Diaphorina citri psyllid: psy7


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MFTYHANTDPVRNRIRVSRVQGECIDHHRQGCVQGEELPYMFGAPLVGGMGYFPKNYTKPEIQLSEMLMTYLSNFVRTG
ccCCccccccccEEEEEEcccccccccccccccccccccHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccc
MFTY***TDPVRNRIRVSRVQGECIDHHRQGCVQGEELPYMFGAPLVGGMGYFPKNYTKPEIQLSEMLMTYLSNFVRTG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTYHANTDPVRNRIRVSRVQGECIDHHRQGCVQGEELPYMFGAPLVGGMGYFPKNYTKPEIQLSEMLMTYLSNFVRTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097090 [BP]presynaptic membrane organizationprobableGO:0016044, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0035418 [BP]protein localization to synapseprobableGO:0033036, GO:0008104, GO:0008150, GO:0051179
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0060077 [CC]inhibitory synapseprobableGO:0005575, GO:0045202
GO:0051965 [BP]positive regulation of synapse assemblyprobableGO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0051128, GO:0023052, GO:0050789, GO:0044699, GO:0044087, GO:0065007, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050793, GO:0050877, GO:0009987, GO:0050794, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051094, GO:0051963, GO:0051962, GO:0051960, GO:2000026, GO:0044763, GO:0044089, GO:0048522
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0097116 [BP]gephyrin clusteringprobableGO:0008104, GO:0070727, GO:0001941, GO:0071840, GO:0034613, GO:0016043, GO:0061024, GO:0044763, GO:0072657, GO:0016044, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0097119 [BP]postsynaptic density protein 95 clusteringprobableGO:0008104, GO:0070727, GO:0001941, GO:0071840, GO:0034613, GO:0016043, GO:0061024, GO:0044763, GO:0072657, GO:0016044, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0097104 [BP]postsynaptic membrane assemblyprobableGO:0007416, GO:0050808, GO:0061024, GO:0022607, GO:0007275, GO:0071840, GO:0001941, GO:0016043, GO:0044091, GO:0044699, GO:0071709, GO:0032502, GO:0032501, GO:0009987, GO:0044763, GO:0048731, GO:0007399, GO:0044707, GO:0048856, GO:0044085, GO:0016044, GO:0008150
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0050804 [BP]regulation of synaptic transmissionprobableGO:0044057, GO:0031644, GO:0050794, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789
GO:0004872 [MF]receptor activityprobableGO:0003674
GO:0007158 [BP]neuron cell-cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BIX, chain A
Confidence level:very confident
Coverage over the Query: 9-79
View the alignment between query and template
View the model in PyMOL