eEEEEEEEE
Q psy7944          82 RLVGRAFVYLSNLMYPIPLIQKVAIVNEKGD--V-KGHLKIAVQ  122 (231)
Q Consensus        82 sLIGrA~VyLsnLly~V~L~~~VpIVsekGE--V-kG~LrVeVq  122 (231)
                      .+||++.+.|+.+.-.-+.+.-+++.+..|.  . -|.|||.++
T Consensus       113 ~~IG~~~i~l~~l~~g~~~~~w~~L~~~~~~~~~~~~~l~v~~~  156 (158)
T cd04015         113 QLIGRAYIPVEDLLSGEPVEGWLPILDSNGKPPKPGAKIRVSLQ  156 (158)
T ss_pred             cEEEEEEEEhHHccCCCCcceEEECcCCCCCCCCCCCEEEEEEE
Confidence            4788888888887766667777777775332  2 367777765


No 29 
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC). PLCs are involved in the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and sn-1,2-diacylglycerol (DAG).   1,4,5-IP3 and DAG are second messengers in eukaryotic signal transduction cascades. PLC is composed of a N-terminal PH domain followed by a series of EF hands, a catalytic TIM barrel and a C-terminal C2 domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking 
Probab=53.03  E-value=32  Score=26.08  Aligned_cols=40  Identities=20%  Similarity=0.287  Sum_probs=30.5

Q ss_pred             ceeEEeeeeeeccccccccccceeEEEEcCCCC--eeEEEEEEEE
Q psy7944          80 WFRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGD--VKGHLKIAVQ  122 (231)
Q Consensus        80 ~fsLIGrA~VyLsnLly~V~L~~~VpIVsekGE--VkG~LrVeVq  122 (231)
                      ...+||.+.+.|+.|.-.   .+.+++.+.+|.  ..|.|.|.++
T Consensus        85 ~~~~iG~~~~~l~~l~~g---~~~~~l~~~~~~~~~~~~l~v~~~  126 (128)
T cd00275          85 DDDFLGQACLPLDSLRQG---YRHVPLLDSKGEPLELSTLFVHID  126 (128)
T ss_pred             CCcEeEEEEEEhHHhcCc---eEEEEecCCCCCCCcceeEEEEEE
Confidence            357899999999988532   367899998884  5688887765


No 30 
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3. RasA2 and RasA3 are GAP1s (GTPase activating protein 1s ), Ras-specific GAP members, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  RasA2 and RasA3 are both inositol 1,3,4,5-tetrakisphosphate-binding proteins and contain an N-terminal C2 domain, a Ras-GAP domain, a pleckstrin-homology (PH) domain which localizes it to the plasma membrane, and Bruton's Tyrosine Kinase (BTK) a zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular p
Probab=51.53  E-value=42  Score=26.21  Aligned_cols=42  Identities=10%  Similarity=0.181  Sum_probs=29.7

Q ss_pred             eeEEeeeeeeccccccccccceeEEEE--cCCCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIV--NEKGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIV--sekGEVkG~LrVeVq  122 (231)
                      ..+||++.+.|+.|...-..+.-.++-  ...+...|.|++++.
T Consensus        77 ~~~iG~~~i~l~~l~~~~~~~~w~~L~~~~~~~~~~G~i~l~~~  120 (121)
T cd08401          77 DSVIGKVAIKKEDLHKYYGKDTWFPLQPVDADSEVQGKVHLELR  120 (121)
T ss_pred             CceEEEEEEEHHHccCCCCcEeeEEEEccCCCCcccEEEEEEEE
Confidence            467999999999987555455555554  345667888888764


No 31 
>PF00571 CBS:  CBS domain CBS domain web page. Mutations in the CBS domain of Swiss:P35520 lead to homocystinuria.;  InterPro: IPR000644 CBS (cystathionine-beta-synthase) domains are small intracellular modules, mostly found in two or four copies within a protein, that occur in a variety of proteins in bacteria, archaea, and eukaryotes [, ]. Tandem pairs of CBS domains can act as binding domains for adenosine derivatives and may regulate the activity of attached enzymatic or other domains []. In some cases, CBS domains may act as sensors of cellular energy status by being activated by AMP and inhibited by ATP []. In chloride ion channels, the CBS domains have been implicated in intracellular targeting and trafficking, as well as in protein-protein interactions, but results vary with different channels: in the CLC-5 channel, the CBS domain was shown to be required for trafficking [], while in the CLC-1 channel, the CBS domain was shown to be critical for channel function, but not necessary for trafficking []. Recent experiments revealing that CBS domains can bind adenosine-containing ligands such ATP, AMP, or S-adenosylmethionine have led to the hypothesis that CBS domains function as sensors of intracellular metabolites [, ]. Crystallographic studies of CBS domains have shown that pairs of CBS sequences form a globular domain where each CBS unit adopts a beta-alpha-beta-beta-alpha pattern []. Crystal structure of the CBS domains of the AMP-activated protein kinase in complexes with AMP and ATP shows that the phosphate groups of AMP/ATP lie in a surface pocket at the interface of two CBS domains, which is lined with basic residues, many of which are associated with disease-causing mutations [].  In humans, mutations in conserved residues within CBS domains cause a variety of human hereditary diseases, including (with the gene mutated in parentheses): homocystinuria (cystathionine beta-synthase); Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase); retinitis pigmentosa (IMP dehydrogenase-1); congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members).; GO: 0005515 protein binding; PDB: 3JTF_A 3TE5_C 3TDH_C 3T4N_C 2QLV_C 3OI8_A 3LV9_A 2QH1_B 1PVM_B 3LQN_A ....
Probab=50.12  E-value=19  Score=23.53  Aligned_cols=18  Identities=28%  Similarity=0.673  Sum_probs=15.7

Q ss_pred             ceeEEEEcCCCCeeEEEE
Q psy7944         101 IQKVAIVNEKGDVKGHLK  118 (231)
Q Consensus       101 ~~~VpIVsekGEVkG~Lr  118 (231)
                      ...+||+|++|++.|.+.
T Consensus        30 ~~~~~V~d~~~~~~G~is   47 (57)
T PF00571_consen   30 ISRLPVVDEDGKLVGIIS   47 (57)
T ss_dssp             SSEEEEESTTSBEEEEEE
T ss_pred             CcEEEEEecCCEEEEEEE
Confidence            457999999999999885


No 32 
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip). Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice varian
Probab=47.98  E-value=37  Score=27.16  Aligned_cols=40  Identities=8%  Similarity=0.227  Sum_probs=19.1

Q ss_pred             eEEeeeeeecc-ccccccccceeEEEEcCCCC-eeEEEEEEE
Q psy7944          82 RLVGRAFVYLS-NLMYPIPLIQKVAIVNEKGD-VKGHLKIAV  121 (231)
Q Consensus        82 sLIGrA~VyLs-nLly~V~L~~~VpIVsekGE-VkG~LrVeV  121 (231)
                      .+||++.|.|. .+.-.-..+.-.++...+|. ..|.+++.+
T Consensus        78 d~iG~~~i~l~~~~~~g~~~~~W~~L~~~~~~~~~g~i~l~l  119 (121)
T cd04016          78 ERIAWTHITIPESVFNGETLDDWYSLSGKQGEDKEGMINLVF  119 (121)
T ss_pred             ceEEEEEEECchhccCCCCccccEeCcCccCCCCceEEEEEE
Confidence            45555555553 34333344455555544333 235555544


No 33 
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular
Probab=44.35  E-value=32  Score=25.81  Aligned_cols=39  Identities=13%  Similarity=0.141  Sum_probs=23.1

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      ..+||++.+.|+.|...-....-+++-+   ...|.|+++++
T Consensus        82 ~~~iG~~~i~l~~l~~~~~~~~w~~L~~---~~~G~~~~~~~  120 (121)
T cd08391          82 DDFLGRLSIDLGSVEKKGFIDEWLPLED---VKSGRLHLKLE  120 (121)
T ss_pred             CCcEEEEEEEHHHhcccCccceEEECcC---CCCceEEEEEe
Confidence            3578888888877765444444445433   24466666554


No 34 
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4. Rasal1 and RasA4 are both members of GAP1 (GTPase activating protein 1).  Rasal1 responds to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras. RasA4 suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation.  Both of these proteins contains two C2 domains, a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  
Probab=42.32  E-value=50  Score=25.53  Aligned_cols=42  Identities=12%  Similarity=0.251  Sum_probs=29.3

Q ss_pred             eeEEeeeeeecccccc-ccccceeEEE--EcCCCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMY-PIPLIQKVAI--VNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly-~V~L~~~VpI--VsekGEVkG~LrVeVq  122 (231)
                      ..+||++.+.++.+.- ....+.-+++  .+..+.+.|.+++++.
T Consensus        76 d~~iG~~~~~~~~~~~~~~~~~~W~~L~~~~~~~~~~G~i~l~~~  120 (121)
T cd04054          76 DDVIGKVSLTREVISAHPRGIDGWMNLTEVDPDEEVQGEIHLELS  120 (121)
T ss_pred             CCEEEEEEEcHHHhccCCCCCCcEEECeeeCCCCccccEEEEEEE
Confidence            4679999998876652 2335666666  4466778899988874


No 35 
>cd04046 C2_Calpain C2 domain present in Calpain proteins. A single C2 domain is found in calpains (EC 3.4.22.52, EC 3.4.22.53), calcium-dependent, non-lysosomal cysteine proteases.  Caplains are classified as belonging to Clan CA by MEROPS and include six families: C1, C2, C10, C12, C28, and C47.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of pic
Probab=39.64  E-value=42  Score=26.13  Aligned_cols=42  Identities=14%  Similarity=0.210  Sum_probs=28.5

Q ss_pred             eeEEeeeeeeccccccccccceeEEEE----cCCCCeeEEEEEEEEEe
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIV----NEKGDVKGHLKIAVQIV  124 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIV----sekGEVkG~LrVeVqpi  124 (231)
                      ..+||.+.+-|..+.-..+  +.+++.    ..+|.+.|.|++.|+..
T Consensus        77 d~~lG~~~~~l~~~~~~~~--~~~~l~~~~~~~~~~~~G~i~~~~~~~  122 (126)
T cd04046          77 DEFLGQATLSADPNDSQTL--RTLPLRKRGRDAAGEVPGTISVKVTSS  122 (126)
T ss_pred             CCceEEEEEecccCCCcCc--eEEEcccCCCCCCCCCCCEEEEEEEEc
Confidence            3579999988876543333  444553    36888999999888653


No 36 
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates
Probab=38.90  E-value=41  Score=27.68  Aligned_cols=43  Identities=12%  Similarity=0.172  Sum_probs=31.9

Q ss_pred             eEEeeeeeeccccccc----cccceeEEEEcCCC--------CeeEEEEEEEEEe
Q psy7944          82 RLVGRAFVYLSNLMYP----IPLIQKVAIVNEKG--------DVKGHLKIAVQIV  124 (231)
Q Consensus        82 sLIGrA~VyLsnLly~----V~L~~~VpIVsekG--------EVkG~LrVeVqpi  124 (231)
                      .+||++.+.|+.|...    .+...-.|+.+..|        ..+|.|+|.|+-.
T Consensus        78 d~lG~v~i~L~~l~~~~~~~~~~~~W~~L~~~~~~~~~~k~~k~~g~l~l~i~~~  132 (150)
T cd04019          78 EPLGRAVIPLNDIERRVDDRPVPSRWFSLERPGGAMEQKKKRKFASRIHLRLCLD  132 (150)
T ss_pred             CeEEEEEEEHHHCcccCCCCccCCceEECcCCCCcccccccCcccccEEEEEEec
Confidence            6899999999998643    33566678877654        4668888888754


No 37 
>PF11141 DUF2914:  Protein of unknown function (DUF2914);  InterPro: IPR022606  This bacterial family of proteins has no known function. 
Probab=37.60  E-value=55  Score=23.89  Aligned_cols=25  Identities=36%  Similarity=0.539  Sum_probs=21.4

Q ss_pred             ccccceeEEEEcCCCCeeEEEEEEE
Q psy7944          97 PIPLIQKVAIVNEKGDVKGHLKIAV  121 (231)
Q Consensus        97 ~V~L~~~VpIVsekGEVkG~LrVeV  121 (231)
                      .-+=+=+|.|+++.|++.|.++..|
T Consensus        41 ~~~G~WrV~V~~~~G~~l~~~~F~V   65 (66)
T PF11141_consen   41 DQPGDWRVEVVDEDGQVLGSLRFSV   65 (66)
T ss_pred             CCCcCEEEEEEcCCCCEEEEEEEEE
Confidence            4556679999999999999999876


No 38 
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase. E3 ubiquitin ligase is part of the ubiquitylation mechanism responsible for controlling surface expression of membrane proteins.  The sequential action of several enzymes are involved: ubiquitin-activating enzyme E1, ubiquitin-conjugating enzyme E2, and ubiquitin-protein ligase E3 which is responsible for substrate recognition and promoting the transfer of ubiquitin to the target protein.  E3 ubiquitin ligase is composed of an N-terminal C2 domain, 4 WW domains, and a HECTc domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction e
Probab=37.45  E-value=73  Score=24.90  Aligned_cols=42  Identities=21%  Similarity=0.194  Sum_probs=27.5

Q ss_pred             ceeEEeeeeeeccccccc--cccc---eeEEEEcC---CCCeeEEEEEEE
Q psy7944          80 WFRLVGRAFVYLSNLMYP--IPLI---QKVAIVNE---KGDVKGHLKIAV  121 (231)
Q Consensus        80 ~fsLIGrA~VyLsnLly~--V~L~---~~VpIVse---kGEVkG~LrVeV  121 (231)
                      ...+||++.+.|+.|+..  -.+.   -.+++...   .|-+.|+|.|++
T Consensus        75 ~~~~iG~~~i~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~  124 (125)
T cd04021          75 ADVLLGEASLDLSDILKNHNGKLENVKLTLNLSSENKGSSVKVGELTVIL  124 (125)
T ss_pred             CCcEEEEEEEEHHHhHhhcCCCccceEEEEEEEccCCCcceeeeeEEEEe
Confidence            347899999999888732  1222   24555533   457889998875


No 39 
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon. A single C2 domain is found in PKC epsilon. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1 (alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that
Probab=36.07  E-value=67  Score=25.00  Aligned_cols=37  Identities=14%  Similarity=0.205  Sum_probs=24.3

Q ss_pred             eeEEeeeeeecccccc--ccccceeEEEEcCCCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMY--PIPLIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly--~V~L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      ..+||++.+.|+.|..  .-..+.-+++-     ..|+|+|.|.
T Consensus        89 ~~~iG~~~i~l~~l~~~~~~~~~~w~~L~-----~~G~l~l~~~  127 (132)
T cd04014          89 DDFVANCTISFEDLIQRGSGSFDLWVDLE-----PQGKLHVKIE  127 (132)
T ss_pred             CceEEEEEEEhHHhcccCCCcccEEEEcc-----CCcEEEEEEE
Confidence            4679999999998886  34455556653     2356666554


No 40 
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphate
Probab=35.29  E-value=40  Score=27.17  Aligned_cols=40  Identities=18%  Similarity=0.106  Sum_probs=31.6

Q ss_pred             ceeEEeeeeeeccccccccccceeEEEEcCC---CCeeEEEEE
Q psy7944          80 WFRLVGRAFVYLSNLMYPIPLIQKVAIVNEK---GDVKGHLKI  119 (231)
Q Consensus        80 ~fsLIGrA~VyLsnLly~V~L~~~VpIVsek---GEVkG~LrV  119 (231)
                      ...+||++.+.|+.|.......+.+|+.+.+   ++..|.|+.
T Consensus        83 ~dd~lG~~~i~l~~l~~~~~~~~~~~L~~~~~~~~~~~g~l~~  125 (126)
T cd08379          83 PDVLIGKVRIRLSTLEDDRVYAHSYPLLSLNPSGVKKMGELEC  125 (126)
T ss_pred             CCceEEEEEEEHHHccCCCEEeeEEEeEeCCCCCccCCcEEEe
Confidence            3578999999999999888889999998753   345577664


No 41 
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins. Domain present in all 3 forms of cellular life. Present in two copies in inosine monophosphate dehydrogenase, of which one is disordered in the crystal structure [3]. A number of disease states are associated with CBS-containing proteins including homocystinuria, Becker's and Thomsen disease.
Probab=35.17  E-value=35  Score=19.85  Aligned_cols=19  Identities=26%  Similarity=0.599  Sum_probs=15.0

Q ss_pred             ceeEEEEcCCCCeeEEEEE
Q psy7944         101 IQKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       101 ~~~VpIVsekGEVkG~LrV  119 (231)
                      .+.++|++.+|++.|.+..
T Consensus        23 ~~~~~v~~~~~~~~g~i~~   41 (49)
T smart00116       23 IRRLPVVDEEGRLVGIVTR   41 (49)
T ss_pred             CCcccEECCCCeEEEEEEH
Confidence            3578999988989898763


No 42 
>PF02743 Cache_1:  Cache domain;  InterPro: IPR004010 Cache is an extracellular domain that is predicted to have a role in small-molecule recognition in a wide range of proteins, including the animal dihydropyridine-sensitive voltage-gated Ca2+ channel; alpha-2delta subunit, and various bacterial chemotaxis receptors. The name Cache comes from CAlcium channels and CHEmotaxis receptors. This domain consists of an N-terminal part with three predicted strands and an alpha-helix, and a C-terminal part with a strand dyad followed by a relatively unstructured region. The N-terminal portion of the (unpermuted) Cache domain contains three predicted strands that could form a sheet analogous to that present in the core of the PAS domain structure. Cache domains are particularly widespread in bacteria, with Vibrio cholerae. The animal calcium channel alpha-2delta subunits might have acquired a part of their extracellular domains from a bacterial source []. The Cache domain appears to have arisen from the GAF-PAS fold despite their divergent functions [].; GO: 0016020 membrane; PDB: 3C8C_A 3LIB_D 3LIA_A 3LI8_A 3LI9_A.
Probab=34.52  E-value=66  Score=22.86  Aligned_cols=23  Identities=22%  Similarity=0.476  Sum_probs=19.3

Q ss_pred             cceeEEEEcCCCCeeEEEEEEEE
Q psy7944         100 LIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus       100 L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      +...+||.+..|++.|.+-+.+.
T Consensus        15 i~~s~pi~~~~g~~~Gvv~~di~   37 (81)
T PF02743_consen   15 ITISVPIYDDDGKIIGVVGIDIS   37 (81)
T ss_dssp             EEEEEEEEETTTEEEEEEEEEEE
T ss_pred             EEEEEEEECCCCCEEEEEEEEec
Confidence            34478999999999999988775


No 43 
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permu
Probab=33.87  E-value=66  Score=24.40  Aligned_cols=42  Identities=10%  Similarity=0.106  Sum_probs=25.0

Q ss_pred             eeEEeeeeeecccccc---ccccceeEEEEcC----CCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMY---PIPLIQKVAIVNE----KGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly---~V~L~~~VpIVse----kGEVkG~LrVeVq  122 (231)
                      ..+||.+.+.|+.+..   .-....-+++-+.    ++.+.|.|++.++
T Consensus        79 ~~~lG~~~i~l~~~~~~~~~~~~~~w~~L~~~~~~~~~~~~G~i~l~~~  127 (128)
T cd04024          79 KDYLGEFDIALEEVFADGKTGQSDKWITLKSTRPGKTSVVSGEIHLQFS  127 (128)
T ss_pred             CCcceEEEEEHHHhhcccccCccceeEEccCcccCccccccceEEEEEE
Confidence            3578888888888762   1123334455443    2347788877763


No 44 
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=32.88  E-value=47  Score=23.52  Aligned_cols=18  Identities=22%  Similarity=0.479  Sum_probs=15.6

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      +.+||+++.|++.|.++.
T Consensus        84 ~~~~Vv~~~g~~~Gvi~~  101 (107)
T cd04610          84 SKLPVVDENNNLVGIITN  101 (107)
T ss_pred             CeEeEECCCCeEEEEEEH
Confidence            578999999999999864


No 45 
>COG2947 Uncharacterized conserved protein [Function unknown]
Probab=32.80  E-value=22  Score=30.81  Aligned_cols=61  Identities=30%  Similarity=0.335  Sum_probs=37.0

Q ss_pred             CCCCCCCCCCC-----CCceeEEeeeeeeccccccccccceeEEEEc--CCCCeeEEEEEEEEEecCCCc
Q psy7944          67 SLTGGDPFYDR-----FPWFRLVGRAFVYLSNLMYPIPLIQKVAIVN--EKGDVKGHLKIAVQIVTDEES  129 (231)
Q Consensus        67 ~~~~~DPFYD~-----~p~fsLIGrA~VyLsnLly~V~L~~~VpIVs--ekGEVkG~LrVeVqpisd~e~  129 (231)
                      .++-.+|+||+     .|.-.+|++++|  ..+..+|+|.+-=+--.  ..+.++-.-|++|+|++.++-
T Consensus        76 q~d~~spYyDPka~~e~pRW~~Vdv~~v--~~~~~~vtL~~lK~~~~~~~~~~l~~g~RLSV~PVt~~ew  143 (156)
T COG2947          76 QFDPASPYYDPKATPEDPRWYCVDVRFV--RKLPRPVTLKELKANPELAEMSLLVKGNRLSVQPVTPEEW  143 (156)
T ss_pred             ccCCCCcccCcccccCCCCeeEEeeHHH--hhcCCCccHHHHhcCcchhhhhhhhccCeeeeeeCCHHHH
Confidence            45667899987     455667999888  45555555443111111  123344446899999977654


No 46 
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=31.26  E-value=53  Score=24.28  Aligned_cols=18  Identities=28%  Similarity=0.732  Sum_probs=15.5

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      +.+||++.+|++.|.+..
T Consensus       100 ~~lpVvd~~~~~vGiit~  117 (123)
T cd04627         100 SSVAVVDNQGNLIGNISV  117 (123)
T ss_pred             ceEEEECCCCcEEEEEeH
Confidence            479999999999998863


No 47 
>cd08375 C2_Intersectin C2 domain present in Intersectin. A single instance of the C2 domain is located C terminally in the intersectin protein.  Intersectin functions as a scaffolding protein, providing a link between the actin cytoskeleton and the components of endocytosis and plays a role in signal transduction.   In addition to C2, intersectin contains several additional domains including: Eps15 homology domains, SH3 domains, a RhoGEF domain, and a PH domain.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking pro
Probab=30.57  E-value=86  Score=25.16  Aligned_cols=38  Identities=11%  Similarity=0.364  Sum_probs=23.4

Q ss_pred             eEEeeeeeecccccc-----ccccceeEEEEcCCCCeeEEEEEEEE
Q psy7944          82 RLVGRAFVYLSNLMY-----PIPLIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        82 sLIGrA~VyLsnLly-----~V~L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      .+||.+.+.|+.|..     .-++..++++   ++--+|.+++++.
T Consensus        92 ~~lG~~~i~l~~l~~~~~~~~~~~~~~~~~---~~~~~g~i~l~~~  134 (136)
T cd08375          92 DFLGRTEIRVADILKETKESKGPITKRLLL---HEVPTGEVVVKLD  134 (136)
T ss_pred             CeeEEEEEEHHHhccccccCCCcEEEEecc---ccccceeEEEEEE
Confidence            578888888888875     3333334443   4555566666653


No 48 
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP). MCTPs are involved in Ca2+ signaling at the membrane.  MCTP is composed of a variable N-terminal sequence, three C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular protei
Probab=28.88  E-value=1.1e+02  Score=22.97  Aligned_cols=38  Identities=18%  Similarity=0.225  Sum_probs=26.4

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAVQ  122 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~LrVeVq  122 (231)
                      ..+||++.+.|+.|.-.-....-+++-..    .|.|++++.
T Consensus        76 ~~~iG~~~~~l~~l~~~~~~~~w~~L~~~----~G~~~~~~~  113 (116)
T cd08376          76 DEFIGRCEIDLSALPREQTHSLELELEDG----EGSLLLLLT  113 (116)
T ss_pred             CCeEEEEEEeHHHCCCCCceEEEEEccCC----CcEEEEEEE
Confidence            47899999999988766666666666543    366666553


No 49 
>PF08151 FerI:  FerI (NUC094) domain;  InterPro: IPR012968  The ferlin gene family are characterised by multiple tandem C2 domains and a C-terminal transmembrane domain. They are found in a wide range of species and their function remains unknown, however, mutations in its two most well-characterised members, dysferlin and otoferlin, have been implicated in human disease []. This domain is present in proteins of the Ferlin family, which includes Otoferlin, Myoferlin and Dysferlin. It is often located between two C2 domains [].
Probab=27.55  E-value=75  Score=23.96  Aligned_cols=17  Identities=29%  Similarity=0.552  Sum_probs=14.2

Q ss_pred             CCCeeEEEEEEEEEecC
Q psy7944         110 KGDVKGHLKIAVQIVTD  126 (231)
Q Consensus       110 kGEVkG~LrVeVqpisd  126 (231)
                      ...++|+|+|.|..++-
T Consensus        28 ~~G~kGYlKv~i~Vlg~   44 (72)
T PF08151_consen   28 SAGVKGYLKVDISVLGP   44 (72)
T ss_pred             ccCCceEEEEEEEEEcC
Confidence            55699999999999943


No 50 
>KOG3837|consensus
Probab=27.22  E-value=50  Score=33.22  Aligned_cols=46  Identities=22%  Similarity=0.290  Sum_probs=41.1

Q ss_pred             eeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEEEEE---EEecC
Q psy7944          81 FRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAV---QIVTD  126 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~LrVeV---qpisd  126 (231)
                      ..|+|.+++=|+-|-+.+++...+|+.|-+-.|-|.|.|.|   +|+++
T Consensus       460 dkl~gt~nikle~Len~cei~e~~~l~DGRK~vGGkLevKvRiR~Pi~~  508 (523)
T KOG3837|consen  460 DKLTGTGNIKLEILENMCEICEYLPLKDGRKAVGGKLEVKVRIRQPIGD  508 (523)
T ss_pred             cceeceeeeeehhhhcccchhhceeccccccccCCeeEEEEEEecccch
Confidence            46899999999999999999999999999888999999999   45544


No 51 
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain. These proteins are integral membrane proteins with four transmembrane spanning helices. The function of these proteins is uncertain, but they are thought to be transporters. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=26.20  E-value=68  Score=23.41  Aligned_cols=19  Identities=21%  Similarity=0.340  Sum_probs=16.1

Q ss_pred             ceeEEEEcCCCCeeEEEEE
Q psy7944         101 IQKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       101 ~~~VpIVsekGEVkG~LrV  119 (231)
                      .+.+||+++.|++.|.+..
T Consensus       100 ~~~~~Vv~~~g~~~Gvit~  118 (124)
T cd04600         100 HHHVPVVDEDRRLVGIVTQ  118 (124)
T ss_pred             CCceeEEcCCCCEEEEEEh
Confidence            4689999999999998764


No 52 
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=25.54  E-value=53  Score=21.86  Aligned_cols=12  Identities=33%  Similarity=0.628  Sum_probs=8.4

Q ss_pred             eEEEEcCCCCee
Q psy7944         103 KVAIVNEKGDVK  114 (231)
Q Consensus       103 ~VpIVsekGEVk  114 (231)
                      -+|+.|+|||++
T Consensus        12 l~pvy~~kgeik   23 (36)
T PF09151_consen   12 LEPVYNQKGEIK   23 (36)
T ss_dssp             EEEEE-TTS-EE
T ss_pred             EEEeecCCCcEE
Confidence            489999999975


No 53 
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment but the function of the CBS domains in OpuCA remains unknown.  In the related ABC transporter, OpuA, the tandem CBS domains have been shown to function as sensors for ionic strength, whereby they control the transport activity through an electronic switching mechanism. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. They are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyz
Probab=23.49  E-value=86  Score=22.12  Aligned_cols=18  Identities=28%  Similarity=0.525  Sum_probs=15.3

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      ..+||++..|++.|.+..
T Consensus        86 ~~~~vv~~~g~~~Gvit~  103 (109)
T cd04583          86 KYVPVVDEDGKLVGLITR  103 (109)
T ss_pred             ceeeEECCCCeEEEEEeh
Confidence            468999999999998864


No 54 
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms]
Probab=23.41  E-value=77  Score=32.37  Aligned_cols=52  Identities=23%  Similarity=0.277  Sum_probs=37.7

Q ss_pred             CCCCCCCCceeEEeeeeeeccccccccccceeEEEEcCCCCeeEEEEEEEEE
Q psy7944          72 DPFYDRFPWFRLVGRAFVYLSNLMYPIPLIQKVAIVNEKGDVKGHLKIAVQI  123 (231)
Q Consensus        72 DPFYD~~p~fsLIGrA~VyLsnLly~V~L~~~VpIVsekGEVkG~LrVeVqp  123 (231)
                      =||-...+...+=|.++|.-.-=.-...+...+||++++|++.|..-|...-
T Consensus       111 kp~~ggde~a~~~G~~yvS~~kGslg~s~R~~~PI~d~~g~~IGvVsVG~~l  162 (537)
T COG3290         111 KPFQGGDEEAALAGESYVSTAKGSLGKSLRAKVPIFDEDGKQIGVVSVGYLL  162 (537)
T ss_pred             CCccCCCHHHHhCCceeEEEeeccchhhheeecceECCCCCEEEEEEEeeEh
Confidence            4554444445555666666555555678899999999999999999998743


No 55 
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=23.39  E-value=93  Score=23.14  Aligned_cols=17  Identities=29%  Similarity=0.548  Sum_probs=14.9

Q ss_pred             eeEEEEcCCCCeeEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLK  118 (231)
Q Consensus       102 ~~VpIVsekGEVkG~Lr  118 (231)
                      +.+||+++.|++.|.+.
T Consensus       103 ~~l~Vvd~~~~~~Giit  119 (126)
T cd04642         103 HRVWVVDEEGKPIGVIT  119 (126)
T ss_pred             cEEEEECCCCCEEEEEE
Confidence            56999999999999875


No 56 
>PF08275 Toprim_N:  DNA primase catalytic core, N-terminal domain;  InterPro: IPR013264 This is the N-terminal, catalytic core domain of DNA primases. DNA primase (2.7.7 from EC) is a nucleotidyltransferase which synthesizes the oligoribonucleotide primers required for DNA replication on the lagging strand of the replication fork. It can also prime the leading strand and has been implicated in cell division []. ; PDB: 1EQN_E 1DD9_A 3B39_B 1DDE_A 2AU3_A.
Probab=23.25  E-value=64  Score=26.05  Aligned_cols=30  Identities=23%  Similarity=0.329  Sum_probs=18.9

Q ss_pred             eEEEEcCCCCeeEEEEEEEEEecCCCccccccc
Q psy7944         103 KVAIVNEKGDVKGHLKIAVQIVTDEESTDLTGT  135 (231)
Q Consensus       103 ~VpIVsekGEVkG~LrVeVqpisd~e~~d~~~g  135 (231)
                      -+||.|++|+|+|+=-   ..+.++..|+|+..
T Consensus        80 ifPI~d~~G~vvgF~g---R~l~~~~~pKYlNs  109 (128)
T PF08275_consen   80 IFPIRDERGRVVGFGG---RRLDDENPPKYLNS  109 (128)
T ss_dssp             EEEEE-TTS-EEEEEE---EESSSSSS-SEEE-
T ss_pred             EEEEEcCCCCEEEEec---ccCCCCCCCceECC
Confidence            4899999999987643   33366667899854


No 57 
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=23.09  E-value=96  Score=22.76  Aligned_cols=19  Identities=21%  Similarity=0.620  Sum_probs=15.9

Q ss_pred             ceeEEEEcCCCCeeEEEEE
Q psy7944         101 IQKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       101 ~~~VpIVsekGEVkG~LrV  119 (231)
                      .+.+||++..|++.|.+..
T Consensus        96 ~~~l~Vvd~~~~~~Givt~  114 (120)
T cd04641          96 VHRLVVVDENKRVEGIISL  114 (120)
T ss_pred             ccEEEEECCCCCEEEEEEH
Confidence            4689999998999998863


No 58 
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=23.02  E-value=86  Score=22.78  Aligned_cols=18  Identities=28%  Similarity=0.488  Sum_probs=15.5

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      +.+||++..|++.|.+..
T Consensus        99 ~~~~Vvd~~g~~~Gvit~  116 (122)
T cd04635          99 GRLPVVNEKDQLVGIVDR  116 (122)
T ss_pred             CeeeEEcCCCcEEEEEEh
Confidence            468999999999999874


No 59 
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=22.58  E-value=98  Score=22.30  Aligned_cols=19  Identities=32%  Similarity=0.622  Sum_probs=15.9

Q ss_pred             ceeEEEEcCCCCeeEEEEE
Q psy7944         101 IQKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       101 ~~~VpIVsekGEVkG~LrV  119 (231)
                      .+.+||++..|++.|.+..
T Consensus        89 ~~~~~Vv~~~~~~~Gvit~  107 (113)
T cd04607          89 IRHLPILDEEGRVVGLATL  107 (113)
T ss_pred             CCEEEEECCCCCEEEEEEh
Confidence            4579999999999999864


No 60 
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=22.42  E-value=98  Score=22.29  Aligned_cols=18  Identities=11%  Similarity=0.529  Sum_probs=15.3

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      ..+||++..|.+.|.+..
T Consensus        92 ~~~pVvd~~~~~~Gvit~  109 (115)
T cd04620          92 RHLPVLDDQGQLIGLVTA  109 (115)
T ss_pred             ceEEEEcCCCCEEEEEEh
Confidence            469999999999998864


No 61 
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=22.17  E-value=1e+02  Score=22.00  Aligned_cols=18  Identities=22%  Similarity=0.530  Sum_probs=15.3

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      ..+||++..|.+.|.+..
T Consensus        89 ~~~~Vv~~~g~~~Gilt~  106 (112)
T cd04624          89 RHHLVVDKGGELVGVISI  106 (112)
T ss_pred             cEEEEEcCCCcEEEEEEH
Confidence            478999999999998863


No 62 
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins. A single C2 domain is found in Smurf proteins, C2-WW-HECT-domain E3s, which play an important role in the downregulation of the TGF-beta signaling pathway.  Smurf proteins also regulate cell shape, motility, and polarity by degrading small guanosine triphosphatases (GTPases). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are 
Probab=22.08  E-value=1.5e+02  Score=22.97  Aligned_cols=41  Identities=10%  Similarity=0.190  Sum_probs=25.7

Q ss_pred             eeEEeeeeeecccccccc-ccceeEEE----EcCCCCeeEEEEEEE
Q psy7944          81 FRLVGRAFVYLSNLMYPI-PLIQKVAI----VNEKGDVKGHLKIAV  121 (231)
Q Consensus        81 fsLIGrA~VyLsnLly~V-~L~~~VpI----VsekGEVkG~LrVeV  121 (231)
                      ..+||.+.+.|+.|+-.- ......++    .+++|.+.|.|.|.+
T Consensus        77 d~~lG~~~i~l~~l~~~~~~~~~~~~l~~~~~~~~~~~~G~v~~~~  122 (123)
T cd08382          77 QGFLGCVRIRANAVLPLKDTGYQRLDLRKLKKSDNLSVRGKIVVSL  122 (123)
T ss_pred             CceEeEEEEEHHHccccCCCccceeEeecCCCCCCceEeeEEEEEe
Confidence            367888888888876322 22334444    224677888887764


No 63 
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in magnesium and cobalt efflux, and in association with some proteins of unknown function.  The function of the CorC_HlyC domain is uncertain but it might be involved in modulating transport of ion substrates. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role,
Probab=21.86  E-value=98  Score=22.07  Aligned_cols=18  Identities=22%  Similarity=0.379  Sum_probs=15.3

Q ss_pred             ceeEEEEcCCCCeeEEEE
Q psy7944         101 IQKVAIVNEKGDVKGHLK  118 (231)
Q Consensus       101 ~~~VpIVsekGEVkG~Lr  118 (231)
                      ...+||++..|+..|.+.
T Consensus        87 ~~~~~Vv~~~~~~~Gvit  104 (111)
T cd04590          87 SHMAIVVDEYGGTAGLVT  104 (111)
T ss_pred             CcEEEEEECCCCEEEEeE
Confidence            357999999999999885


No 64 
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=21.56  E-value=99  Score=22.50  Aligned_cols=17  Identities=29%  Similarity=0.573  Sum_probs=14.6

Q ss_pred             eeEEEEcCCCCeeEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLK  118 (231)
Q Consensus       102 ~~VpIVsekGEVkG~Lr  118 (231)
                      ..+||++..|.+.|.++
T Consensus        88 ~~lpVvd~~~~~~Giit  104 (111)
T cd04603          88 PVVAVVDKEGKLVGTIY  104 (111)
T ss_pred             CeEEEEcCCCeEEEEEE
Confidence            46899999999999876


No 65 
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generali
Probab=21.38  E-value=1.1e+02  Score=20.94  Aligned_cols=19  Identities=21%  Similarity=0.583  Sum_probs=16.0

Q ss_pred             ceeEEEEcCCCCeeEEEEE
Q psy7944         101 IQKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       101 ~~~VpIVsekGEVkG~LrV  119 (231)
                      .+.+||++..|++.|.+..
T Consensus        89 ~~~~~V~~~~~~~~G~i~~  107 (113)
T cd02205          89 IRRLPVVDDEGRLVGIVTR  107 (113)
T ss_pred             CCEEEEEcCCCcEEEEEEH
Confidence            3679999999999998864


No 66 
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=21.37  E-value=92  Score=22.88  Aligned_cols=18  Identities=17%  Similarity=0.327  Sum_probs=14.8

Q ss_pred             eeEEEEcCC---CCeeEEEEE
Q psy7944         102 QKVAIVNEK---GDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsek---GEVkG~LrV  119 (231)
                      +.+||++..   |.+.|.+.-
T Consensus        92 ~~lpVvd~~~~~~~l~Gvit~  112 (118)
T cd04617          92 DSLPVVEKVDEGLEVIGRITK  112 (118)
T ss_pred             CEeeEEeCCCccceEEEEEEh
Confidence            579999987   789998763


No 67 
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream. The function of the DRTGG domain, named after its conserved residues, is unknown. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=20.60  E-value=1.1e+02  Score=21.99  Aligned_cols=18  Identities=11%  Similarity=0.346  Sum_probs=15.6

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      ..+||+++.|++.|.+..
T Consensus        85 ~~~~Vv~~~~~~~G~it~  102 (108)
T cd04596          85 EMLPVVDDNKKLLGIISR  102 (108)
T ss_pred             CeeeEEcCCCCEEEEEEH
Confidence            678999999999998864


No 68 
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein.  IMPDH is an essential enzyme that catalyzes the first step unique to GTP synthesis, playing a key role in the regulation of cell proliferation and differentiation. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain in IMPDH have been associated with retinitis pigmentosa.
Probab=20.40  E-value=1.1e+02  Score=21.50  Aligned_cols=18  Identities=28%  Similarity=0.785  Sum_probs=15.3

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      ..+||++++|+..|.++.
T Consensus        87 ~~~~Vv~~~~~~~Gvi~~  104 (110)
T cd04601          87 EKLPVVDDEGKLKGLITV  104 (110)
T ss_pred             CeeeEEcCCCCEEEEEEh
Confidence            368999999999999875


No 69 
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=20.10  E-value=1.2e+02  Score=22.18  Aligned_cols=18  Identities=22%  Similarity=0.440  Sum_probs=15.2

Q ss_pred             eeEEEEcCCCCeeEEEEE
Q psy7944         102 QKVAIVNEKGDVKGHLKI  119 (231)
Q Consensus       102 ~~VpIVsekGEVkG~LrV  119 (231)
                      ..+||++..|.+.|.+..
T Consensus        91 ~~lpVvd~~~~~~Gvi~~  108 (114)
T cd04619          91 KNIPVVDENARPLGVLNA  108 (114)
T ss_pred             CeEEEECCCCcEEEEEEh
Confidence            469999999999998863


Done!