BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy7982
(72 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3EIA|A Chain A, Crystal Structure Of K270q Variant Of Ll-Diaminopimelate
Aminotransferase From Arabidopsis Thaliana Complexed
With L-Glu: External Aldimine Form
pdb|3EIA|B Chain B, Crystal Structure Of K270q Variant Of Ll-Diaminopimelate
Aminotransferase From Arabidopsis Thaliana Complexed
With L-Glu: External Aldimine Form
Length = 432
Score = 25.4 bits (54), Expect = 7.4, Method: Composition-based stats.
Identities = 10/34 (29%), Positives = 20/34 (58%)
Query: 10 SVICLTRENIEALNSKFAAYQEPPSIYLEEYAEL 43
++ CLT E +EA++ Y+E +I ++ + L
Sbjct: 319 ALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSL 352
>pdb|3EI8|A Chain A, Crystal Structure Of K270n Variant Of Ll-Diaminopimelate
Aminotransferase From Arabidopsis Thaliana Complexed
With Ll-Dap: External Aldimine Form
pdb|3EI8|B Chain B, Crystal Structure Of K270n Variant Of Ll-Diaminopimelate
Aminotransferase From Arabidopsis Thaliana Complexed
With Ll-Dap: External Aldimine Form
pdb|3EI9|A Chain A, Crystal Structure Of K270n Variant Of Ll-diaminopimelate
Aminotransferase From Arabidopsis Thaliana Complexed
With L-glu: External Aldimine Form
pdb|3EI9|B Chain B, Crystal Structure Of K270n Variant Of Ll-diaminopimelate
Aminotransferase From Arabidopsis Thaliana Complexed
With L-glu: External Aldimine Form
pdb|3EIB|A Chain A, Crystal Structure Of K270n Variant Of Ll-Diaminopimelate
Aminotransferase From Arabidopsis Thaliana
pdb|3EIB|B Chain B, Crystal Structure Of K270n Variant Of Ll-Diaminopimelate
Aminotransferase From Arabidopsis Thaliana
Length = 432
Score = 25.4 bits (54), Expect = 7.4, Method: Composition-based stats.
Identities = 10/34 (29%), Positives = 20/34 (58%)
Query: 10 SVICLTRENIEALNSKFAAYQEPPSIYLEEYAEL 43
++ CLT E +EA++ Y+E +I ++ + L
Sbjct: 319 ALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSL 352
>pdb|2Z1Z|A Chain A, Crystal Structure Of Ll-diaminopimelate Aminotransferase
From Arabidopsis Thaliana Complexed With L-malate Ion
pdb|2Z1Z|B Chain B, Crystal Structure Of Ll-diaminopimelate Aminotransferase
From Arabidopsis Thaliana Complexed With L-malate Ion
pdb|3EI5|A Chain A, Crystal Structure Of Ll-Diaminopimelate Aminotransferase
From Arabidopsis Thaliana Complexed With Plp-Glu: An
External Aldimine Mimic
pdb|3EI5|B Chain B, Crystal Structure Of Ll-Diaminopimelate Aminotransferase
From Arabidopsis Thaliana Complexed With Plp-Glu: An
External Aldimine Mimic
pdb|3EI6|A Chain A, Crystal Structure Of Ll-Diaminopimelate Aminotransferase
From Arabidopsis Thaliana Complexed With Plp-Dap: An
External Aldimine Mimic
pdb|3EI6|B Chain B, Crystal Structure Of Ll-Diaminopimelate Aminotransferase
From Arabidopsis Thaliana Complexed With Plp-Dap: An
External Aldimine Mimic
pdb|3EI7|A Chain A, Crystal Structure Of Apo-Ll-Diaminopimelate
Aminotransferase From Arabidopsis Thaliana (No Plp)
pdb|3EI7|B Chain B, Crystal Structure Of Apo-Ll-Diaminopimelate
Aminotransferase From Arabidopsis Thaliana (No Plp)
Length = 432
Score = 25.4 bits (54), Expect = 7.4, Method: Composition-based stats.
Identities = 10/34 (29%), Positives = 20/34 (58%)
Query: 10 SVICLTRENIEALNSKFAAYQEPPSIYLEEYAEL 43
++ CLT E +EA++ Y+E +I ++ + L
Sbjct: 319 ALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSL 352
>pdb|4EEB|A Chain A, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EEB|B Chain B, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EEB|C Chain C, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EEB|D Chain D, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EEB|E Chain E, Cora Coiled-Coil Mutant Under Mg2+ Absence
pdb|4EED|A Chain A, Cora Coiled-Coil Mutant Under Mg2+ Presence
pdb|4EED|B Chain B, Cora Coiled-Coil Mutant Under Mg2+ Presence
pdb|4EED|C Chain C, Cora Coiled-Coil Mutant Under Mg2+ Presence
pdb|4EED|D Chain D, Cora Coiled-Coil Mutant Under Mg2+ Presence
pdb|4EED|E Chain E, Cora Coiled-Coil Mutant Under Mg2+ Presence
Length = 330
Score = 25.4 bits (54), Expect = 9.3, Method: Composition-based stats.
Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 7/43 (16%)
Query: 29 YQEPPSIYLEEYAELTSK-------LHELEAREAKLIEERECV 64
+Q P + E Y + K LHELE+ + LI + CV
Sbjct: 73 HQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCV 115
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.313 0.129 0.351
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,803,592
Number of Sequences: 62578
Number of extensions: 52972
Number of successful extensions: 129
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 126
Number of HSP's gapped (non-prelim): 9
length of query: 72
length of database: 14,973,337
effective HSP length: 42
effective length of query: 30
effective length of database: 12,345,061
effective search space: 370351830
effective search space used: 370351830
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)