Query         psy8
Match_columns 50
No_of_seqs    145 out of 745
Neff          6.2 
Searched_HMMs 46136
Date          Sat Aug 17 00:13:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03028 Dynein_heavy:  Dynein   99.6 4.1E-16   9E-21  109.1   2.2   49    1-49    581-631 (707)
  2 PF06714 Gp5_OB:  Gp5 N-termina  67.2       3 6.5E-05   25.5   1.0   37    8-44     13-57  (144)
  3 PHA02926 zinc finger-like prot  65.5     3.2 6.9E-05   27.3   0.9   31    3-42     73-103 (242)
  4 PF04831 Popeye:  Popeye protei  58.5      11 0.00024   23.3   2.3   16    2-17     37-52  (153)
  5 PF10438 Cyc-maltodext_C:  Cycl  58.3     4.7  0.0001   22.0   0.6   13   30-42      6-18  (78)
  6 PHA02596 5 baseplate hub subun  56.5      10 0.00022   27.8   2.2   38    8-45     44-89  (576)
  7 PF02566 OsmC:  OsmC-like prote  54.0      12 0.00026   19.7   1.8   22    2-23     25-46  (100)
  8 PF10764 Gin:  Inhibitor of sig  48.6      19  0.0004   17.8   1.9   14   29-42      7-20  (46)
  9 cd01763 Sumo Small ubiquitin-r  45.0      14  0.0003   19.8   1.2   20    2-21     39-58  (87)
 10 PF08487 VIT:  Vault protein in  41.8      54  0.0012   18.4   3.3   36    8-43      1-55  (118)
 11 PF11623 DUF3252:  Protein of u  40.8      12 0.00026   19.4   0.5   11   39-49     33-43  (53)
 12 TIGR03562 osmo_induc_OsmC pero  35.5      43 0.00094   19.6   2.3   23    2-24     61-83  (135)
 13 COG5654 Uncharacterized conser  33.4      20 0.00043   22.4   0.7   16   30-50     26-41  (163)
 14 PF11976 Rad60-SLD:  Ubiquitin-  33.1      20 0.00043   18.1   0.5   19    2-20     28-47  (72)
 15 KOG2964|consensus               31.7      25 0.00055   24.4   1.0   22    1-23    178-199 (361)
 16 PF00035 dsrm:  Double-stranded  31.5      69  0.0015   15.4   3.8   13    1-13      5-17  (67)
 17 cd06601 GH31_lyase_GLase GLase  30.7      33 0.00071   23.0   1.4   19    5-23     33-51  (332)
 18 cd06595 GH31_xylosidase_XylS-l  29.6      38 0.00083   21.9   1.5   16    6-21     35-50  (292)
 19 PF14026 DUF4242:  Protein of u  29.3      43 0.00094   17.9   1.5   14    3-16     62-75  (77)
 20 TIGR00296 uncharacterized prot  29.3      58  0.0013   20.5   2.3   34   12-45     97-147 (200)
 21 TIGR03563 perox_SACOL1771 pero  28.6      87  0.0019   17.8   2.8   20    3-22     61-80  (138)
 22 KOG1769|consensus               28.5      51  0.0011   19.0   1.8   21    3-23     49-69  (99)
 23 COG1660 Predicted P-loop-conta  28.2      50  0.0011   22.4   1.9   22    3-24    169-191 (286)
 24 cd06593 GH31_xylosidase_YicI Y  27.8      49  0.0011   21.3   1.8   18    5-22     33-50  (308)
 25 TIGR00313 cobQ cobyric acid sy  27.6      31 0.00066   24.1   0.9    9   34-42    417-425 (475)
 26 cd06591 GH31_xylosidase_XylS X  27.3      44 0.00095   21.9   1.5   15    6-20     34-48  (319)
 27 COG1564 THI80 Thiamine pyropho  27.3      30 0.00065   22.2   0.7   14   36-49    159-172 (212)
 28 PRK10738 hypothetical protein;  27.2      55  0.0012   19.0   1.8   22    2-23     53-74  (134)
 29 PF08577 PI31_Prot_C:  PI31 pro  26.5      23  0.0005   18.9   0.1   12   38-49     59-70  (73)
 30 cd06602 GH31_MGAM_SI_GAA This   25.9      39 0.00085   22.4   1.1   18    6-23     34-51  (339)
 31 cd06598 GH31_transferase_CtsZ   25.9      52  0.0011   21.6   1.7   16    6-21     34-49  (317)
 32 cd06589 GH31 The enzymes of gl  25.8      45 0.00097   21.2   1.3   19    5-23     33-51  (265)
 33 cd06603 GH31_GANC_GANAB_alpha   25.3      47   0.001   21.9   1.4   17    5-21     33-49  (339)
 34 cd06594 GH31_glucosidase_YihQ   24.5      53  0.0011   21.6   1.5   14    5-18     32-45  (317)
 35 cd06599 GH31_glycosidase_Aec37  24.3      57  0.0012   21.4   1.6   14    6-19     39-52  (317)
 36 cd06600 GH31_MGAM-like This fa  24.1      49  0.0011   21.7   1.3   18    6-23     34-51  (317)
 37 PF11020 DUF2610:  Domain of un  23.9      11 0.00023   21.2  -1.6   16    1-16     57-72  (82)
 38 COG4972 PilM Tfp pilus assembl  23.3   1E+02  0.0022   21.5   2.7   23    2-24    109-131 (354)
 39 cd06604 GH31_glucosidase_II_Ma  23.1      51  0.0011   21.7   1.3   16    5-20     33-48  (339)
 40 PF02760 HIN:  HIN-200/IF120x d  23.1      61  0.0013   20.4   1.5   12   31-42    110-121 (170)
 41 PF05692 Myco_haema:  Mycoplasm  23.0      99  0.0022   22.2   2.7   18   29-46    335-353 (439)
 42 PRK06278 cobyrinic acid a,c-di  22.6      33 0.00071   24.3   0.3   11   33-43    178-188 (476)
 43 cd06597 GH31_transferase_CtsY   22.4      66  0.0014   21.4   1.7   13    6-18     34-46  (340)
 44 PF01745 IPT:  Isopentenyl tran  22.2      27 0.00058   23.0  -0.2   14    3-16    180-193 (233)
 45 COG4352 RPL13 Ribosomal protei  21.8      45 0.00097   19.7   0.7   12    3-14     74-85  (113)
 46 TIGR03561 organ_hyd_perox pero  21.8      69  0.0015   18.2   1.5   20    2-21     59-79  (134)
 47 PHA00911 21 prohead core scaff  21.7   1E+02  0.0022   20.1   2.4   14   31-44     28-41  (212)
 48 PF08284 RVP_2:  Retroviral asp  21.7      73  0.0016   18.5   1.6   23    2-24     48-70  (135)
 49 cd01420 MoaC_PE MoaC family, p  20.6 2.1E+02  0.0046   17.3   3.8   17    8-24     63-79  (140)
 50 PF01212 Beta_elim_lyase:  Beta  20.5      50  0.0011   21.6   0.8    8   40-47    161-168 (290)
 51 PF03969 AFG1_ATPase:  AFG1-lik  20.2      78  0.0017   21.5   1.7   11   29-39     59-69  (362)
 52 PF01229 Glyco_hydro_39:  Glyco  20.1      81  0.0018   21.9   1.8   21    3-23    217-237 (486)

No 1  
>PF03028 Dynein_heavy:  Dynein heavy chain and region D6 of dynein motor;  InterPro: IPR004273 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.  Dynein is composed of a number of ATP-binding large subunits, intermediate size subunits and small subunits (see IPR001372 from INTERPRO). This family represents the C-terminal region of dynein heavy chain. The dynein heavy chain also exhibits ATPase activity and microtubule binding ability and acts as a motor for the movement of organelles and vesicles along microtubules. ; GO: 0003777 microtubule motor activity, 0007018 microtubule-based movement, 0030286 dynein complex; PDB: 3VKG_A 3VKH_C 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=99.59  E-value=4.1e-16  Score=109.07  Aligned_cols=49  Identities=57%  Similarity=1.007  Sum_probs=28.0

Q ss_pred             ChhhhhhcCCCceEEEeEEEEEecc--CCCCCCCCeEEEeeeeEeeeccCC
Q psy8              1 MQNYARKMTIPIDHLTFDFVVLQIN--KSEAPPEDGVYCYGLFLDGARWDR   49 (50)
Q Consensus         1 lQ~~ARk~~ipiD~l~~~~~v~~~~--~~~~~p~~GvyI~GLfLeGA~Wd~   49 (50)
                      +|++||++++|||+|.|.++|++.+  +...+|++|+||+|||||||+||.
T Consensus       581 rQ~~AR~~~~~ld~L~l~~~v~~~~~~~~~~~~~~g~~I~GL~leGA~wd~  631 (707)
T PF03028_consen  581 RQEYARKNKIPLDQLTLSFEVTSSEDENIRSPPEDGVYIHGLFLEGARWDG  631 (707)
T ss_dssp             HHHHHHHTT-----EE--EE--------------EEEEE-SEEEESSEEET
T ss_pred             HHHHHHhcCcCchhcceeEEEEeccccccccccccceEEEeEEecccEecc
Confidence            5999999999999999999999863  344578999999999999999996


No 2  
>PF06714 Gp5_OB:  Gp5 N-terminal OB domain;  InterPro: IPR009590 This domain is found at the N terminus of the Gp5 baseplate protein of Bacteriophage T4. This domain binds to the Gp27 protein []. This domain has the common OB fold [].; PDB: 1K28_A 1WTH_A 2Z6B_A.
Probab=67.15  E-value=3  Score=25.53  Aligned_cols=37  Identities=27%  Similarity=0.438  Sum_probs=18.8

Q ss_pred             cCCCceEEEeEEEEEecc--------CCCCCCCCeEEEeeeeEee
Q psy8              8 MTIPIDHLTFDFVVLQIN--------KSEAPPEDGVYCYGLFLDG   44 (50)
Q Consensus         8 ~~ipiD~l~~~~~v~~~~--------~~~~~p~~GvyI~GLfLeG   44 (50)
                      ..+|.++|-|-.-++...        ........|++|.|+||+.
T Consensus        13 ~giPTE~LPW~~v~~p~tsa~~sG~G~S~tgl~~Gs~V~GfflD~   57 (144)
T PF06714_consen   13 EGIPTEDLPWASVMQPTTSASISGIGGSPTGLVEGSHVFGFFLDK   57 (144)
T ss_dssp             B---GGGS-EEEE---TT---BTTBSS-S----TT-EEEEEESST
T ss_pred             cccccccCcccceeccccccccCccCCCCCcccccCEEEEEEecc
Confidence            479999999987776641        2223356899999999984


No 3  
>PHA02926 zinc finger-like protein; Provisional
Probab=65.47  E-value=3.2  Score=27.35  Aligned_cols=31  Identities=26%  Similarity=0.346  Sum_probs=20.9

Q ss_pred             hhhhhcCCCceEEEeEEEEEeccCCCCCCCCeEEEeeeeE
Q psy8              3 NYARKMTIPIDHLTFDFVVLQINKSEAPPEDGVYCYGLFL   42 (50)
Q Consensus         3 ~~ARk~~ipiD~l~~~~~v~~~~~~~~~p~~GvyI~GLfL   42 (50)
                      +.||..++.+|+|+++..-         .+.-..|||+|+
T Consensus        73 ~~s~e~~i~~~~l~~~i~~---------~~~~~~i~G~~i  103 (242)
T PHA02926         73 NLSRDTGIQQSKLTETIRN---------CQKNRNIYGLYI  103 (242)
T ss_pred             hhhHhhCcchhhhhhhhhh---------ccccceEEEEEe
Confidence            5677888999998876432         233446777775


No 4  
>PF04831 Popeye:  Popeye protein conserved region;  InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle. It is represented by a conserved region which includes three potential transmembrane domains []. The strong conservation of POP genes during evolution and their preferential expression in heart and skeletal muscle suggest that these novel proteins may have an important function in these tissues in vertebrates.; GO: 0016020 membrane
Probab=58.49  E-value=11  Score=23.26  Aligned_cols=16  Identities=38%  Similarity=0.667  Sum_probs=13.5

Q ss_pred             hhhhhhcCCCceEEEe
Q psy8              2 QNYARKMTIPIDHLTF   17 (50)
Q Consensus         2 Q~~ARk~~ipiD~l~~   17 (50)
                      |+||-...-|+|.|++
T Consensus        37 ~~YAvE~~T~~drLSl   52 (153)
T PF04831_consen   37 ETYAVEGKTPIDRLSL   52 (153)
T ss_pred             ceeeecCCcccceEeE
Confidence            6788888899999887


No 5  
>PF10438 Cyc-maltodext_C:  Cyclo-malto-dextrinase C-terminal domain;  InterPro: IPR019492  This domain is at the very C terminus of cyclo-malto-dextrinase proteins and consists of 8 beta strands, is largely globular and appears to help stabilise the active sites created by upstream domains, IPR015171 from INTERPRO, and IPR006047 from INTERPRO. Cyclo-malto-dextrinases hydrolyse cyclodextrans to maltose and glucose and catalyse trans-glycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. ; PDB: 3EDK_B 3EDD_A 3EDJ_B 3EDE_A 1H3G_B 3EDF_B.
Probab=58.26  E-value=4.7  Score=21.99  Aligned_cols=13  Identities=46%  Similarity=0.963  Sum_probs=8.3

Q ss_pred             CCCCeEEEeeeeE
Q psy8             30 PPEDGVYCYGLFL   42 (50)
Q Consensus        30 ~p~~GvyI~GLfL   42 (50)
                      .|.+|+|+|==+.
T Consensus         6 ~P~~gvYvYfR~~   18 (78)
T PF10438_consen    6 APQDGVYVYFRYY   18 (78)
T ss_dssp             --BTTEEEEEEEE
T ss_pred             CccCCEEEEEEEc
Confidence            4899999984333


No 6  
>PHA02596 5 baseplate hub subunit and tail lysozyme; Provisional
Probab=56.51  E-value=10  Score=27.79  Aligned_cols=38  Identities=32%  Similarity=0.459  Sum_probs=27.8

Q ss_pred             cCCCceEEEeEEEEEecc--------CCCCCCCCeEEEeeeeEeee
Q psy8              8 MTIPIDHLTFDFVVLQIN--------KSEAPPEDGVYCYGLFLDGA   45 (50)
Q Consensus         8 ~~ipiD~l~~~~~v~~~~--------~~~~~p~~GvyI~GLfLeGA   45 (50)
                      +.+|-+.|-|-.-+++..        .......+|+.|+|+||++-
T Consensus        44 ~~~~te~l~w~~~~~~~~~~~~~g~g~~~~~~~~g~~v~g~~~d~~   89 (576)
T PHA02596         44 YGIPTEDLPWMSVIQPITSAAISGIGQSPTGIVEGTHVYGHFLDKW   89 (576)
T ss_pred             cCcccccCccccccccccccccCCCCCCCCccccccEEEEEEeccc
Confidence            578989988877665531        23344578999999999963


No 7  
>PF02566 OsmC:  OsmC-like protein;  InterPro: IPR003718 Osmotically inducible protein C (OsmC) is a stress-induced protein found in Escherichia coli. The transcription of the osmC gene of E. coli is regulated as a function of the phase of growth and is induced during the late exponential phase when the growth rate slows before entry into stationary phase. The transcription is initiated by two overlapping promoters, osmCp1 and osmCp2 [].  An organic hydroperoxide detoxification protein (OHR) from Xanthomonas campestris pv. phaseoli is highly induced by organic hydroperoxides, weakly induced by H2O2, and not induced at all by a superoxide generator. Ohr may be a new type of organic hydroperoxide detoxification protein [, ].; GO: 0006950 response to stress; PDB: 2D7V_A 2BJO_A 1USP_A 2PN2_A 2QL8_A 1N2F_A 1UKK_A 1VLA_D 3CJE_A 2ONF_B ....
Probab=54.05  E-value=12  Score=19.74  Aligned_cols=22  Identities=18%  Similarity=0.120  Sum_probs=16.6

Q ss_pred             hhhhhhcCCCceEEEeEEEEEe
Q psy8              2 QNYARKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         2 Q~~ARk~~ipiD~l~~~~~v~~   23 (50)
                      +.+|++.+++++.+..+.+...
T Consensus        25 ~~~a~~~gi~~~~~~v~v~~~~   46 (100)
T PF02566_consen   25 RMVAEKRGIDLEDLEVEVEGEL   46 (100)
T ss_dssp             HHHHHHTT-EEEEEEEEEEEEE
T ss_pred             HHHHHHcCCCcceEEEEEEEEE
Confidence            5678999999999887777643


No 8  
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=48.61  E-value=19  Score=17.81  Aligned_cols=14  Identities=36%  Similarity=0.793  Sum_probs=11.5

Q ss_pred             CCCCCeEEEeeeeE
Q psy8             29 APPEDGVYCYGLFL   42 (50)
Q Consensus        29 ~~p~~GvyI~GLfL   42 (50)
                      .++.+|..|.|-||
T Consensus         7 ~~~~~GI~I~~~fI   20 (46)
T PF10764_consen    7 KEKEEGIHIYGKFI   20 (46)
T ss_pred             CcCCCCEEEECeEe
Confidence            45677999999887


No 9  
>cd01763 Sumo Small ubiquitin-related modifier (SUMO). Small ubiquitin-related modifier (SUMO) proteins are conjugated to numerous intracellular targets and serve to modulate protein interaction, localization, activity or stability.  SUMO (also known as "Smt3" and "sentrin" in other organisms) is linked to several different pathways, including nucleocytoplasmic transport. Attachment of SUMO to targets proteins is stimulated by PIAS (Protein inhibitor of activated STATs) proteins which serve as E3-like ligases.
Probab=45.03  E-value=14  Score=19.84  Aligned_cols=20  Identities=15%  Similarity=0.416  Sum_probs=16.3

Q ss_pred             hhhhhhcCCCceEEEeEEEE
Q psy8              2 QNYARKMTIPIDHLTFDFVV   21 (50)
Q Consensus         2 Q~~ARk~~ipiD~l~~~~~v   21 (50)
                      +.|+.+.++|.+++.|-|.=
T Consensus        39 ~~y~~~~gi~~~~~rf~f~G   58 (87)
T cd01763          39 EAYCQRQGLSMNSVRFLFDG   58 (87)
T ss_pred             HHHHHHhCCCccceEEEECC
Confidence            46788889999998888763


No 10 
>PF08487 VIT:  Vault protein inter-alpha-trypsin domain;  InterPro: IPR013694 Inter-alpha-trypsin inhibitors (ITIs) consist of one light chain and a variable set of heavy chains. ITIs play a role in extracellular matrix (ECM) stabilisation and tumour metastasis as well as in plasma protease inhibition []. The vault protein inter-alpha-trypsin (VIT) domain described here is found to the N terminus of a von Willebrand factor type A domain (IPR002035 from INTERPRO) in ITI heavy chains (ITIHs) and their precursors. 
Probab=41.77  E-value=54  Score=18.41  Aligned_cols=36  Identities=11%  Similarity=0.241  Sum_probs=22.5

Q ss_pred             cCCCceEEEeEEEEEec-------------c------CCCCCCCCeEEEeeeeEe
Q psy8              8 MTIPIDHLTFDFVVLQI-------------N------KSEAPPEDGVYCYGLFLD   43 (50)
Q Consensus         8 ~~ipiD~l~~~~~v~~~-------------~------~~~~~p~~GvyI~GLfLe   43 (50)
                      +++||.++..+..+.+.             .      .+.-|-.+|+.|+|+.|.
T Consensus         1 ~~~~l~s~~v~~~I~~~~a~t~v~q~f~N~~~~~~E~~y~fpLp~~A~i~~f~~~   55 (118)
T PF08487_consen    1 NQVPLKSVHVKVTIIDRFARTTVTQTFENPSSEPLEAVYSFPLPEGAAISGFSMW   55 (118)
T ss_pred             CCceEEEEEEEEEEEccEEEEEEEEEEECCCCCcEEEEEEeECCCCeEEEEEEEE
Confidence            46788888887777553             0      112234567788887664


No 11 
>PF11623 DUF3252:  Protein of unknown function (DUF3252);  InterPro: IPR021659  This family of proteins has no known function. Some members are annotated as Ssl0352 however this cannot be confirmed. Currently there is no known function. ; PDB: 3C4S_B 2JZ2_A.
Probab=40.83  E-value=12  Score=19.36  Aligned_cols=11  Identities=27%  Similarity=1.150  Sum_probs=8.4

Q ss_pred             eeeEeeeccCC
Q psy8             39 GLFLDGARWDR   49 (50)
Q Consensus        39 GLfLeGA~Wd~   49 (50)
                      +.-.||+.||+
T Consensus        33 aVLFEGGnWdK   43 (53)
T PF11623_consen   33 AVLFEGGNWDK   43 (53)
T ss_dssp             EEEEEETTEEE
T ss_pred             EEEecCCCceE
Confidence            35679999985


No 12 
>TIGR03562 osmo_induc_OsmC peroxiredoxin, OsmC subfamily. Pfam model pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein OsmC, or osmotically induced protein C. The member from Thermus thermophilus was shown to have hydroperoxide peroxidase activity. In many species, this protein is induced by stress and helps resist oxidative stress.
Probab=35.49  E-value=43  Score=19.56  Aligned_cols=23  Identities=9%  Similarity=-0.106  Sum_probs=18.5

Q ss_pred             hhhhhhcCCCceEEEeEEEEEec
Q psy8              2 QNYARKMTIPIDHLTFDFVVLQI   24 (50)
Q Consensus         2 Q~~ARk~~ipiD~l~~~~~v~~~   24 (50)
                      ..+|++.+++++.+..+.++.-.
T Consensus        61 ~~ia~k~~~~~~~~~v~a~~~l~   83 (135)
T TIGR03562        61 SAALAEAGFTPESLDTTATVTLD   83 (135)
T ss_pred             HHHHHHCCCCCceeEEEEEEEEE
Confidence            46789999999998888777654


No 13 
>COG5654 Uncharacterized conserved protein [Function unknown]
Probab=33.45  E-value=20  Score=22.38  Aligned_cols=16  Identities=25%  Similarity=0.717  Sum_probs=12.1

Q ss_pred             CCCCeEEEeeeeEeeeccCCC
Q psy8             30 PPEDGVYCYGLFLDGARWDRT   50 (50)
Q Consensus        30 ~p~~GvyI~GLfLeGA~Wd~~   50 (50)
                      -..+|++|.     |+|||.+
T Consensus        26 ~sG~GA~i~-----GGRWNpk   41 (163)
T COG5654          26 FSGEGAAIF-----GGRWNPK   41 (163)
T ss_pred             cCCCcceec-----ccccCCC
Confidence            347888888     6999864


No 14 
>PF11976 Rad60-SLD:  Ubiquitin-2 like Rad60 SUMO-like;  InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins. SUMOs are small proteins that are covalently attached to lysines as post-translational modifications and are used to control multiple cellular process including signal transduction, nuclear transport and DNA replication and repair []. Unlike ubiquitin, they are not involved in protein degradation.  This entry also contains the C-terminal Rad60 DNA repair protein SUMO-like domain.; PDB: 3RD2_A 2JXX_A 3RCZ_A 3GOE_A 3A4S_D 3A4R_B 2IO1_D 1U4A_A 2K1F_A 1WZ0_A ....
Probab=33.10  E-value=20  Score=18.06  Aligned_cols=19  Identities=26%  Similarity=0.497  Sum_probs=14.6

Q ss_pred             hhhhhhcCCCc-eEEEeEEE
Q psy8              2 QNYARKMTIPI-DHLTFDFV   20 (50)
Q Consensus         2 Q~~ARk~~ipi-D~l~~~~~   20 (50)
                      +.||.+.++|. .++.|.|.
T Consensus        28 ~~~~~~~~i~~~~~~~l~fd   47 (72)
T PF11976_consen   28 EKYCEKKGIPPEESIRLIFD   47 (72)
T ss_dssp             HHHHHHHTTTT-TTEEEEET
T ss_pred             HHHHHhhCCCccceEEEEEC
Confidence            56888889999 77777653


No 15 
>KOG2964|consensus
Probab=31.73  E-value=25  Score=24.36  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=18.0

Q ss_pred             ChhhhhhcCCCceEEEeEEEEEe
Q psy8              1 MQNYARKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         1 lQ~~ARk~~ipiD~l~~~~~v~~   23 (50)
                      ||..+||++ |++-|.|+-+.-.
T Consensus       178 lRAvs~k~G-PV~ilH~DaH~Dt  199 (361)
T KOG2964|consen  178 LRAVSRKYG-PVSILHFDAHLDT  199 (361)
T ss_pred             HHHHHHhhC-CceEEEeccCccc
Confidence            477899999 9999999876543


No 16 
>PF00035 dsrm:  Double-stranded RNA binding motif;  InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions []. It is involved in localisation of at least five different mRNAs in the early Drosophila embryo and by interferon-induced protein kinase in humans, which is part of the cellular response to dsRNA.; GO: 0003725 double-stranded RNA binding, 0005622 intracellular; PDB: 1EKZ_A 1STU_A 1QU6_A 2L2M_A 3ADJ_A 1WHN_A 3LLH_B 2B7V_A 2L3J_A 1UHZ_A ....
Probab=31.46  E-value=69  Score=15.37  Aligned_cols=13  Identities=23%  Similarity=0.529  Sum_probs=9.9

Q ss_pred             ChhhhhhcCCCce
Q psy8              1 MQNYARKMTIPID   13 (50)
Q Consensus         1 lQ~~ARk~~ipiD   13 (50)
                      ||++++++++++.
T Consensus         5 L~e~~~~~~~~~~   17 (67)
T PF00035_consen    5 LNEYCQKNKFPPP   17 (67)
T ss_dssp             HHHHHHHCTSSEE
T ss_pred             HHHHHHHcCCCCC
Confidence            5788999886654


No 17 
>cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end. GLases cleave the bond between C1 and O1 of the nonreducing sugar residue of alpha-glucans to generate a monosaccharide product with a double bond between C1 and C2. This family corresponds to subgroup 2 in the Ernst et al classification of GH31 enzymes.
Probab=30.68  E-value=33  Score=22.98  Aligned_cols=19  Identities=32%  Similarity=0.424  Sum_probs=15.4

Q ss_pred             hhhcCCCceEEEeEEEEEe
Q psy8              5 ARKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         5 ARk~~ipiD~l~~~~~v~~   23 (50)
                      -|+++||+|.+.++..-+.
T Consensus        33 ~r~~~IP~D~i~lDidy~~   51 (332)
T cd06601          33 YRDNNIPLDGLHVDVDFQD   51 (332)
T ss_pred             HHHcCCCCceEEEcCchhc
Confidence            3678999999999877654


No 18 
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus. Alpha-xylosidases catalyze the release of an alpha-xylose residue from the non-reducing end of alpha-xyloside substrates. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
Probab=29.56  E-value=38  Score=21.91  Aligned_cols=16  Identities=38%  Similarity=0.584  Sum_probs=13.1

Q ss_pred             hhcCCCceEEEeEEEE
Q psy8              6 RKMTIPIDHLTFDFVV   21 (50)
Q Consensus         6 Rk~~ipiD~l~~~~~v   21 (50)
                      |+++||+|.|.++...
T Consensus        35 r~~~iP~D~i~lD~dw   50 (292)
T cd06595          35 KKHNIPLDVLVIDMDW   50 (292)
T ss_pred             HHhCCCccEEEEeccc
Confidence            6779999999987553


No 19 
>PF14026 DUF4242:  Protein of unknown function (DUF4242)
Probab=29.33  E-value=43  Score=17.86  Aligned_cols=14  Identities=36%  Similarity=0.641  Sum_probs=11.5

Q ss_pred             hhhhhcCCCceEEE
Q psy8              3 NYARKMTIPIDHLT   16 (50)
Q Consensus         3 ~~ARk~~ipiD~l~   16 (50)
                      .+||+.++|.|+|+
T Consensus        62 ~~~~~aG~p~d~I~   75 (77)
T PF14026_consen   62 EHARRAGLPADRIT   75 (77)
T ss_pred             HHHHHcCCCcceEE
Confidence            56788899999875


No 20 
>TIGR00296 uncharacterized protein, PH0010 family. Members of this functionally uncharacterized protein family have been crystallized from Pyrococcus Horikoshii, Methanosarcina Mazei, and Sulfolobus Tokodaii.
Probab=29.26  E-value=58  Score=20.53  Aligned_cols=34  Identities=18%  Similarity=0.296  Sum_probs=21.1

Q ss_pred             ceEEEeEEEEEec-cCCC-----------CCCCCeEEE-----eeeeEeee
Q psy8             12 IDHLTFDFVVLQI-NKSE-----------APPEDGVYC-----YGLFLDGA   45 (50)
Q Consensus        12 iD~l~~~~~v~~~-~~~~-----------~~p~~GvyI-----~GLfLeGA   45 (50)
                      ++.|.++..|++. +.+.           .+..+|++|     .|+||-.-
T Consensus        97 L~~l~ieVSvL~~~e~i~~~~~~~~~~~~~~G~hGlii~~g~~~gt~LPqV  147 (200)
T TIGR00296        97 LDDIKVEVSILTPPETIFVGGPKDYPFDIEIGRHGLIVEFGPKRGLLLPQV  147 (200)
T ss_pred             hCCcEEEEEeCCCCEEcccCCccccHHHcccccceEEEEECCccEEECCcc
Confidence            6788899888875 2221           345677765     45666443


No 21 
>TIGR03563 perox_SACOL1771 peroxiredoxin, SACOL1771 subfamily. This protein family belongs to the OsmC/Ohr family (pfam02566, OsmC-like protein) of peroxiredoxins.
Probab=28.61  E-value=87  Score=17.82  Aligned_cols=20  Identities=10%  Similarity=0.125  Sum_probs=16.3

Q ss_pred             hhhhhcCCCceEEEeEEEEE
Q psy8              3 NYARKMTIPIDHLTFDFVVL   22 (50)
Q Consensus         3 ~~ARk~~ipiD~l~~~~~v~   22 (50)
                      .+|++.+++++.+..+.+..
T Consensus        61 ~~a~~~gi~~~~~~v~~~~~   80 (138)
T TIGR03563        61 AMLERAGLEDEKLTLESEGI   80 (138)
T ss_pred             HHHHHcCCcceEEEEEEEEE
Confidence            57899999999888777654


No 22 
>KOG1769|consensus
Probab=28.51  E-value=51  Score=18.99  Aligned_cols=21  Identities=19%  Similarity=0.385  Sum_probs=17.6

Q ss_pred             hhhhhcCCCceEEEeEEEEEe
Q psy8              3 NYARKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         3 ~~ARk~~ipiD~l~~~~~v~~   23 (50)
                      .||++.+++.+++.|-|+=.+
T Consensus        49 aYc~r~Gl~~~s~RFlFdG~r   69 (99)
T KOG1769|consen   49 AYCERQGLSMNSLRFLFDGQR   69 (99)
T ss_pred             HHHHHcCCccceEEEEECCcC
Confidence            589999999999999887444


No 23 
>COG1660 Predicted P-loop-containing kinase [General function prediction only]
Probab=28.19  E-value=50  Score=22.36  Aligned_cols=22  Identities=41%  Similarity=0.600  Sum_probs=15.8

Q ss_pred             hhhhhcCCCceE-EEeEEEEEec
Q psy8              3 NYARKMTIPIDH-LTFDFVVLQI   24 (50)
Q Consensus         3 ~~ARk~~ipiD~-l~~~~~v~~~   24 (50)
                      .|.=||++|+|. +.|+..+++.
T Consensus       169 SFGFKyGiP~DADlVFDVRfLPN  191 (286)
T COG1660         169 SFGFKYGIPIDADLVFDVRFLPN  191 (286)
T ss_pred             ecccccCCCCCcceEEEecccCC
Confidence            344589999996 6777777664


No 24 
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.
Probab=27.79  E-value=49  Score=21.34  Aligned_cols=18  Identities=22%  Similarity=0.458  Sum_probs=13.6

Q ss_pred             hhhcCCCceEEEeEEEEE
Q psy8              5 ARKMTIPIDHLTFDFVVL   22 (50)
Q Consensus         5 ARk~~ipiD~l~~~~~v~   22 (50)
                      .|+++||+|.+.++..-+
T Consensus        33 ~~~~~iP~d~~~lD~~w~   50 (308)
T cd06593          33 MRERNLPCDVIHLDCFWM   50 (308)
T ss_pred             HHHcCCCeeEEEEecccc
Confidence            468899999988775443


No 25 
>TIGR00313 cobQ cobyric acid synthase CobQ.
Probab=27.64  E-value=31  Score=24.13  Aligned_cols=9  Identities=56%  Similarity=0.944  Sum_probs=6.4

Q ss_pred             eEEEeeeeE
Q psy8             34 GVYCYGLFL   42 (50)
Q Consensus        34 GvyI~GLfL   42 (50)
                      |.|+||||=
T Consensus       417 GtYlHgl~~  425 (475)
T TIGR00313       417 GTYLHGLFE  425 (475)
T ss_pred             EEeeeeccC
Confidence            667888763


No 26 
>cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.  The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
Probab=27.32  E-value=44  Score=21.91  Aligned_cols=15  Identities=40%  Similarity=0.685  Sum_probs=12.6

Q ss_pred             hhcCCCceEEEeEEE
Q psy8              6 RKMTIPIDHLTFDFV   20 (50)
Q Consensus         6 Rk~~ipiD~l~~~~~   20 (50)
                      |+++||+|.|.++..
T Consensus        34 ~~~~iP~d~i~lD~~   48 (319)
T cd06591          34 RKRGIPLDVIVQDWF   48 (319)
T ss_pred             HHhCCCccEEEEech
Confidence            678999999998854


No 27 
>COG1564 THI80 Thiamine pyrophosphokinase [Coenzyme metabolism]
Probab=27.25  E-value=30  Score=22.19  Aligned_cols=14  Identities=29%  Similarity=0.468  Sum_probs=11.9

Q ss_pred             EEeeeeEeeeccCC
Q psy8             36 YCYGLFLDGARWDR   49 (50)
Q Consensus        36 yI~GLfLeGA~Wd~   49 (50)
                      -++||-++|++|..
T Consensus       159 ~~~~Lti~g~KypL  172 (212)
T COG1564         159 DVAGLTIKGAKYPL  172 (212)
T ss_pred             cccceEeccceeec
Confidence            46899999999975


No 28 
>PRK10738 hypothetical protein; Provisional
Probab=27.25  E-value=55  Score=19.04  Aligned_cols=22  Identities=5%  Similarity=-0.070  Sum_probs=17.1

Q ss_pred             hhhhhhcCCCceEEEeEEEEEe
Q psy8              2 QNYARKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         2 Q~~ARk~~ipiD~l~~~~~v~~   23 (50)
                      ..+++|++++++.+..+.+-..
T Consensus        53 ~~~l~k~~~~~~~~~v~v~~~r   74 (134)
T PRK10738         53 VSILQKGRQDVVDCEVKLTSER   74 (134)
T ss_pred             HHHHHHCCCCcccEEEEEEEEE
Confidence            3578999999999887776543


No 29 
>PF08577 PI31_Prot_C:  PI31 proteasome regulator ;  InterPro: IPR013886  PI31 is a cellular regulator of proteasome formation and of proteasome-mediated antigen processing []. 
Probab=26.48  E-value=23  Score=18.92  Aligned_cols=12  Identities=42%  Similarity=0.481  Sum_probs=8.2

Q ss_pred             eeeeEeeeccCC
Q psy8             38 YGLFLDGARWDR   49 (50)
Q Consensus        38 ~GLfLeGA~Wd~   49 (50)
                      .+=+.-|||||-
T Consensus        59 ~~~vPPGARfDP   70 (73)
T PF08577_consen   59 PGGVPPGARFDP   70 (73)
T ss_pred             CCCCCCCCccCC
Confidence            445677889873


No 30 
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain.  Both of
Probab=25.94  E-value=39  Score=22.44  Aligned_cols=18  Identities=28%  Similarity=0.313  Sum_probs=14.6

Q ss_pred             hhcCCCceEEEeEEEEEe
Q psy8              6 RKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         6 Rk~~ipiD~l~~~~~v~~   23 (50)
                      |+++||+|.+.++...+.
T Consensus        34 r~~~iP~d~i~lD~~~~~   51 (339)
T cd06602          34 RAAGIPLDVQWNDIDYMD   51 (339)
T ss_pred             HHhCCCcceEEECccccc
Confidence            678999999998866543


No 31 
>cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY.  CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain.  All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
Probab=25.91  E-value=52  Score=21.55  Aligned_cols=16  Identities=25%  Similarity=0.480  Sum_probs=12.7

Q ss_pred             hhcCCCceEEEeEEEE
Q psy8              6 RKMTIPIDHLTFDFVV   21 (50)
Q Consensus         6 Rk~~ipiD~l~~~~~v   21 (50)
                      |+++||+|.|.++...
T Consensus        34 ~~~~iP~d~i~lD~~w   49 (317)
T cd06598          34 REKDFPLDAAILDLYW   49 (317)
T ss_pred             HHhCCCceEEEEechh
Confidence            6789999999887543


No 32 
>cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed.  Most characterized GH31 enzymes are alpha-glucosidases.  In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes
Probab=25.76  E-value=45  Score=21.17  Aligned_cols=19  Identities=26%  Similarity=0.361  Sum_probs=15.0

Q ss_pred             hhhcCCCceEEEeEEEEEe
Q psy8              5 ARKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         5 ARk~~ipiD~l~~~~~v~~   23 (50)
                      -|++++|+|.+.++...+.
T Consensus        33 ~~~~~iP~d~~~lD~~~~~   51 (265)
T cd06589          33 MRENDIPLDGFVLDDDYTD   51 (265)
T ss_pred             HHHcCCCccEEEECccccc
Confidence            3678999999998866544


No 33 
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
Probab=25.26  E-value=47  Score=21.92  Aligned_cols=17  Identities=24%  Similarity=0.276  Sum_probs=13.3

Q ss_pred             hhhcCCCceEEEeEEEE
Q psy8              5 ARKMTIPIDHLTFDFVV   21 (50)
Q Consensus         5 ARk~~ipiD~l~~~~~v   21 (50)
                      .|+++||+|.|.++...
T Consensus        33 ~~~~~iP~d~i~lD~~~   49 (339)
T cd06603          33 FDEHDIPYDVIWLDIEH   49 (339)
T ss_pred             HHHcCCCceEEEEChHH
Confidence            36789999999887543


No 34 
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
Probab=24.53  E-value=53  Score=21.63  Aligned_cols=14  Identities=21%  Similarity=0.292  Sum_probs=11.6

Q ss_pred             hhhcCCCceEEEeE
Q psy8              5 ARKMTIPIDHLTFD   18 (50)
Q Consensus         5 ARk~~ipiD~l~~~   18 (50)
                      -|+++||+|.+.++
T Consensus        32 ~~~~~iP~d~i~ld   45 (317)
T cd06594          32 ARAAGVKVAGLWLQ   45 (317)
T ss_pred             HHHcCCCeeEEEEc
Confidence            36789999999875


No 35 
>cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens.  All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
Probab=24.32  E-value=57  Score=21.38  Aligned_cols=14  Identities=29%  Similarity=0.501  Sum_probs=11.7

Q ss_pred             hhcCCCceEEEeEE
Q psy8              6 RKMTIPIDHLTFDF   19 (50)
Q Consensus         6 Rk~~ipiD~l~~~~   19 (50)
                      |+++||+|.+.++.
T Consensus        39 r~~~iP~d~i~ld~   52 (317)
T cd06599          39 REHDIPCDSFHLSS   52 (317)
T ss_pred             HHcCCCeeEEEEec
Confidence            67899999998763


No 36 
>cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal do
Probab=24.11  E-value=49  Score=21.72  Aligned_cols=18  Identities=22%  Similarity=0.373  Sum_probs=14.1

Q ss_pred             hhcCCCceEEEeEEEEEe
Q psy8              6 RKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         6 Rk~~ipiD~l~~~~~v~~   23 (50)
                      |+++||+|.|.++...++
T Consensus        34 ~~~~iP~d~i~lD~~~~~   51 (317)
T cd06600          34 QKEGFPYDVVFLDIHYMD   51 (317)
T ss_pred             HHcCCCcceEEEChhhhC
Confidence            678999999988865543


No 37 
>PF11020 DUF2610:  Domain of unknown function (DUF2610);  InterPro: IPR021277  This family is conserved in Proteobacteria. One member is annotated as being elongation factor P but this could not be confirmed. 
Probab=23.88  E-value=11  Score=21.18  Aligned_cols=16  Identities=13%  Similarity=0.368  Sum_probs=12.3

Q ss_pred             ChhhhhhcCCCceEEE
Q psy8              1 MQNYARKMTIPIDHLT   16 (50)
Q Consensus         1 lQ~~ARk~~ipiD~l~   16 (50)
                      |+..|++|++|+.+|+
T Consensus        57 L~~La~~N~v~feeLc   72 (82)
T PF11020_consen   57 LYKLAKENNVSFEELC   72 (82)
T ss_pred             HHHHHHHcCCCHHHHH
Confidence            4567899999987764


No 38 
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=23.35  E-value=1e+02  Score=21.51  Aligned_cols=23  Identities=22%  Similarity=0.499  Sum_probs=18.8

Q ss_pred             hhhhhhcCCCceEEEeEEEEEec
Q psy8              2 QNYARKMTIPIDHLTFDFVVLQI   24 (50)
Q Consensus         2 Q~~ARk~~ipiD~l~~~~~v~~~   24 (50)
                      ++.+|-.-+|+++++++|+|+..
T Consensus       109 ~ea~~y~PyP~EEv~lDy~vlg~  131 (354)
T COG4972         109 SEASRYIPYPLEEVNLDYQVLGP  131 (354)
T ss_pred             HHHhhcCCCchhhcccceEEecc
Confidence            34556667999999999999886


No 39 
>cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This family also includes the MalA alpha-glucosidase from Sulfolobus sulfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
Probab=23.13  E-value=51  Score=21.71  Aligned_cols=16  Identities=31%  Similarity=0.459  Sum_probs=13.0

Q ss_pred             hhhcCCCceEEEeEEE
Q psy8              5 ARKMTIPIDHLTFDFV   20 (50)
Q Consensus         5 ARk~~ipiD~l~~~~~   20 (50)
                      -|+++||+|.+.++..
T Consensus        33 ~~~~~iP~d~i~lD~~   48 (339)
T cd06604          33 FRERDIPCDAIYLDID   48 (339)
T ss_pred             HHHhCCCcceEEECch
Confidence            3678999999999844


No 40 
>PF02760 HIN:  HIN-200/IF120x domain;  InterPro: IPR004021 This domain has no known function. It is found in one or two copies per protein, and is found associated with the PAAD/DAPIN domain IPR004020 from INTERPRO.; PDB: 3RN2_A 3RN5_C 2OQ0_A 3B6Y_A 3RLN_A 3RNU_A 3RLO_A.
Probab=23.13  E-value=61  Score=20.39  Aligned_cols=12  Identities=33%  Similarity=0.747  Sum_probs=10.2

Q ss_pred             CCCeEEEeeeeE
Q psy8             31 PEDGVYCYGLFL   42 (50)
Q Consensus        31 p~~GvyI~GLfL   42 (50)
                      -..|.+|+|+|+
T Consensus       110 q~~Gt~V~G~F~  121 (170)
T PF02760_consen  110 QASGTFVNGLFT  121 (170)
T ss_dssp             SSTTEEEEEEEE
T ss_pred             CCCCcEEeEEEE
Confidence            457999999996


No 41 
>PF05692 Myco_haema:  Mycoplasma haemagglutinin;  InterPro: IPR008692 This family consists of several haemagglutinin sequences from Mycoplasma gallisepticum. The major plasma membrane proteins, pMGAs, of Mycoplasma gallisepticum are cell adhesin (hemagglutinin) molecules. It has been shown that the genetic determinants that code for the haemagglutinins are organised into a large family of genes and that only one of these genes is predominately expressed in any given strain [, ].
Probab=23.01  E-value=99  Score=22.16  Aligned_cols=18  Identities=28%  Similarity=0.601  Sum_probs=14.3

Q ss_pred             CCCCCeE-EEeeeeEeeec
Q psy8             29 APPEDGV-YCYGLFLDGAR   46 (50)
Q Consensus        29 ~~p~~Gv-yI~GLfLeGA~   46 (50)
                      ..|.+|- ||.|-||.+..
T Consensus       335 NAP~~G~Y~ISGsYlt~~~  353 (439)
T PF05692_consen  335 NAPKAGDYYISGSYLTSSN  353 (439)
T ss_pred             eCCCCCceeEEEEEecCCc
Confidence            5688995 69999998763


No 42 
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated
Probab=22.62  E-value=33  Score=24.32  Aligned_cols=11  Identities=9%  Similarity=0.072  Sum_probs=7.9

Q ss_pred             CeEEEeeeeEe
Q psy8             33 DGVYCYGLFLD   43 (50)
Q Consensus        33 ~GvyI~GLfLe   43 (50)
                      -|.|+||+|..
T Consensus       178 ~GTYlHGifdn  188 (476)
T PRK06278        178 FGTMVHNFLDN  188 (476)
T ss_pred             EEEecCcccCC
Confidence            46788888864


No 43 
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in  Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain.  All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
Probab=22.40  E-value=66  Score=21.43  Aligned_cols=13  Identities=15%  Similarity=0.447  Sum_probs=11.1

Q ss_pred             hhcCCCceEEEeE
Q psy8              6 RKMTIPIDHLTFD   18 (50)
Q Consensus         6 Rk~~ipiD~l~~~   18 (50)
                      |+++||+|.|.++
T Consensus        34 ~~~~iP~d~i~lD   46 (340)
T cd06597          34 EEHGIPVTVVVIE   46 (340)
T ss_pred             HHcCCCeeEEEEe
Confidence            6789999999775


No 44 
>PF01745 IPT:  Isopentenyl transferase;  InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [].; GO: 0004161 dimethylallyltranstransferase activity, 0009058 biosynthetic process; PDB: 2ZE8_C 2ZE5_A 2ZE7_A 2ZE6_A.
Probab=22.24  E-value=27  Score=22.95  Aligned_cols=14  Identities=36%  Similarity=0.562  Sum_probs=10.1

Q ss_pred             hhhhhcCCCceEEE
Q psy8              3 NYARKMTIPIDHLT   16 (50)
Q Consensus         3 ~~ARk~~ipiD~l~   16 (50)
                      +|||++++++|+|.
T Consensus       180 ~~a~~~~v~~~~l~  193 (233)
T PF01745_consen  180 RFARKHQVTPDQLL  193 (233)
T ss_dssp             HHHHHTT--GGGCC
T ss_pred             HHHHHhCCCHHHHH
Confidence            58999999999864


No 45 
>COG4352 RPL13 Ribosomal protein L13E [Translation, ribosomal structure and biogenesis]
Probab=21.80  E-value=45  Score=19.69  Aligned_cols=12  Identities=42%  Similarity=0.700  Sum_probs=10.0

Q ss_pred             hhhhhcCCCceE
Q psy8              3 NYARKMTIPIDH   14 (50)
Q Consensus         3 ~~ARk~~ipiD~   14 (50)
                      ++||+.+||+|.
T Consensus        74 ~~AR~LGI~VD~   85 (113)
T COG4352          74 RKARTLGIAVDH   85 (113)
T ss_pred             HHHHhhCcceeh
Confidence            478999999985


No 46 
>TIGR03561 organ_hyd_perox peroxiredoxin, Ohr subfamily. Pfam model pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein Ohr, or organic hydroperoxide resistance protein.
Probab=21.77  E-value=69  Score=18.23  Aligned_cols=20  Identities=10%  Similarity=0.079  Sum_probs=15.0

Q ss_pred             hhhhhhcCCCce-EEEeEEEE
Q psy8              2 QNYARKMTIPID-HLTFDFVV   21 (50)
Q Consensus         2 Q~~ARk~~ipiD-~l~~~~~v   21 (50)
                      +.+|++.+++++ .+.++.++
T Consensus        59 ~~~a~~~g~~~~~~~~v~~~~   79 (134)
T TIGR03561        59 KLVAGQAKVKLPADAEVTATV   79 (134)
T ss_pred             HHHHHHcCCCCCCCcEEEEEE
Confidence            467899999997 46666665


No 47 
>PHA00911 21 prohead core scaffolding protein and protease
Probab=21.72  E-value=1e+02  Score=20.05  Aligned_cols=14  Identities=21%  Similarity=0.634  Sum_probs=11.2

Q ss_pred             CCCeEEEeeeeEee
Q psy8             31 PEDGVYCYGLFLDG   44 (50)
Q Consensus        31 p~~GvyI~GLfLeG   44 (50)
                      .+...||+|+|++.
T Consensus        28 ~k~~l~ieGif~qa   41 (212)
T PHA00911         28 GKKDLYIEGIFMQA   41 (212)
T ss_pred             CCccEEEEEEEEee
Confidence            34578999999985


No 48 
>PF08284 RVP_2:  Retroviral aspartyl protease;  InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses). These proteases are generally part of a larger polyprotein; usually pol, more rarely gag. Retroviral proteases appear to be homologous to a single domain of the two-domain eukaryotic aspartyl proteases. 
Probab=21.67  E-value=73  Score=18.51  Aligned_cols=23  Identities=26%  Similarity=0.495  Sum_probs=18.7

Q ss_pred             hhhhhhcCCCceEEEeEEEEEec
Q psy8              2 QNYARKMTIPIDHLTFDFVVLQI   24 (50)
Q Consensus         2 Q~~ARk~~ipiD~l~~~~~v~~~   24 (50)
                      +.+|+++++|+..+.-.+.|...
T Consensus        48 ~~~a~~~~l~~~~l~~~~~V~~~   70 (135)
T PF08284_consen   48 SSFAKKLGLPLEPLPRPIVVSAP   70 (135)
T ss_pred             HHHHHhcCCEEEEccCeeEEecc
Confidence            57899999999998887777543


No 49 
>cd01420 MoaC_PE MoaC family, prokaryotic and eukaryotic. Members of this family are involved in molybdenum cofactor (Moco) biosynthesis, an essential cofactor of a diverse group of redox enzymes. MoaC, a small hexameric protein, converts, together with MoaA, a guanosine derivative to the precursor Z by inserting the carbon-8 of the purine between the 2' and 3' ribose carbon atoms, which is the first of three phases of Moco biosynthesis.
Probab=20.57  E-value=2.1e+02  Score=17.30  Aligned_cols=17  Identities=18%  Similarity=0.376  Sum_probs=13.8

Q ss_pred             cCCCceEEEeEEEEEec
Q psy8              8 MTIPIDHLTFDFVVLQI   24 (50)
Q Consensus         8 ~~ipiD~l~~~~~v~~~   24 (50)
                      |.+||+.+.++|++...
T Consensus        63 Hpi~l~~v~v~~~~~~~   79 (140)
T cd01420          63 HPLPLTGVDVDFELDEE   79 (140)
T ss_pred             CCCcccEEEEEEEEcCC
Confidence            46899999999987553


No 50 
>PF01212 Beta_elim_lyase:  Beta-eliminating lyase;  InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases. It is involved in the degradation of amino acids. The glycine cleavage system is composed of four proteins: P, T, L and H. In Bacillus subtilis, the P 'protein' is an heterodimer of two subunits. The glycine cleavage system catalyses the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; CO(2) is released and the remaining methylamine moiety is then transferred to the lipoamide cofactor of the H protein; GO: 0016829 lyase activity, 0006520 cellular amino acid metabolic process; PDB: 3PJ0_C 2C44_C 2V0Y_A 2OQX_A 2V1P_A 1AX4_B 3LWS_A 1C7G_A 1V72_A 2YHK_B ....
Probab=20.46  E-value=50  Score=21.59  Aligned_cols=8  Identities=63%  Similarity=1.016  Sum_probs=6.2

Q ss_pred             eeEeeecc
Q psy8             40 LFLDGARW   47 (50)
Q Consensus        40 LfLeGA~W   47 (50)
                      |||+|||.
T Consensus       161 lhmDGARl  168 (290)
T PF01212_consen  161 LHMDGARL  168 (290)
T ss_dssp             EEEEETTH
T ss_pred             EEEehhhH
Confidence            67999983


No 51 
>PF03969 AFG1_ATPase:  AFG1-like ATPase;  InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP. AFG1 also has substantial homology to these proteins outside the ATPase domain []. This family of proteins contains a P-loop motif.; GO: 0005524 ATP binding
Probab=20.18  E-value=78  Score=21.51  Aligned_cols=11  Identities=45%  Similarity=1.238  Sum_probs=8.5

Q ss_pred             CCCCCeEEEee
Q psy8             29 APPEDGVYCYG   39 (50)
Q Consensus        29 ~~p~~GvyI~G   39 (50)
                      .++..|+|++|
T Consensus        59 ~~~~~GlYl~G   69 (362)
T PF03969_consen   59 PPPPKGLYLWG   69 (362)
T ss_pred             CCCCceEEEEC
Confidence            45678999988


No 52 
>PF01229 Glyco_hydro_39:  Glycosyl hydrolases family 39;  InterPro: IPR000514 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 39 GH39 from CAZY comprises enzymes with several known activities; alpha-L-iduronidase (3.2.1.76 from EC); beta-xylosidase (3.2.1.37 from EC). The most highly conserved regions in these enzymes are located in their N-terminal sections. These contain a glutamic acid residue which, on the basis of similarities with other families of glycosyl hydrolases [], probably acts as the proton donor in their catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 2BS9_D 2BFG_E 1W91_B 1UHV_D 1PX8_A.
Probab=20.12  E-value=81  Score=21.92  Aligned_cols=21  Identities=14%  Similarity=0.389  Sum_probs=13.6

Q ss_pred             hhhhhcCCCceEEEeEEEEEe
Q psy8              3 NYARKMTIPIDHLTFDFVVLQ   23 (50)
Q Consensus         3 ~~ARk~~ipiD~l~~~~~v~~   23 (50)
                      ++++++++|+|-++|+..-..
T Consensus       217 ~~~~~~~~~~DfiS~H~y~~~  237 (486)
T PF01229_consen  217 EFCKGNNCPLDFISFHSYGTD  237 (486)
T ss_dssp             HHHHHCT---SEEEEEEE-BE
T ss_pred             HHHhcCCCCCCEEEEEecccc
Confidence            578889999999999866543


Done!