Query         psy7974
Match_columns 135
No_of_seqs    104 out of 175
Neff          3.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:35:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7974.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7974hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04704 PLA2_bee_venom_like PL 100.0   1E-30 2.2E-35  189.4   3.0   63   66-128     1-63  (97)
  2 PF05826 Phospholip_A2_2:  Phos 100.0 5.9E-31 1.3E-35  190.6  -0.1   62   67-128     1-62  (99)
  3 cd04705 PLA2_group_III_like PL  99.5 5.2E-15 1.1E-19  108.8   1.9   45   84-128    26-70  (100)
  4 cd00618 PLA2_like PLA2_like: P  99.4 1.5E-13 3.2E-18   93.7   2.0   59   68-128     1-72  (83)
  5 smart00085 PA2c Phospholipase   98.8 2.5E-09 5.3E-14   79.4   1.9   46   64-114    16-61  (117)
  6 cd04706 PLA2_plant PLA2_plant:  97.8 1.3E-05 2.9E-10   60.7   2.4   35   70-106    24-58  (117)
  7 cd00125 PLA2c PLA2c: Phospholi  96.9 0.00026 5.5E-09   53.0   0.0   33   72-110    25-57  (115)
  8 cd04707 otoconin_90 otoconin_9  96.8 0.00028 6.1E-09   53.1   0.0   30   72-107    22-51  (117)
  9 PF08398 Parvo_coat_N:  Parvovi  95.8  0.0014 3.1E-08   45.4  -1.0   44   68-114     1-45  (64)
 10 KOG4087|consensus               94.5  0.0096 2.1E-07   46.9  -0.2   30   72-107    46-75  (144)
 11 PF00068 Phospholip_A2_1:  Phos  92.6   0.015 3.3E-07   42.8  -1.9   31   72-108    26-56  (116)
 12 PF06951 PLA2G12:  Group XII se  36.9      22 0.00047   29.0   1.6   42   63-106    71-112 (184)
 13 PF08036 Antimicrobial_6:  Diap  34.2     9.7 0.00021   24.3  -0.6   12   90-101    15-26  (39)

No 1  
>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of  Phospholipase A2, similar to bee venom PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s.
Probab=99.96  E-value=1e-30  Score=189.36  Aligned_cols=63  Identities=49%  Similarity=0.872  Sum_probs=61.3

Q ss_pred             eeecCCccccCCCCCCCCCCCCCCCccccccccccCCcccccccccccceeCCCCCccceecc
Q psy7974          66 LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWL  128 (135)
Q Consensus        66 ~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a~e~kygl~N~~~~t~~~~~~  128 (135)
                      ||+|||||||+||+|.+|+|||.+.+||+|||+||+||++|+++++|||++|.+|+|+.-|.|
T Consensus         1 ~~~pGTkWCG~Gn~a~~~~dlG~~~~tD~CCr~HD~C~~~i~~~~~kyg~~N~~~~t~~~C~C   63 (97)
T cd04704           1 FIVPGTKWCGPGNIATNYSDLGAFRETDKCCREHDHCPDIISAGEYKYGLTNTRLFTRSHCDC   63 (97)
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchHHHccccCcCcccccccccCccCCCccccccCcH
Confidence            589999999999999999999999999999999999999999999999999999999998876


No 2  
>PF05826 Phospholip_A2_2:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1POC_A.
Probab=99.96  E-value=5.9e-31  Score=190.56  Aligned_cols=62  Identities=45%  Similarity=0.918  Sum_probs=46.5

Q ss_pred             eecCCccccCCCCCCCCCCCCCCCccccccccccCCcccccccccccceeCCCCCccceecc
Q psy7974          67 IFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWL  128 (135)
Q Consensus        67 i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a~e~kygl~N~~~~t~~~~~~  128 (135)
                      |+|||||||+||+|.+|+|||.+.+||+|||+||+||++|+++++||||+|..++|++-|-|
T Consensus         1 i~pGT~WCG~gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~~hC~C   62 (99)
T PF05826_consen    1 IYPGTKWCGPGNIAKNYSDLGEFKETDRCCREHDHCPDKIPPGETKYGLHNPRPFTISHCDC   62 (99)
T ss_dssp             B-TT-SSSBSS---SSTT---SSHHHHHHHHHHHT-SSEE-TT-EETTEE--SSS-EEBHHH
T ss_pred             CCCCCcccCCCCCccCcccccccHHHHHHHHhhccCCCccCCCccccccccCCcCceeecCc
Confidence            79999999999999999999999999999999999999999999999999999999998766


No 3  
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of  Phospholipase A2, similar to human group III PLA2. PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers.
Probab=99.50  E-value=5.2e-15  Score=108.77  Aligned_cols=45  Identities=24%  Similarity=0.365  Sum_probs=42.3

Q ss_pred             CCCCCCCccccccccccCCcccccccccccceeCCCCCccceecc
Q psy7974          84 NDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWL  128 (135)
Q Consensus        84 ~dLG~~~~tD~CCR~HD~Cp~~I~a~e~kygl~N~~~~t~~~~~~  128 (135)
                      .+||.+.++|+|||+||+||++|.++|+||||+|.+++|++=|=|
T Consensus        26 ~~lG~~~~~DrCCR~HD~Cp~~I~~~~~k~gl~N~~~~tisHCdC   70 (100)
T cd04705          26 LSEGEFKEPDRCCWKHKQCPGHIIPPFSSDGHHNFHLHSVSHCDC   70 (100)
T ss_pred             cccccccchhhhhhhhhcCccccCCcccccceecCCCcccccccH
Confidence            799999999999999999999999999999999999999986643


No 4  
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately 
Probab=99.38  E-value=1.5e-13  Score=93.71  Aligned_cols=59  Identities=29%  Similarity=0.419  Sum_probs=51.7

Q ss_pred             ecCCccccCCCCCCCCCCCCCCCccccccccccCCcccccccccccc-------------eeCCCCCccceecc
Q psy7974          68 FPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHG-------------LDTFSGLALFPAWL  128 (135)
Q Consensus        68 ~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a~e~kyg-------------l~N~~~~t~~~~~~  128 (135)
                      .|+++|||.|..+.++.+++  .++|+|||+||+|++.|...+.+++             +.|.++.+++-|-|
T Consensus         1 ~~ygc~CG~g~~~~~~g~p~--D~~D~CC~~HD~Cy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~C~C   72 (83)
T cd00618           1 LPYGCYCGPGGSACPSGQPV--DETDRCCRKHDCCYDQISDGGCCDGCLSYSFSEGGVTCLTNSDLCTRSHCDC   72 (83)
T ss_pred             CCcCcccCCCCcCCCCCCCC--CcchhhhhhCccHhhhhhccCCCCCcceeeecCCceeECCCCChhhHhhCcc
Confidence            37899999999999888877  7999999999999999999999988             67877777776654


No 5  
>smart00085 PA2c Phospholipase A2.
Probab=98.78  E-value=2.5e-09  Score=79.40  Aligned_cols=46  Identities=22%  Similarity=0.240  Sum_probs=38.3

Q ss_pred             CceeecCCccccCCCCCCCCCCCCCCCccccccccccCCcccccccccccc
Q psy7974          64 SDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHG  114 (135)
Q Consensus        64 ~~~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a~e~kyg  114 (135)
                      +.++.+++.||+-|+.+....    ..+||+|||+||+|++.|++ +..++
T Consensus        16 ~~~~~y~~YGCyCG~gg~G~p----vD~~D~CC~~HD~Cy~~~~~-~~C~~   61 (117)
T smart00085       16 RAWLSYGDYGCYCGWGGSGTP----VDATDRCCFVHDCCYGKAEK-EGCNP   61 (117)
T ss_pred             CcccchhccCcccCCCCCCCc----cccccchhhhcCchhhhccc-CCCcc
Confidence            467899999999999886552    78999999999999999987 44443


No 6  
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of  Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. This sub-family does not appear to have a conserved active site and metal-binding loop.
Probab=97.79  E-value=1.3e-05  Score=60.67  Aligned_cols=35  Identities=29%  Similarity=0.557  Sum_probs=28.5

Q ss_pred             CCccccCCCCCCCCCCCCCCCccccccccccCCcccc
Q psy7974          70 GTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYI  106 (135)
Q Consensus        70 GTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I  106 (135)
                      -.+|||+|..+..  ++..-..+|+||+.||+|.+..
T Consensus        24 YG~yCG~g~~g~~--~~~P~D~lD~CC~~HD~Cy~~~   58 (117)
T cd04706          24 YGKYCGPGYSGCP--GERPCDDLDACCMTHDACVQAK   58 (117)
T ss_pred             cCcccCCCCCCCC--CCCCcchhhHHHHhCcCcccCC
Confidence            7899999998732  3445689999999999999864


No 7  
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in 
Probab=96.87  E-value=0.00026  Score=52.98  Aligned_cols=33  Identities=33%  Similarity=0.715  Sum_probs=25.8

Q ss_pred             ccccCCCCCCCCCCCCCCCccccccccccCCcccccccc
Q psy7974          72 KWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKS  110 (135)
Q Consensus        72 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a~e  110 (135)
                      -|||.|....+-      ..+|+||+.||.|...+...+
T Consensus        25 CyCG~GG~G~Pv------D~~DrCC~~HD~CY~~~~~~~   57 (115)
T cd00125          25 CYCGLGGSGTPV------DDTDRCCQVHDCCYDRAEKGG   57 (115)
T ss_pred             CccCCCCCCCCc------ccHHHHHHHHHhHHhccccCC
Confidence            488888766544      578999999999999876433


No 8  
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia. Interactions involving otoconin-90 may trigger or constitute key events in otoconia formation. The PLA2-like domains in otoconins may have lost their metal-binding sites.
Probab=96.83  E-value=0.00028  Score=53.14  Aligned_cols=30  Identities=30%  Similarity=0.595  Sum_probs=23.2

Q ss_pred             ccccCCCCCCCCCCCCCCCccccccccccCCccccc
Q psy7974          72 KWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYIL  107 (135)
Q Consensus        72 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~  107 (135)
                      -|||.|....+-      .++|+||..||.|...+.
T Consensus        22 CyCG~GG~G~Pv------D~~DrCC~~HD~CY~~~~   51 (117)
T cd04707          22 CYCGQEGEGLPV------DELDRCCFQHRCCLEQAS   51 (117)
T ss_pred             CcccCCCCCCCc------ccchhHHHHhHHHHhhhh
Confidence            477777655443      589999999999999765


No 9  
>PF08398 Parvo_coat_N:  Parvovirus coat protein VP1;  InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides. Parvoviruses have been described that infect a wide range of invertebrates and vertebrates and are well known for causing enteric disease in mammals. Genomes contains two large ORFs: NS1 and VP1; other ORFs are found in some sub-types and different gene products can arise from splice variants and the use of different start codons [].  This is the N-terminal region of the Parvovirus VP1 coat protein []; its function is not known. ; GO: 0005198 structural molecule activity, 0019028 viral capsid
Probab=95.83  E-value=0.0014  Score=45.36  Aligned_cols=44  Identities=20%  Similarity=0.305  Sum_probs=32.7

Q ss_pred             ecCCccccCCCCCCCCCCCCCCCccccccccccCCccc-ccccccccc
Q psy7974          68 FPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEY-ILAKSSLHG  114 (135)
Q Consensus        68 ~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~-I~a~e~kyg  114 (135)
                      +||++++||||.-.+-.   .-..+|..||+||.+.+. |..+..-|=
T Consensus         1 lPg~~YlGPgn~l~~g~---Pv~~~D~aA~~HD~aY~~~lk~G~NPY~   45 (64)
T PF08398_consen    1 LPGYKYLGPGNPLDNGE---PVNPVDAAAREHDEAYDELLKHGDNPYL   45 (64)
T ss_pred             CCCCCccCCCCCcCCCC---CCCHHHHHHHHHHHHHHHHHHcCCCCce
Confidence            59999999999865443   346899999999988875 444444343


No 10 
>KOG4087|consensus
Probab=94.48  E-value=0.0096  Score=46.89  Aligned_cols=30  Identities=30%  Similarity=0.686  Sum_probs=24.6

Q ss_pred             ccccCCCCCCCCCCCCCCCccccccccccCCccccc
Q psy7974          72 KWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYIL  107 (135)
Q Consensus        72 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~  107 (135)
                      =|||-|-+..+-      .++|+||-.||.|.+..+
T Consensus        46 CyCGlGG~G~P~------D~iDwCC~~HDcCY~~le   75 (144)
T KOG4087|consen   46 CYCGLGGSGQPK------DAIDWCCHAHDCCYDRLE   75 (144)
T ss_pred             ccccCCCCCCcc------chHHHHHhcccHHHHHHH
Confidence            478888776655      689999999999998765


No 11 
>PF00068 Phospholip_A2_1:  Phospholipase A2;  InterPro: IPR001211 Phospholipase A2 (3.1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1OQS_F 1S6B_B 1XXW_B 1MH2_B 2RD4_B 1OZ6_A 2OSN_A 2PH4_B 1FDK_A 2BP2_A ....
Probab=92.56  E-value=0.015  Score=42.81  Aligned_cols=31  Identities=35%  Similarity=0.799  Sum_probs=23.0

Q ss_pred             ccccCCCCCCCCCCCCCCCccccccccccCCcccccc
Q psy7974          72 KWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILA  108 (135)
Q Consensus        72 kWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a  108 (135)
                      -|||.|....+      -.++|+||+.||.|..-+..
T Consensus        26 CyCg~~g~G~P------vD~iD~~C~~h~~Cy~~~~~   56 (116)
T PF00068_consen   26 CYCGFGGKGQP------VDEIDRCCRKHDQCYKCAKE   56 (116)
T ss_dssp             TTBSSSSSSS-------SSHHHHHHHHHHHHHHHHTT
T ss_pred             ccCCCCCCCCC------cccccchhHHhHHHHHHHhc
Confidence            38887754433      36799999999999887655


No 12 
>PF06951 PLA2G12:  Group XII secretory phospholipase A2 precursor (PLA2G12);  InterPro: IPR010711 This family consists of several group XII secretory phospholipase A2 precursor (PLA2G12) (3.1.1.4 from EC) proteins. Group XII and group V PLA(2)s are thought to participate in helper T cell immune response through release of immediate second signals and generation of downstream eicosanoids [].; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process, 0005576 extracellular region
Probab=36.93  E-value=22  Score=29.02  Aligned_cols=42  Identities=24%  Similarity=0.538  Sum_probs=25.9

Q ss_pred             CCceeecCCccccCCCCCCCCCCCCCCCccccccccccCCcccc
Q psy7974          63 KSDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYI  106 (135)
Q Consensus        63 ~~~~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I  106 (135)
                      +..+-.|=-+-||+-.....++ .|. ...-.||-+||.|.++=
T Consensus        71 r~g~k~p~~NGCGS~~~G~~~d-~~i-P~~t~CCn~HDiCYdTC  112 (184)
T PF06951_consen   71 RPGYKPPEPNGCGSYFLGLQID-IGI-PAMTKCCNQHDICYDTC  112 (184)
T ss_pred             CCCCCCCCCCCCCCcccCCccc-CCC-CchhccchhhhhHHHcc
Confidence            3444556777899722222222 222 23778999999999863


No 13 
>PF08036 Antimicrobial_6:  Diapausin family of antimicrobial peptide;  InterPro: IPR012525 This family consists of diapausin-related antimicrobial peptides. Diapause during periods of environmental adversity is an essential part of the life cycle of many organisms with the molecular basis being different among animals. Diapause-specific peptides provide anti-fungal activity and act as N-type voltage-gated calcium channel blocker [].; GO: 0050832 defense response to fungus, 0005576 extracellular region; PDB: 2E2F_A.
Probab=34.21  E-value=9.7  Score=24.30  Aligned_cols=12  Identities=50%  Similarity=1.077  Sum_probs=9.5

Q ss_pred             CccccccccccC
Q psy7974          90 VETDKCCRDHDH  101 (135)
Q Consensus        90 ~~tD~CCR~HD~  101 (135)
                      .+-|-|||+|-+
T Consensus        15 ~Er~eCCrAhG~   26 (39)
T PF08036_consen   15 PERDECCRAHGY   26 (39)
T ss_dssp             TTTHHHHHHTT-
T ss_pred             hhHHHHHHHcCc
Confidence            567899999986


Done!