RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy8010
         (87 letters)



>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 45.6 bits (109), Expect = 3e-07
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVDVREILGTPDYV 85
           P+N++L     D  VKL DFG++R L     +   +GTP+Y+
Sbjct: 125 PENILLDE---DGHVKLADFGLARQLDPGEKLTTFVGTPEYM 163


>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 4.  Protein kinases (PKs), MAP
           kinase kinase 4 (MKK4) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK4 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK4 is a dual-specificity PK that
           phosphorylates and activates the downstream targets,
           c-Jun N-terminal kinase (JNK) and p38 MAPK, on specific
           threonine and tyrosine residues. JNK and p38 are
           collectively known as stress-activated MAPKs, as they
           are activated in response to a variety of environmental
           stresses and pro-inflammatory cytokines. Their
           activation is associated with the induction of cell
           death. Mice deficient in MKK4 die during embryogenesis
           and display anemia, severe liver hemorrhage, and
           abnormal hepatogenesis. MKK4 may also play roles in the
           immune system and in cardiac hypertrophy. It plays a
           major role in cancer as a tumor and metastasis
           suppressor. Under certain conditions, MKK4 is
           pro-oncogenic.
          Length = 288

 Score = 40.4 bits (95), Expect = 2e-05
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 11  RIP-RLVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHL 69
            IP  ++ K+ V  + +LN+       ++R   +P N++L       ++KLCDFGIS  L
Sbjct: 103 VIPEEILGKIAVATVKALNYLKEELKIIHRDV-KPSNILLDRN---GNIKLCDFGISGQL 158

Query: 70  ------SRDVDVR 76
                 +RD   R
Sbjct: 159 VDSIAKTRDAGCR 171


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 39.8 bits (94), Expect = 3e-05
 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVDV-REILGTPDYV 85
           PQN+ LT       VKL DFGIS+ LS  VD+ + ++GTP Y+
Sbjct: 131 PQNIFLTSNG---LVKLGDFGISKVLSSTVDLAKTVVGTPYYL 170


>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity
           Protein Kinase, Mitogen-Activated Protein Kinase Kinase.
            Protein kinases (PKs), MAP kinase kinase (MAPKK)
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK or MAP2K), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK or
           MAP3K). MAPKKs are dual-specificity PKs that
           phosphorylate their downstream targets, MAPKs, at
           specific threonine and tyrosine residues. There are
           three MAPK subfamilies: extracellular signal-regulated
           kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In
           mammalian cells, there are seven MAPKKs (named MKK1-7)
           and 20 MAPKKKs. Each MAPK subfamily can be activated by
           at least two cognate MAPKKs and by multiple MAPKKKs.
          Length = 265

 Score = 37.3 bits (87), Expect = 2e-04
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 9/66 (13%)

Query: 11  RIP-RLVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLT--GEYPDCDVKLCDFGISR 67
           RIP R++ K+ V +L  L +       ++R   +P N+++   G+     +KLCDFG+S 
Sbjct: 96  RIPERILGKIAVAVLKGLTYLHEKHKIIHRDV-KPSNILVNSRGQ-----IKLCDFGVSG 149

Query: 68  HLSRDV 73
            L   +
Sbjct: 150 QLVNSL 155


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase 15.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAPK15 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. Human MAPK15 is also called
           Extracellular signal Regulated Kinase 8 (ERK8) while the
           rat protein is called ERK7. ERK7 and ERK8 display both
           similar and different biochemical properties. They
           autophosphorylate and activate themselves and do not
           require upstream activating kinases. ERK7 is
           constitutively active and is not affected by
           extracellular stimuli whereas ERK8 shows low basal
           activity and is activated by DNA-damaging agents. ERK7
           and ERK8 also have different substrate profiles. Genome
           analysis shows that they are orthologs with similar gene
           structures. ERK7 and ERK 8 may be involved in the
           signaling of some nuclear receptor transcription
           factors. ERK7 regulates hormone-dependent degradation of
           estrogen receptor alpha while ERK8 down-regulates the
           transcriptional co-activation androgen and
           glucocorticoid receptors.
          Length = 337

 Score = 36.4 bits (85), Expect = 5e-04
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVDVREILGTPDYV 85
           P N++L     DC VKL DFG++R LS   +  E     DYV
Sbjct: 135 PSNILLNS---DCRVKLADFGLARSLSELEENPENPVLTDYV 173


>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III
           myosin-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), Class III myosin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           class III myosin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Class III myosins are motor
           proteins with an N-terminal kinase catalytic domain and
           a C-terminal actin-binding motor domain. Class III
           myosins are present in the photoreceptors of
           invertebrates and vertebrates and in the auditory hair
           cells of mammals. The kinase domain of myosin III can
           phosphorylate several cytoskeletal proteins,
           conventional myosin regulatory light chains, and can
           autophosphorylate the C-terminal motor domain. Myosin
           III may play an important role in maintaining the
           structural integrity of photoreceptor cell microvilli.
           It may also function as a cargo carrier during
           light-dependent translocation, in photoreceptor cells,
           of proteins such as transducin and arrestin. The
           Drosophila class III myosin, called NinaC (Neither
           inactivation nor afterpotential protein C), is critical
           in normal adaptation and termination of photoresponse.
           Vertebrates contain two isoforms of class III myosin,
           IIIA and IIIB. This subfamily also includes mammalian
           NIK-like embryo-specific kinase (NESK), Traf2- and
           Nck-interacting kinase (TNIK), mitogen-activated protein
           kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or
           MAP4K4) and MAPKKKK6 (or MAP4K6). MAP4Ks are involved in
           some MAPK signaling pathways by activating a MAPK kinase
           kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
          Length = 275

 Score = 36.5 bits (85), Expect = 6e-04
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 4/39 (10%)

Query: 45  QNLVLTGEYPDCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           QN++LT      +VKL DFG+S  L   +  R   +GTP
Sbjct: 142 QNILLTKNA---EVKLVDFGVSAQLDSTLGRRNTFIGTP 177


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 36.0 bits (84), Expect = 7e-04
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVDVREILGTPDY 84
             N++LT    D +VKL DFG+S  LS       ++GTP +
Sbjct: 126 AANILLT---SDGEVKLIDFGLSAQLSDTKARNTMVGTPYW 163


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 35.7 bits (83), Expect = 8e-04
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVDV-REILGTPDYV 85
           P+N++L  +     VKL DFG+S+ L+ D  + + I+GTP Y+
Sbjct: 120 PENILLDSDNGK--VKLADFGLSKLLTSDKSLLKTIVGTPAYM 160


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 35.3 bits (82), Expect = 0.001
 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 4/43 (9%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISR-HLSRDVDVREILGTPDYV 85
           P+N++L     +  VK+ DFG+++  L     +   +GTP Y+
Sbjct: 126 PENILLD---ENGVVKIADFGLAKKLLKSSSSLTTFVGTPWYM 165


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), CMGC family, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CMGC family is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The CMGC family consists of Cyclin-Dependent
           protein Kinases (CDKs), Mitogen-activated protein
           kinases (MAPKs) such as Extracellular signal-regulated
           kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38,
           and similar proteins. CDKs belong to a large subfamily
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. MAPKs
           serve as important mediators of cellular responses to
           extracellular signals. They control critical cellular
           functions including differentiation, proliferation,
           migration, and apoptosis. They are also implicated in
           the pathogenesis of many diseases including multiple
           types of cancer, stroke, diabetes, and chronic
           inflammation.
          Length = 283

 Score = 34.2 bits (79), Expect = 0.003
 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRHLSRDVD 74
           +P+NL++     +  +KL DFG++R     V 
Sbjct: 125 KPENLLINT---EGVLKLADFGLARSFGSPVR 153


>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), AGC (Protein Kinases A, G and C) family,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The AGC family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
           this family include cAMP-dependent Protein Kinase (PKA),
           cGMP-dependent Protein Kinase (PKG), Protein Kinase C
           (PKC), Protein Kinase B (PKB), G protein-coupled
           Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
           Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
           (p70S6K or S6K), among others. AGC kinases share an
           activation mechanism based on the phosphorylation of up
           to three sites: the activation loop (A-loop), the
           hydrophobic motif (HM) and the turn motif.
           Phosphorylation at the A-loop is required of most AGC
           kinases, which results in a disorder-to-order transition
           of the A-loop. The ordered conformation results in the
           access of substrates and ATP to the active site. A
           subset of AGC kinases with C-terminal extensions
           containing the HM also requires phosphorylation at this
           site. Phosphorylation at the HM allows the C-terminal
           extension to form an ordered structure that packs into
           the hydrophobic pocket of the catalytic domain, which
           then reconfigures the kinase into an active bi-lobed
           state. In addition, growth factor-activated AGC kinases
           such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
           phosphorylation at the turn motif (also called tail or
           zipper site), located N-terminal to the HM at the
           C-terminal extension. AGC kinases regulate many cellular
           processes including division, growth, survival,
           metabolism, motility, and differentiation. Many are
           implicated in the development of various human diseases.
          Length = 250

 Score = 33.6 bits (78), Expect = 0.005
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVD-VREILGTPDYV 85
           P+N++L     D  +KL DFG+++ LS +        GTP+Y+
Sbjct: 121 PENILLDA---DGHIKLTDFGLAKELSSEGSRTNTFCGTPEYL 160


>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity
           Protein Kinases, MAP kinase kinases 3 and 6.  Protein
           kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6
           subfamily, catalytic (c) domain. PKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MKK3 and MKK6 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK3 and MKK6 are dual-specificity PKs that
           phosphorylate and activate their downstream target, p38
           MAPK, on specific threonine and tyrosine residues.
           MKK3/6 plays roles in the regulation of cell cycle
           progression, cytokine- and stress-induced apoptosis,
           oncogenic transformation, and adult tissue regeneration.
           In addition, MKK6 plays a critical role in osteoclast
           survival in inflammatory disease while MKK3 is
           associated with tumor invasion, progression, and poor
           patient survival in glioma.
          Length = 283

 Score = 33.6 bits (77), Expect = 0.005
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 11  RIPR-LVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHL 69
            IP  ++ K+ V+++ +L +  +    ++R   +P N+++        VKLCDFGIS +L
Sbjct: 99  TIPEDILGKIAVSIVKALEYLHSKLSVIHRDV-KPSNVLINRN---GQVKLCDFGISGYL 154


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated
           serine/threonine kinase-like proteins.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MAST kinase subfamily
           includes MAST kinases, MAST-like (MASTL) kinases, and
           fungal kinases with similarity to Saccharomyces
           cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
           MAST kinases contain an N-terminal domain of unknown
           function, a central catalytic domain, and a C-terminal
           PDZ domain that mediates protein-protein interactions.
           MASTL kinases carry only a catalytic domain which
           contains a long insert relative to other kinases. The
           fungal kinases in this subfamily harbor other domains in
           addition to a central catalytic domain, which also
           contains an insert relative to MAST kinases like MASTL.
           Rim15 contains a C-terminal signal receiver (REC) domain
           while cek1 contains an N-terminal PAS domain. MAST
           kinases are cytoskeletal associated kinases of unknown
           function that are also expressed at neuromuscular
           junctions and postsynaptic densities. The fungal
           proteins Rim15 and cek1 are involved in the regulation
           of meiosis and mitosis, respectively.
          Length = 265

 Score = 33.8 bits (78), Expect = 0.005
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 12/51 (23%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISR---------HLSRDVDVREILGTPDYV 85
           P N+++     +  +KL DFG+S+             + + + I+GTPDY+
Sbjct: 121 PDNILIDS---NGHLKLTDFGLSKVGLVRRQINLNDDEKEDKRIVGTPDYI 168


>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mitogen-Activated Protein
           Kinase Kinase Kinase Kinase 4 and 6.  Serine/threonine
           kinases (STKs), mitogen-activated protein kinase (MAPK)
           kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6
           (or MAP4K6) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAP4K4/MAP4K6 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Members of this subfamily
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain. MAP4Ks (or
           MAPKKKKs) are involved in MAPK signaling pathways that
           are important in mediating cellular responses to
           extracellular signals by activating a MAPK kinase kinase
           (MAPKKK or MAP3K or MKKK). Each MAPK cascade is
           activated either by a small GTP-binding protein or by an
           adaptor protein, which transmits the signal either
           directly to a MAP3K to start the triple kinase core
           cascade or indirectly through a mediator kinase, a
           MAP4K. MAP4K4 is also called Nck Interacting kinase
           (NIK). It facilitates the activation of the MAPKs,
           extracellular signal-regulated kinase (ERK) 1, ERK2, and
           c-Jun N-terminal kinase (JNK), by phosphorylating and
           activating MEKK1. MAP4K4 plays a role in tumor necrosis
           factor (TNF) alpha-induced insulin resistance. MAP4K4
           silencing in skeletal muscle cells from type II diabetic
           patients restores insulin-mediated glucose uptake.
           MAP4K4, through JNK, also plays a broad role in cell
           motility, which impacts inflammation, homeostasis, as
           well as the invasion and spread of cancer. MAP4K4 is
           found to be highly expressed in most tumor cell lines
           relative to normal tissue. MAP4K6 (also called MINK for
           Misshapen/NIKs-related kinase) is activated after Ras
           induction and mediates activation of p38 MAPK. MAP4K6
           plays a role in cell cycle arrest, cytoskeleton
           organization, cell adhesion, and cell motility.
          Length = 282

 Score = 33.8 bits (77), Expect = 0.005
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 30  HFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           H  +   ++R   + QN++LT    + +VKL DFG+S  L R V  R   +GTP
Sbjct: 136 HLHAHKVIHRDI-KGQNVLLT---ENAEVKLVDFGVSAQLDRTVGRRNTFIGTP 185


>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 8.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek8 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek8 contains an
           N-terminal kinase catalytic domain and a C-terminal RCC1
           (regulator of chromosome condensation) domain. A double
           point mutation in Nek8 causes cystic kidney disease in
           mice that genetically resembles human autosomal
           recessive polycystic kidney disease (ARPKD). Nek8 is
           also associated with a rare form of juvenile renal
           cystic disease, nephronophthisis type 9. It has been
           suggested that a defect in the ciliary localization of
           Nek8 contributes to the development of cysts manifested
           by these diseases.
          Length = 256

 Score = 33.7 bits (77), Expect = 0.006
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 21  VTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHLSRDVDVREILG 80
           V +L +L+H    T  +     + QN++L        VK+ DFGIS+ LS       ++G
Sbjct: 108 VQILLALHH--VHTKLILHRDLKTQNILLDKH--KMVVKIGDFGISKILSSKSKAYTVVG 163

Query: 81  TPDYV 85
           TP Y+
Sbjct: 164 TPCYI 168


>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 7.  Protein kinases (PKs), MAP
           kinase kinase 7 (MKK7) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK7 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MKK7 is a dual-specificity PK that phosphorylates and
           activates its downstream target, c-Jun N-terminal kinase
           (JNK), on specific threonine and tyrosine residues.
           Although MKK7 is capable of dual phosphorylation, it
           prefers to phosphorylate the threonine residue of JNK.
           Thus, optimal activation of JNK requires both MKK4 (not
           included in this subfamily) and MKK7. MKK7 is primarily
           activated by cytokines. MKK7 is essential for liver
           formation during embryogenesis. It plays roles in G2/M
           cell cycle arrest and cell growth. In addition, it is
           involved in the control of programmed cell death, which
           is crucial in oncogenesis, cancer chemoresistance, and
           antagonism to TNFalpha-induced killing, through its
           inhibition by Gadd45beta and the subsequent suppression
           of the JNK cascade.
          Length = 296

 Score = 33.5 bits (77), Expect = 0.006
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 12  IP-RLVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHL 69
           IP  ++ K+TV ++ +L H+    H +     +P N++L       +VKLCDFGIS  L
Sbjct: 111 IPEDILGKMTVAIVKAL-HYLKEKHGVIHRDVKPSNILLDA---SGNVKLCDFGISGRL 165


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
           Kinase, Mitogen-Activated Protein Kinase.
           Serine/Threonine Kinases (STKs), Mitogen-Activated
           Protein Kinase (MAPK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The MAPK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. MAPKs serve as important
           mediators of cellular responses to extracellular
           signals. They control critical cellular functions
           including differentiation, proliferation, migration, and
           apoptosis. They are also implicated in the pathogenesis
           of many diseases including multiple types of cancer,
           stroke, diabetes, and chronic inflammation. Typical MAPK
           pathways involve a triple kinase core cascade comprising
           of the MAPK, which is phosphorylated and activated by a
           MAPK kinase (MAP2K or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAP3K or MKKK). Each cascade is activated either by a
           small GTP-binding protein or by an adaptor protein,
           which transmits the signal either directly to a MAP3K to
           start the triple kinase core cascade or indirectly
           through a mediator kinase, a MAP4K. There are three main
           typical MAPK subfamilies: Extracellular signal-Regulated
           Kinase (ERK), c-Jun N-terminal Kinase (JNK), and p38.
           Some MAPKs are atypical in that they are not regulated
           by MAP2Ks. These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 33.3 bits (77), Expect = 0.007
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 5/42 (11%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVDVREILGTPDYV 85
           P N+++     +CD+K+CDFG++R +  D D +  L T +YV
Sbjct: 131 PSNILVNS---NCDLKICDFGLARGVDPDEDEKGFL-T-EYV 167


>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Traf2- and Nck-interacting
           kinase.  Serine/threonine kinases (STKs), Traf2- and
           Nck-interacting kinase (TNIK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The TNIK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to mitogen-activated protein kinase (MAPK),
           kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks
           participate in some MAPK signaling pathways by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). TNIK is an effector of Rap2, a small GTP-binding
           protein from the Ras family. TNIK specifically activates
           the c-Jun N-terminal kinase (JNK) pathway and plays a
           role in regulating the actin cytoskeleton.
          Length = 272

 Score = 32.8 bits (74), Expect = 0.010
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 16  VAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHLSRDVDV 75
           +A +   +L  L+H     H +     + QN++LT    + +VKL DFG+S  L R V  
Sbjct: 113 IAYICREILRGLSH--LHQHKVIHRDIKGQNVLLT---ENAEVKLVDFGVSAQLDRTVGR 167

Query: 76  RE-ILGTP 82
           R   +GTP
Sbjct: 168 RNTFIGTP 175


>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the
           Serine/Threonine Kinases, TEY Mitogen-Activated Protein
           Kinases from Plants.  Serine/Threonine Kinases (STKs),
           Plant TEY Mitogen-Activated Protein Kinase (MAPK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The TEY
           MAPK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKs are important mediators of cellular
           responses to extracellular signals. In plants, MAPKs are
           associated with physiological, developmental, hormonal,
           and stress responses. Some plants show numerous gene
           duplications of MAPKs. Arabidopsis thaliana harbors at
           least 20 MAPKs, named AtMPK1-20. There are two subtypes
           of plant MAPKs based on the conserved phosphorylation
           motif present in the activation loop, TEY and TDY. This
           subfamily represents the TEY subtype and is further
           subdivided into three groups (A, B, and C). Group A is
           represented by AtMPK3, AtMPK6, Nicotiana tabacum BTF4
           (NtNTF4), among others. They are mostly involved in
           environmental and hormonal responses. AtMPK3 and  AtMPK6
           are also key regulators for stomatal development and
           patterning. Group B is represented by AtMPK4, AtMPK13,
           and NtNTF6, among others. They may be involved in both
           cell division and environmental stress response. AtMPK4
           also participates in regulating innate immunity. Group C
           is represented by AtMPK1, AtMPK2, NtNTF3, Oryza sativa
           MAPK4 (OsMAPK4), among others. They may also be involved
           in stress responses. AtMPK1 and AtMPK2 are activated
           following mechanical injury and in the presence of
           stress chemicals such as jasmonic acid, hydrogen
           peroxide and abscisic acid. OsMAPK4 is also called
           OsMSRMK3 for Multiple Stress-Responsive MAPK3.
          Length = 337

 Score = 32.3 bits (74), Expect = 0.017
 Identities = 12/25 (48%), Positives = 19/25 (76%), Gaps = 3/25 (12%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISR 67
           +P NL+L     +CD+K+CDFG++R
Sbjct: 135 KPSNLLLNA---NCDLKICDFGLAR 156


>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional.
          Length = 496

 Score = 32.1 bits (73), Expect = 0.017
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 13/63 (20%)

Query: 29  HHFTSTHSLYRSCSQPQNLVLTGEYPDCD---VKLCDFGISRHLSRDV--DV-REILGTP 82
           HH  S H ++R   +  N++L      C    VKL DFG S+  +  V  DV R   GTP
Sbjct: 157 HHVHSKHMIHRDI-KSANILL------CSNGLVKLGDFGFSKMYAATVSDDVGRTFCGTP 209

Query: 83  DYV 85
            YV
Sbjct: 210 YYV 212


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
           cell-Associated Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Male germ
           cell-Associated Kinase (MAK)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of human MAK and
           MAK-related kinase (MRK), Saccharomyces cerevisiae
           Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
           3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
           Arabidopsis thaliana MHK, and similar proteins. These
           proteins play important roles during meiosis. MAK is
           highly expressed in testicular cells specifically in the
           meiotic phase, but is not essential for spermatogenesis
           and fertility. It functions as a coactivator of the
           androgen receptor in prostate cells. MRK, also called
           Intestinal Cell Kinase (ICK), is expressed ubiquitously,
           with highest expression in the ovary and uterus. A
           missense mutation in MRK causes
           endocrine-cerebro-osteodysplasia (ECO), suggesting that
           this protein plays an important role in the development
           of many organs. MAK and MRK may be involved in
           regulating cell cycle and cell fate. Ime2p is a
           meiosis-specific kinase that is important during meiotic
           initiation and during the later stages of meiosis. Mde3
           functions downstream of the transcription factor Mei-4
           which is essential for meiotic prophase I.
          Length = 283

 Score = 32.1 bits (74), Expect = 0.019
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 4/30 (13%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHL-SRD 72
           P+NL+++G      VK+ DFG++R + SR 
Sbjct: 127 PENLLVSGPE---VVKIADFGLAREIRSRP 153


>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 1.  Protein kinases (PKs),
           MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK1 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients. MEK1 also plays a role in cell
           cycle control.
          Length = 333

 Score = 31.9 bits (72), Expect = 0.024
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 10  ARIP-RLVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRH 68
            RIP +++ KV++ ++  L +     H +     +P N+++       ++KLCDFG+S  
Sbjct: 98  GRIPEQILGKVSIAVIKGLTY-LREKHKIMHRDVKPSNILVNSR---GEIKLCDFGVSGQ 153

Query: 69  LSRDVDVREILGTPDYV 85
           L  D      +GT  Y+
Sbjct: 154 LI-DSMANSFVGTRSYM 169


>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           Byr1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Byr1 from
           Schizosaccharomyces pombe, FUZ7 from Ustilago maydis,
           and related proteins. Byr1 phosphorylates its downstream
           target, the MAPK Spk1, and is regulated by the MAPKKK
           Byr2. The Spk1 cascade is pheromone-responsive and is
           essential for sporulation and sexual differentiation in
           fission yeast. FUZ7 phosphorylates and activates its
           target, the MAPK Crk1, which is required in mating and
           virulence in U. maydis.
          Length = 284

 Score = 31.7 bits (72), Expect = 0.026
 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 13  PRLVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHL 69
             ++ K+ V ++  L + +     ++R   +P N+++        +KLCDFG+S  L
Sbjct: 102 VEILGKIAVAVVEGLTYLYNVHRIMHRDI-KPSNILVNSR---GQIKLCDFGVSGEL 154


>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase 2.  Protein kinases (PKs),
           MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MEK subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising the MAP kinase
           (MAPK), which is phosphorylated and activated by a MAPK
           kinase (MAPKK or MKK), which itself is phosphorylated
           and activated by a MAPK kinase kinase (MAPKKK or MKKK).
           MEK2 is a dual-specificity PK that phosphorylates and
           activates the downstream targets, extracellular
           signal-regulated kinase (ERK) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK2, and finally to ERK1/2. The ERK cascade
           plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. Gain-of-function mutations in
           genes encoding  ERK cascade proteins, including MEK2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 331

 Score = 31.6 bits (71), Expect = 0.027
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 11  RIPR-LVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHL 69
           RIP  ++ KV++ +L  L +     H +     +P N+++       ++KLCDFG+S  L
Sbjct: 99  RIPEEILGKVSIAVLRGLAY-LREKHQIMHRDVKPSNILVNSR---GEIKLCDFGVSGQL 154

Query: 70  SRDVDVREILGTPDYV 85
             D      +GT  Y+
Sbjct: 155 I-DSMANSFVGTRSYM 169


>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 1.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek1 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek1 is
           associated with centrosomes throughout the cell cycle.
           It is involved in the formation of primary cilium and in
           the maintenance of centrosomes. It cycles through the
           nucleus and may be capable of relaying signals between
           the cilium and the nucleus. Nek1 is implicated in the
           development of polycystic kidney disease, which is
           characterized by benign polycystic tumors formed by
           abnormal overgrowth of renal epithelial cells. It
           appears also to be involved in DNA damage response, and
           may be important for both correct DNA damage checkpoint
           activation and DNA repair.
          Length = 256

 Score = 31.7 bits (72), Expect = 0.027
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 4/42 (9%)

Query: 45  QNLVLTGEYPDCDVKLCDFGISRHLSRDVDV-REILGTPDYV 85
           QN+ LT    D  +KL DFGI+R L+  V++ R  +GTP Y+
Sbjct: 130 QNIFLT---KDGTIKLGDFGIARVLNSTVELARTCIGTPYYL 168


>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular
           signal-Regulated Kinase 1 and 2-like Serine/Threonine
           Kinases.  Serine/Threonine Kinases (STKs), Extracellular
           signal-regulated kinases 1 and 2 (ERK1/2) and Fus3
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. This
           ERK1/2-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           the mitogen-activated protein kinases (MAPKs) ERK1,
           ERK2, baker's yeast Fus3, and similar proteins. MAPK
           pathways are important mediators of cellular responses
           to extracellular signals. ERK1/2 activation is
           preferentially by mitogenic factors, differentiation
           stimuli, and cytokines, through a kinase cascade
           involving the MAPK kinases MEK1/2 and a MAPK kinase
           kinase from the Raf family. ERK1/2 have numerous
           substrates, many of which are nuclear and participate in
           transcriptional regulation of many cellular processes.
           They regulate cell growth, cell proliferation, and cell
           cycle progression from G1 to S phase. Although the
           distinct roles of ERK1 and ERK2 have not been fully
           determined, it is known that ERK2 can maintain most
           functions in the absence of ERK1, and that the deletion
           of ERK2 is embryonically lethal. The MAPK, Fus3,
           regulates yeast mating processes including
           mating-specific gene expression, G1 arrest, mating
           projection, and cell fusion.
          Length = 336

 Score = 31.5 bits (72), Expect = 0.029
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 3/24 (12%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISR 67
           P NL+L     +CD+K+CDFG++R
Sbjct: 134 PSNLLLNT---NCDLKICDFGLAR 154


>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine
           Kinase, Fungal Mitogen-Activated Protein Kinase MPK1.
           Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MPK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of the MAPKs MPK1 from Saccharomyces
           cerevisiae, Pmk1 from Schizosaccharomyces pombe, and
           similar proteins. MAPKs are important mediators of
           cellular responses to extracellular signals. MPK1 (also
           called Slt2) and Pmk1 (also called Spm1) are
           stress-activated MAPKs that regulate the cell wall
           integrity (CWI) pathway, and are therefore important in
           the maintainance of cell shape, cell wall construction,
           morphogenesis, and ion homeostasis. MPK1 is activated in
           response to cell wall stress including heat stimulation,
           osmotic shock, UV irradiation, and any agents that
           interfere with cell wall biogenesis such as chitin
           antagonists, caffeine, or zymolase. MPK1 is regulated by
           the MAP2Ks Mkk1/2, which are regulated by the MAP3K
           Bck1. Pmk1 is also activated by multiple stresses
           including elevated temperatures, hyper- or hypotonic
           stress, glucose deprivation, exposure to cell-wall
           damaging compounds, and oxidative stress. It is
           regulated by the MAP2K Pek1, which is regulated by the
           MAP3K Mkh1.
          Length = 332

 Score = 31.2 bits (71), Expect = 0.036
 Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 3/28 (10%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRHLS 70
           +P NL++     DC++K+CDFG++R  S
Sbjct: 132 KPGNLLVNA---DCELKICDFGLARGFS 156


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 31.4 bits (72), Expect = 0.036
 Identities = 12/44 (27%), Positives = 19/44 (43%), Gaps = 6/44 (13%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVDV---REILGTPDY 84
             N+++     D  VKL DFG ++ L           + GTP +
Sbjct: 129 GANILVD---SDGVVKLADFGCAKRLGDIETGEGTGSVRGTPYW 169


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score = 31.3 bits (72), Expect = 0.037
 Identities = 10/24 (41%), Positives = 16/24 (66%), Gaps = 3/24 (12%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISR 67
           PQN+++     D  +KL DFG++R
Sbjct: 126 PQNILINR---DGVLKLADFGLAR 146


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
           Protein Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, fungal Rim15-like kinases,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include Saccharomyces
           cerevisiae Rim15, Schizosaccharomyces pombe cek1, and
           similar fungal proteins. They contain a central
           catalytic domain, which contains an insert relative to
           MAST kinases. In addition, Rim15 contains a C-terminal
           signal receiver (REC) domain while cek1 contains an
           N-terminal PAS domain. Rim15 (or Rim15p) functions as a
           regulator of meiosis. It acts as a downstream effector
           of PKA and regulates entry into stationary phase (G0).
           Thus, it plays a crucial role in regulating yeast
           proliferation, differentiation, and aging. Cek1 may
           facilitate progression of mitotic anaphase.
          Length = 260

 Score = 30.9 bits (70), Expect = 0.042
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 12/46 (26%)

Query: 43  QPQNLVL--TGEYPDCDVKLCDFGISRHLSRDVDV-REILGTPDYV 85
           +P+NL++  TG      +KL DFG    LSR+    ++ +GTPDY+
Sbjct: 124 KPENLLIDQTGH-----LKLTDFG----LSRNGLENKKFVGTPDYL 160


>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein
           Serine/Threonine Kinase, Microtubule-associated
           serine/threonine-like kinase.  Serine/Threonine Kinases
           (STKs), Microtubule-associated serine/threonine (MAST)
           kinase subfamily, MAST-like (MASTL) kinases, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAST kinases contain an N-terminal domain of
           unknown function, a central catalytic domain, and a
           C-terminal PDZ domain that mediates protein-protein
           interactions. The MASTL kinases in this group carry only
           a catalytic domain, which contains a long insertion
           relative to MAST kinases. The human MASTL gene has also
           been labelled FLJ14813. A missense mutation in FLJ14813
           is associated with autosomal dominant thrombocytopenia.
           To date, the function of MASTL is unknown.
          Length = 669

 Score = 31.0 bits (70), Expect = 0.047
 Identities = 15/41 (36%), Positives = 29/41 (70%), Gaps = 4/41 (9%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISR-HLSRDVDVREILGTP 82
           +P N++++ E     +KL DFG+S+  L+R++++ +IL TP
Sbjct: 131 KPDNMLISNE---GHIKLTDFGLSKVTLNRELNMMDILTTP 168



 Score = 24.8 bits (54), Expect = 7.3
 Identities = 9/19 (47%), Positives = 12/19 (63%)

Query: 67  RHLSRDVDVREILGTPDYV 85
           R  +  V+   ILGTPDY+
Sbjct: 529 RRGAAPVEGERILGTPDYL 547


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
           protein kinase 3-like Protein Serine/Threonine Kinases. 
           Serine/threonine kinases (STKs), mammalian Ste20-like
           protein kinase 3 (MST3)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MST3-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST3, MST4,
           STK25, Schizosaccharomyces pombe Nak1 and Sid1,
           Saccharomyces cerevisiae sporulation-specific protein 1
           (SPS1), and related proteins. Nak1 is required by
           fission yeast for polarizing the tips of actin
           cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Sid1 is a component in the septation initiation network
           (SIN) signaling pathway, and plays a role in
           cytokinesis. SPS1 plays a role in regulating proteins
           required for spore wall formation. MST4 plays a role in
           mitogen-activated protein kinase (MAPK) signaling during
           cytoskeletal rearrangement, morphogenesis, and
           apoptosis. MST3 phosphorylates the STK NDR and may play
           a role in cell cycle progression and cell morphology.
           STK25 may play a role in the regulation of cell
           migration and polarization.
          Length = 274

 Score = 30.7 bits (70), Expect = 0.051
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 57  DVKLCDFGISRHLSRDVDVRE-ILGTP 82
           DVKL DFG+S  L+  +  R   +GTP
Sbjct: 136 DVKLADFGVSGQLTSTMSKRNTFVGTP 162


>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine
           Kinases, Fungal Mitogen-Activated Protein Kinases Sty1
           and Hog1.  Serine/Threonine Kinases (STKs), Fungal
           Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Sty1/Hog1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of the MAPKs Sty1
           from Schizosaccharomyces pombe, Hog1 from Saccharomyces
           cerevisiae, and similar proteins. MAPKs are important
           mediators of cellular responses to extracellular
           signals. Sty1 and Hog1 are stress-activated MAPKs that
           partipate in transcriptional regulation in response to
           stress. Sty1 is activated in response to oxidative
           stress, osmotic stress, and UV radiation. Sty1 is
           regulated by the MAP2K Wis1, which is activated by the
           MAP3Ks Wis4 and Win1, which receive signals of the
           stress condition from membrane-spanning histidine
           kinases Mak1-3. Activated Sty1 stabilizes the Atf1
           transcription factor and induces transcription of
           Atf1-dependent genes of the core environmetal stress
           response (CESR). Hog1 is the key element in the high
           osmolarity glycerol (HOG) pathway and is activated upon
           hyperosmotic stress. Activated Hog1 accumulates in the
           nucleus and regulates stress-induced transcription. The
           HOG pathway is mediated by two transmembrane
           osmosensors, Sln1 and Sho1.
          Length = 328

 Score = 30.9 bits (70), Expect = 0.052
 Identities = 10/25 (40%), Positives = 19/25 (76%), Gaps = 3/25 (12%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISR 67
           +P N+++     +CD+K+CDFG++R
Sbjct: 135 KPSNILIN---ENCDLKICDFGLAR 156


>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase(MAPKK) subfamily, fungal
           Pek1-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Pek1/Skh1 from
           Schizosaccharomyces pombe and MKK2 from Saccharomyces
           cerevisiae, and related proteins. Both fission yeast
           Pek1 and baker's yeast MKK2 are components of the cell
           integrity MAPK pathway. In fission yeast, Pek1
           phosphorylates and activates the MAPK Pmk1/Spm1 and is
           regulated by the MAPKKK Mkh1. In baker's yeast, the
           pathway involves the MAPK Slt2, the MAPKKs MKK1 and
           MKK2, and the MAPKKK Bck1. The cell integrity MAPK
           cascade is activated by multiple stress conditions, and
           is essential  in cell wall construction, morphogenesis,
           cytokinesis, and ion homeostasis.
          Length = 287

 Score = 30.9 bits (70), Expect = 0.054
 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 3/24 (12%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGIS 66
           +P N++LT +     VKLCDFG+S
Sbjct: 132 KPSNILLTRK---GQVKLCDFGVS 152


>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated
           protein kinase kinase kinase kinase-like Protein
           Serine/Threonine Kinases.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K3-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily includes MAP4K3, MAP4K1,
           MAP4K2, MAP4K5, and related proteins. Vertebrate members
           contain an N-terminal catalytic domain and a C-terminal
           citron homology (CNH) regulatory domain, similar to
           MAP4K4/6. MAP4Ks are involved in some MAPK signaling
           pathways that are important in mediating cellular
           responses to extracellular signals by activating a MAPK
           kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAP3K to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. MAP4K1, also called haematopoietic
           progenitor kinase 1 (HPK1), is a hematopoietic-specific
           STK involved in many cellular signaling cascades
           including MAPK, antigen receptor, apoptosis, growth
           factor, and cytokine signaling. It participates in the
           regulation of T cell receptor signaling and T
           cell-mediated immune responses. MAP4K2 was referred to
           as germinal center (GC) kinase because of its preferred
           location in GC B cells. MAP4K3 plays a role in the
           nutrient-responsive pathway of mTOR (mammalian target of
           rapamycin) signaling. It is required in the activation
           of S6 kinase by amino acids and for the phosphorylation
           of the mTOR-regulated inhibitor of eukaryotic initiation
           factor 4E. MAP4K5, also called germinal center
           kinase-related enzyme (GCKR), has been shown to activate
           the MAPK c-Jun N-terminal kinase (JNK).
          Length = 262

 Score = 30.3 bits (69), Expect = 0.071
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 4/38 (10%)

Query: 46  NLVLTGEYPDCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           N++LT    D DVKL DFG+S  L+  +  R+  +GTP
Sbjct: 131 NILLT---EDGDVKLADFGVSAQLTATIAKRKSFIGTP 165


>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein
           Kinase, MAP/ERK Kinase.  Protein kinases (PKs), MAP/ERK
           kinase (MEK) subfamily, catalytic (c) domain. PKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine or tyrosine residues on protein
           substrates. The MEK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1
           and MEK2 are dual-specificity PKs that phosphorylate and
           activate the downstream targets, ERK(extracellular
           signal-regulated kinase) 1 and ERK2, on specific
           threonine and tyrosine residues. The ERK cascade starts
           with extracellular signals including growth factors,
           hormones, and neurotransmitters, which act through
           receptors and ion channels to initiate intracellular
           signaling that leads to the activation at the MAPKKK
           (Raf-1 or MOS) level, which leads to the transmission of
           signals to MEK1/2, and finally to ERK1/2. The ERK
           cascade plays an important role in cell proliferation,
           differentiation, oncogenic transformation, and cell
           cycle control, as well as in apoptosis and cell survival
           under certain conditions. This cascade has also been
           implicated in synaptic plasticity, migration,
           morphological determination, and stress response
           immunological reactions. Gain-of-function mutations in
           genes encoding ERK cascade proteins, including MEK1/2,
           cause cardiofaciocutaneous (CFC) syndrome, a condition
           leading to multiple congenital anomalies and mental
           retardation in patients.
          Length = 308

 Score = 30.1 bits (68), Expect = 0.082
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 9   VARIPR-LVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR 67
             RIP  ++ K+++ +L  L +     H +     +P N+++       ++KLCDFG+S 
Sbjct: 93  AGRIPENILGKISIAVLRGLTY-LREKHKIMHRDVKPSNILVNS---RGEIKLCDFGVSG 148

Query: 68  HL 69
            L
Sbjct: 149 QL 150


>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine
           Kinases, Vascular Endothelial Growth Factor Receptors.
           Protein Tyrosine Kinase (PTK) family; Vascular
           Endothelial Growth Factor Receptor (VEGFR) subfamily;
           catalytic (c) domain. The VEGFR subfamily consists of
           VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           VEGFR subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           seven immunoglobulin (Ig)-like domains, a transmembrane
           segment, and an intracellular catalytic domain. In
           VEGFR3, the fifth Ig-like domain is replaced by a
           disulfide bridge. The binding of VEGFRs to their
           ligands, the VEGFs, leads to receptor dimerization,
           activation, and intracellular signaling. There are five
           VEGF ligands in mammals, which bind, in an overlapping
           pattern to the three VEGFRs, which can form homo or
           heterodimers. VEGFRs regulate the cardiovascular system.
           They are critical for vascular development during
           embryogenesis and blood vessel formation in adults. They
           induce cellular functions common to other growth factor
           receptors such as cell migration, survival, and
           proliferation. VEGFR1 binds VEGFA, VEGFB, and placenta
           growth factor (PLGF). It regulates monocyte and
           macrophage migration, vascular permeability,
           haematopoiesis, and the recruitment of haematopietic
           progenitor cells from the bone marrow.
          Length = 337

 Score = 30.2 bits (68), Expect = 0.084
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 9/28 (32%)

Query: 58  VKLCDFGISRHLSRDVDVREILGTPDYV 85
           VK+CDFG++R + +D         PDYV
Sbjct: 212 VKICDFGLARDIYKD---------PDYV 230


>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yank1.  Serine/Threonine
           Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Yank1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily
           contains uncharacterized STKs with similarity to the
           human protein designated Yank1 or STK32A.
          Length = 258

 Score = 30.0 bits (68), Expect = 0.087
 Identities = 9/27 (33%), Positives = 13/27 (48%)

Query: 58  VKLCDFGISRHLSRDVDVREILGTPDY 84
           V + DF I+  ++ D       GTP Y
Sbjct: 139 VHITDFNIATKVTPDTLTTSTSGTPGY 165


>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant
           dual-specificity MAP kinase kinases and similar
           proteins.  Protein kinases (PKs), MAP kinase kinase
           (MAPKK) subfamily, Plant MAPKKs and similar proteins,
           catalytic (c) domain. PKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine or
           tyrosine residues on protein substrates. The MAPKK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein serine/threonine
           kinases, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The mitogen-activated protein
           (MAP) kinase signaling pathways are important mediators
           of cellular responses to extracellular signals. The
           pathways involve a triple kinase core cascade comprising
           of the MAP kinase (MAPK), which is phosphorylated and
           activated by a MAPK kinase (MAPKK or MKK), which itself
           is phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). Members of this group include MAPKKs
           from plants, kinetoplastids, alveolates, and mycetozoa.
           The MAPKK, LmxPK4, from Leishmania mexicana, is
           important in differentiation and virulence.
           Dictyostelium discoideum MEK1 is required for proper
           chemotaxis. MEK1 null mutants display severe defects in
           cell polarization and directional movement. Plants
           contain multiple MAPKKs like other eukaryotes. The
           Arabidopsis genome encodes for 10 MAPKKs while poplar
           and rice contain 13 MAPKKs each. The functions of these
           proteins have not been fully elucidated. There is
           evidence to suggest that MAPK cascades are involved in
           plant stress responses. In Arabidopsis, MKK3 plays a
           role in pathogen signaling, MKK2 is involved in cold and
           salt stress signaling, MKK4/MKK5 participates in innate
           immunity, and MKK7 regulates basal and systemic acquired
           resistance.
          Length = 264

 Score = 29.9 bits (68), Expect = 0.11
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 7/35 (20%)

Query: 44  PQNLVL--TGEYPDCDVKLCDFGISRHLSRDVDVR 76
           P NL++   GE     VK+ DFGIS+ L   +D  
Sbjct: 128 PSNLLINSKGE-----VKIADFGISKVLENTLDQC 157


>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of
           cAMP-dependent protein kinase-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), Fission yeast Suppressor of loss of
           cAMP-dependent protein kinase (Sck1)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sck1-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of fungal proteins
           with similarity to the Schizosaccharomyces pombe STK
           Sck1. Sck1 plays a role in trehalase activation
           triggered by glucose and a nitrogen source. Trehalase
           catalyzes the cleavage of the disaccharide trehalose to
           glucose. Trehalose, as a carbohydrate reserve and stress
           metabolite, plays an important role in the response of
           yeast to environmental changes.
          Length = 330

 Score = 29.9 bits (67), Expect = 0.12
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 5/76 (6%)

Query: 11  RIPRLVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR-HL 69
           R     AK  +  L     H      +YR   +P+N++L        + LCDFG+S+ +L
Sbjct: 92  RFSEDRAKFYIAELVLALEHLHKYDIVYRDL-KPENILLDA---TGHIALCDFGLSKANL 147

Query: 70  SRDVDVREILGTPDYV 85
           + +       GT +Y+
Sbjct: 148 TDNKTTNTFCGTTEYL 163


>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase Like 5.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 5 (CDKL5) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. Mutations in the gene encoding CDKL5,
           previously called STK9, are associated with early onset
           epilepsy and severe mental retardation [X-linked
           infantile spasm syndrome (ISSX) or West syndrome]. In
           addition, CDKL5 mutations also sometimes cause a
           phenotype similar to Rett syndrome (RTT), a progressive
           neurodevelopmental disorder. These pathogenic mutations
           are located in the N-terminal portion of the protein
           within the kinase domain.
          Length = 287

 Score = 29.6 bits (66), Expect = 0.15
 Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 3/32 (9%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRHLSRDVD 74
           +P+NL+++    +  +KLCDFG +R+LS   +
Sbjct: 127 KPENLLISH---NDVLKLCDFGFARNLSEGSN 155


>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 1 and 4.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 1 (CDKL1) and CDKL4 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL1 and CDKL4
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL1, also called
           p42 KKIALRE, is a glial protein that is upregulated in
           gliosis. It is present in neuroblastoma and A431 human
           carcinoma cells, and may be implicated in neoplastic
           transformation. The function of CDKL4 is unknown.
          Length = 286

 Score = 29.3 bits (66), Expect = 0.17
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 15  LVAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHLS 70
           L+ K+    L ++N  F   H+      +P+N+++T +     +KLCDFG +R L+
Sbjct: 101 LIKKIIWQTLQAVN--FCHKHNCIHRDVKPENILITKQG---QIKLCDFGFARILT 151


>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Ste20-like kinase.  Serine/threonine kinases
           (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SLK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. SLK promotes
           apoptosis through apoptosis signal-regulating kinase 1
           (ASK1) and the mitogen-activated protein kinase (MAPK)
           p38. It acts as a MAPK kinase kinase (MAPKKK) by
           phosphorylating ASK1, resulting in the phosphorylation
           of p38. SLK also plays a role in mediating actin
           reorganization. It is part of a microtubule-associated
           complex that is targeted at adhesion sites, and is
           required in focal adhesion turnover and in regulating
           cell migration.
          Length = 282

 Score = 29.2 bits (65), Expect = 0.17
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 55  DCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           D D+KL DFG+S   +R +  R+  +GTP
Sbjct: 139 DGDIKLADFGVSAKNTRTIQRRDSFIGTP 167


>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase,
           p38 Mitogen-Activated Protein Kinase.  Serine/Threonine
           Kinases (STKs), p38 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The p38 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. p38 kinases are
           mitogen-activated protein kinases (MAPKs), serving as
           important mediators of cellular responses to
           extracellular signals. They function in the regulation
           of the cell cycle, cell development, cell
           differentiation, senescence, tumorigenesis, apoptosis,
           pain development and pain progression, and immune
           responses. p38 kinases are activated by the MAPK kinases
           MKK3 and MKK6, which in turn are activated by upstream
           MAPK kinase kinases including TAK1, ASK1, and MLK3, in
           response to cellular stresses or inflammatory cytokines.
           p38 substrates include other protein kinases and factors
           that regulate transcription, nuclear export, mRNA
           stability and translation. p38 kinases are drug targets
           for the inflammatory diseases psoriasis, rheumatoid
           arthritis, and chronic pulmonary disease. Vertebrates
           contain four isoforms of p38, named alpha, beta, gamma,
           and delta, which show varying substrate specificity and
           expression patterns. p38alpha and p38beta are
           ubiquitously expressed, p38gamma is predominantly found
           in skeletal muscle, and p38delta is found in the heart,
           lung, testis, pancreas, and small intestine.
          Length = 343

 Score = 29.2 bits (66), Expect = 0.18
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLS 70
           P N+ +     DC++K+ DFG++RH  
Sbjct: 146 PSNIAVNE---DCELKILDFGLARHTD 169


>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Citron Rho-interacting kinase. 
           Serine/Threonine Kinases (STKs), Citron Rho-interacting
           kinase (CRIK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The CRIK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CRIK is also called citron kinase. It contains
           a catalytic domain, a central coiled-coil domain, and a
           C-terminal region containing a Rho-binding domain (RBD),
           a zinc finger, and a pleckstrin homology (PH) domain, in
           addition to other motifs. CRIK, an effector of the small
           GTPase Rho, plays an important function during
           cytokinesis and affects its contractile process.
           CRIK-deficient mice show severe ataxia and epilepsy as a
           result of abnormal cytokinesis and massive apoptosis in
           neuronal precursors. A Down syndrome critical region
           protein TTC3 interacts with CRIK and inhibits
           CRIK-dependent neuronal differentiation and neurite
           extension.
          Length = 330

 Score = 29.4 bits (66), Expect = 0.18
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 9/47 (19%)

Query: 43  QPQNLVL--TGEYPDCDVKLCDFGISRHLSRDVDVREIL--GTPDYV 85
           +P+N+++  TG      +KL DFG +  L+ +  V   L  GTPDY+
Sbjct: 129 KPENVLIDRTGH-----IKLADFGSAARLTANKMVNSKLPVGTPDYI 170


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 29.3 bits (64), Expect = 0.18
 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 9/48 (18%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVD-------VREILGTPDY 84
           P+N++L        VKL DFG+++ L                +GTP Y
Sbjct: 129 PENILLD--RDGRVVKLIDFGLAKLLPDPGSTSSIPALPSTSVGTPGY 174


>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           alpha.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, alpha isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           PKC-alpha is expressed in many tissues and is associated
           with cell proliferation, apoptosis, and cell motility.
           It plays a role in the signaling of the growth factors
           PDGF, VEGF, EGF, and FGF. Abnormal levels of PKC-alpha
           have been detected in many transformed cell lines and
           several human tumors. In addition, PKC-alpha is required
           for HER2 dependent breast cancer invasion.
          Length = 323

 Score = 29.2 bits (65), Expect = 0.20
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 58  VKLCDFGISR-HLSRDVDVREILGTPDYVG 86
           +K+ DFG+ + H+   V  R   GTPDY+ 
Sbjct: 140 IKIADFGMCKEHMVDGVTTRTFCGTPDYIA 169


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
           Serine/Threonine Kinase, cGMP-dependent protein kinase. 
           Serine/Threonine Kinases (STKs), cGMP-dependent protein
           kinase (cGK or PKG) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The cGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mammals have two cGK isoforms
           from different genes, cGKI and cGKII. cGKI exists as two
           splice variants, cGKI-alpha and cGKI-beta. cGK consists
           of an N-terminal regulatory domain containing a
           dimerization and an autoinhibitory pseudosubstrate
           region, two cGMP-binding domains, and a C-terminal
           catalytic domain. Binding of cGMP to both binding sites
           releases the inhibition of the catalytic center by the
           pseudosubstrate region, allowing autophosphorylation and
           activation of the kinase. cGKI is a  soluble protein
           expressed in all smooth muscles, platelets, cerebellum,
           and kidney. It is also expressed at lower concentrations
           in other tissues. cGKII is a membrane-bound protein that
           is most abundantly expressed in the intestine. It is
           also present in the brain nuclei, adrenal cortex,
           kidney, lung, and prostate. cGKI is involved in the
           regulation of smooth muscle tone, smooth cell
           proliferation, and platelet activation. cGKII plays a
           role in the regulation of secretion, such as renin
           secretion by the kidney and aldosterone secretion by the
           adrenal. It also regulates bone growth and the circadian
           rhythm.
          Length = 262

 Score = 29.1 bits (66), Expect = 0.21
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 44  PQNLVLTGE-YPDCDVKLCDFGISRHLSRDVDVREILGTPDYV 85
           P+NL+L    Y    VKL DFG ++ L          GTP+YV
Sbjct: 121 PENLLLDSNGY----VKLVDFGFAKKLKSGQKTWTFCGTPEYV 159


>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine
           Kinase, Vascular Endothelial Growth Factor Receptor 3.
           Protein Tyrosine Kinase (PTK) family; Vascular
           Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic
           (c) domain. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           VEGFR3 (or Flt4) is a member of the VEGFR subfamily of
           proteins, which are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           seven immunoglobulin (Ig)-like domains, a transmembrane
           segment, and an intracellular catalytic domain. In
           VEGFR3, the fifth Ig-like domain is replaced by a
           disulfide bridge. The binding of VEGFRs to their
           ligands, the VEGFs, leads to receptor dimerization,
           activation, and intracellular signaling. VEGFR3
           preferentially binds the ligands VEGFC and VEGFD. VEGFR3
           is essential for lymphatic endothelial cell (EC)
           development and function. It has been shown to regulate
           adaptive immunity during corneal transplantation. VEGFR3
           is upregulated on blood vascular ECs in pathological
           conditions such as vascular tumors and the periphery of
           solid tumors. It plays a role in cancer progression and
           lymph node metastasis. Missense mutations in the VEGFR3
           gene are associated with primary human lymphedema.
          Length = 338

 Score = 29.2 bits (65), Expect = 0.21
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 9/28 (32%)

Query: 58  VKLCDFGISRHLSRDVDVREILGTPDYV 85
           VK+CDFG++R + +D         PDYV
Sbjct: 213 VKICDFGLARDIYKD---------PDYV 231


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control
           protein 7-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs),  (Cdc7)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Cdc7-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include
           Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae
           Cdc15, Arabidopsis thaliana mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK) epsilon, and
           related proteins. MAPKKKs phosphorylate and activate
           MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Fission yeast Cdc7
           is essential for cell division by playing a key role in
           the initiation of septum formation and cytokinesis.
           Budding yeast Cdc15 functions to coordinate mitotic exit
           with cytokinesis. Arabidopsis MAPKKK epsilon is required
           for pollen development in the plasma membrane.
          Length = 254

 Score = 28.8 bits (65), Expect = 0.24
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%)

Query: 58  VKLCDFGISRHLSR-DVDVREILGTP 82
           VKL DFG++  L+    D   ++GTP
Sbjct: 138 VKLADFGVATKLNDVSKDDASVVGTP 163


>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C.
           Serine/Threonine Kinases (STKs), Classical (or
           Conventional) Protein Kinase C (cPKC) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. cPKCs contain a
           calcium-binding C2 region in their regulatory domain.
           There are four cPKC isoforms, named alpha, betaI,
           betaII, and gamma. cPKCs are potent kinases for
           histones, myelin basic protein, and protamine. PKC-gamma
           is mainly expressed in neuronal tissues. It plays a role
           in protection from ischemia.
          Length = 324

 Score = 29.0 bits (65), Expect = 0.26
 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 58  VKLCDFGISR-HLSRDVDVREILGTPDYV 85
           +K+ DFG+ + ++      R   GTPDY+
Sbjct: 140 IKIADFGMCKENIFGGKTTRTFCGTPDYI 168


>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the
           Serine/Threonine Kinase, p38alpha Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38alpha subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38alpha subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38alpha, also called MAPK14, is expressed in
           most tissues and is the major isoform involved in the
           immune and inflammatory response. It is the central p38
           MAPK involved in myogenesis. It plays a role in
           regulating cell cycle check-point transition and
           promoting cell differentiation. p38alpha also regulates
           cell proliferation and death through crosstalk with the
           JNK pathway. Its substrates include MAPK activated
           protein kinase 2 (MK2), MK5, and the transcription
           factors ATF2 and Mitf.
          Length = 345

 Score = 28.9 bits (64), Expect = 0.27
 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 3/26 (11%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRH 68
           +P NL +     DC++K+ DFG++RH
Sbjct: 147 KPSNLAVN---EDCELKILDFGLARH 169


>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase,
           Focal Adhesion Kinase.  Protein Tyrosine Kinase (PTK)
           family; Focal Adhesion Kinase (FAK); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FAK is a
           cytoplasmic (or nonreceptor) tyr kinase that contains an
           autophosphorylation site and a FERM domain at the
           N-terminus, a central tyr kinase domain, proline-rich
           regions, and a C-terminal FAT (focal adhesion targeting)
           domain. FAK activity is dependent on integrin-mediated
           cell adhesion, which facilitates N-terminal
           autophosphorylation. Full activation is achieved by the
           phosphorylation of its two adjacent A-loop tyrosines.
           FAK is important in mediating signaling initiated at
           sites of cell adhesions and at growth factor receptors.
           Through diverse molecular interactions, FAK functions as
           a biosensor or integrator to control cell motility. It
           is a key regulator of cell survival, proliferation,
           migration and invasion, and thus plays an important role
           in the development and progression of cancer. Src binds
           to autophosphorylated FAK forming the FAK-Src dual
           kinase complex, which is activated in a wide variety of
           tumor cells and generates signals promoting growth and
           metastasis. FAK is being developed as a target for
           cancer therapy.
          Length = 270

 Score = 28.5 bits (64), Expect = 0.28
 Identities = 12/19 (63%), Positives = 15/19 (78%), Gaps = 1/19 (5%)

Query: 54  PDCDVKLCDFGISRHLSRD 72
           PDC VKL DFG+SR+L  +
Sbjct: 143 PDC-VKLGDFGLSRYLEDE 160


>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 8-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 8 (CDK8)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK8-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDK8, CDC2L6, and similar proteins. CDK8
           functions as a negative or positive regulator of
           transcription, depending on the scenario. Together with
           its regulator, cyclin C, it reversibly associates with
           the multi-subunit core Mediator complex, a cofactor that
           is involved in regulating RNA polymerase II (RNAP
           II)-dependent transcription. CDC2L6 also associates with
           Mediator in complexes lacking CDK8. In VP16-dependent
           transcriptional activation, CDK8 and CDC2L6 exerts
           opposing effects by positive and negative regulation,
           respectively, in similar conditions.
          Length = 316

 Score = 28.8 bits (65), Expect = 0.30
 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 1/26 (3%)

Query: 44  PQNLVLTGEYPDCD-VKLCDFGISRH 68
           P N+++ GE P+   VK+ D G++R 
Sbjct: 136 PANILVMGEGPERGVVKIGDLGLARL 161


>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine
           Kinase, Cell Cycle-Related Kinase.  Serine/Threonine
           Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CCRK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CCRK was previously called p42. It is a
           Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK)
           which is essential for the activation of CDK2. It is
           indispensable for cell growth and has been implicated in
           the progression of glioblastoma multiforme. In the
           heart, a splice variant of CCRK with a different
           C-terminal half is expressed, this variant promotes
           cardiac cell growth and survival and is significantly
           down-regulated during the development of heart failure.
          Length = 286

 Score = 28.4 bits (64), Expect = 0.33
 Identities = 10/29 (34%), Positives = 18/29 (62%), Gaps = 3/29 (10%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRD 72
           P NL+++    D  +K+ DFG++R  S +
Sbjct: 127 PANLLIS---ADGVLKIADFGLARLFSEE 152


>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine
           Kinase, Vascular Endothelial Growth Factor Receptor 2.
           Protein Tyrosine Kinase (PTK) family; Vascular
           Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic
           (c) domain. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           VEGFR2 (or Flk1) is a member of the VEGFR subfamily of
           proteins, which are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           seven immunoglobulin (Ig)-like domains, a transmembrane
           segment, and an intracellular catalytic domain. The
           binding of VEGFRs to their ligands, the VEGFs, leads to
           receptor dimerization, activation, and intracellular
           signaling. The carboxyl terminus of VEGFR2 plays an
           important role in its autophosphorylation and
           activation. VEGFR2 binds the ligands VEGFA, VEGFC, VEGFD
           and VEGFE. VEGFR2 signaling is implicated in all aspects
           of normal and pathological vascular endothelial cell
           biology. It induces a variety of cellular effects
           including migration, survival, and proliferation. It is
           critical in regulating embryonic vascular development
           and angiogenesis. VEGFR2 is the major signal transducer
           in pathological angiogenesis including cancer and
           diabetic retinopathy, and is a target for inhibition in
           cancer therapy.
          Length = 343

 Score = 28.5 bits (63), Expect = 0.35
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 9/28 (32%)

Query: 58  VKLCDFGISRHLSRDVDVREILGTPDYV 85
           VK+CDFG++R + +D         PDYV
Sbjct: 218 VKICDFGLARDIYKD---------PDYV 236


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 28.3 bits (64), Expect = 0.35
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 55  DCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           D  VKL DFG +  L+++   R  ++GTP
Sbjct: 152 DGSVKLADFGFAAQLTKEKSKRNSVVGTP 180


>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the
           Serine/Threonine Kinase, p38delta Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38delta subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38delta subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38delta, also called MAPK13, is found in
           skeletal muscle, heart, lung, testis, pancreas, and
           small intestine. It regulates microtubule function by
           phosphorylating Tau. It activates the c-jun promoter and
           plays a role in G2 cell cycle arrest. It also controls
           the degration of c-Myb, which is associated with myeloid
           leukemia and poor prognosis in colorectal cancer.
           p38delta is the main isoform involved in regulating the
           differentiation and apoptosis of keratinocytes.
          Length = 342

 Score = 28.3 bits (63), Expect = 0.36
 Identities = 11/26 (42%), Positives = 18/26 (69%), Gaps = 3/26 (11%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRH 68
           +P NL +     DC++K+ DFG++RH
Sbjct: 144 KPGNLAVN---EDCELKILDFGLARH 166


>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the
           Serine/Threonine Kinases, TDY Mitogen-Activated Protein
           Kinases from Plants.  Serine/Threonine Kinases (STKs),
           Plant TDY Mitogen-Activated Protein Kinase (MAPK)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The TDY
           MAPK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKs are important mediators of cellular
           responses to extracellular signals. In plants, MAPKs are
           associated with physiological, developmental, hormonal,
           and stress responses. Some plants show numerous gene
           duplications of MAPKs. Arabidopsis thaliana harbors at
           least 20 MAPKs, named AtMPK1-20. Oryza sativa contains
           at least 17 MAPKs. There are two subtypes of plant MAPKs
           based on the conserved phosphorylation motif present in
           the activation loop, TEY and TDY. Arabidopsis thaliana
           contains more TEY-type MAPKs than TDY-type, whereas the
           reverse is true for Oryza sativa. This subfamily
           represents the TDY subtype and is composed of Group D
           plant MAPKs including Arabidopsis thaliana MPK18
           (AtMPK18), Oryza sativa Blast- and Wound-induced MAPK1
           (OsBWMK1), OsWJUMK1 (Wound- and JA-Uninducible MAPK1),
           Zea mays MPK6, and the Medicago sativa TDY1 gene
           product. OsBWMK1 enhances resistance to pathogenic
           infections. It mediates stress-activated defense
           responses by activating a transcription factor that
           affects the expression of stress-related genes. AtMPK18
           is involved in microtubule-related functions.
          Length = 338

 Score = 28.2 bits (63), Expect = 0.38
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 5/45 (11%)

Query: 23  LLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR 67
           LL +L   +  T +++    +P+N++      DC +K+CDFG++R
Sbjct: 112 LLRALK--YIHTANVFHRDLKPKNILANA---DCKLKICDFGLAR 151


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 2.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek2 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek2
           subfamily includes Aspergillus nidulans NIMA kinase, the
           founding member of the Nek family, which was identified
           in a screen for cell cycle mutants prevented from
           entering mitosis. NIMA is essential for mitotic entry
           and progression through mitosis, and its degradation is
           essential for mitotic exit. NIMA is involved in nuclear
           membrane fission. Vertebrate Nek2 is a cell
           cycle-regulated STK, localized in centrosomes and
           kinetochores, that regulates centrosome splitting at the
           G2/M phase. It also interacts with other mitotic kinases
           such as Polo-like kinase 1 and may play a role in
           spindle checkpoint. An increase in the expression of the
           human NEK2 gene is strongly associated with the
           progression of non-Hodgkin lymphoma.
          Length = 265

 Score = 28.0 bits (63), Expect = 0.44
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDVDV-REILGTPDY 84
           P N+ L     + +VKL DFG+++ L  D    +  +GTP Y
Sbjct: 138 PANIFLDA---NNNVKLGDFGLAKILGHDSSFAKTYVGTPYY 176


>gnl|CDD|176388 cd01793, Fubi, Fubi ubiquitin-like protein.  Fubi is a
          ubiquitin-like protein encoded by the fau gene which
          has an  N-terminal ubiquitin-like domain (also referred
          to as FUBI) fused to the ribosomal protein S30.  Fubi
          is thought to be a tumor suppressor protein and the
          FUBI domain may act as a substitute or an inhibitor of
          ubiquitin or one of ubiquitin's close relatives UCRP,
          FAT10, and Nedd8.
          Length = 74

 Score = 27.0 bits (60), Expect = 0.49
 Identities = 11/40 (27%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 41 CSQPQNLVLTGEYPDCDVKLCDFGISRHLSRDVDVREILG 80
            + Q L+L G   + D  L   G+    + +V  R +LG
Sbjct: 35 DVEDQVLLLAGVPLEDDATLGQCGVEELCTLEVAGR-LLG 73


>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein
           Kinase Like Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Cyclin-dependent protein kinase like
           (CDKL) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDKL subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDKL1-5 and similar proteins. Some CDKLs,
           like CDKL1 and CDKL3, may be implicated in
           transformation and others, like CDKL3 and CDKL5, are
           associated with mental retardation when impaired. CDKL2
           plays a role in learning and memory.
          Length = 288

 Score = 28.1 bits (63), Expect = 0.49
 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLS 70
           P+N++++       +KLCDFG +R L 
Sbjct: 128 PENILVS---ESGVLKLCDFGFARALR 151


>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 5.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 5 (CDK5) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK5 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK5
           is unusual in that it is regulated by non-cyclin
           proteins, p35 and p39. It is highly expressed in the
           nervous system and is critical in normal neural
           development and function. It plays a role in neuronal
           migration and differentiation, and is also important in
           synaptic plasticity and learning. CDK5 also participates
           in protecting against cell death and promoting
           angiogenesis. Impaired CDK5 activity is implicated in
           Alzheimer's disease, amyotrophic lateral sclerosis,
           Parkinson's disease, Huntington's disease and acute
           neuronal injury.
          Length = 284

 Score = 27.8 bits (62), Expect = 0.53
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 13  PRLVAKVTVTLLGSLNH-HFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR 67
           P +V      LL  L   H  S + L+R   +PQNL++     + ++KL DFG++R
Sbjct: 98  PEIVKSFMFQLLKGLAFCH--SHNVLHRDL-KPQNLLINK---NGELKLADFGLAR 147


>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 6.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 6, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK6 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK6 may play a role in stress responses
           through its activation by the mitogen-activated protein
           kinase (MAPK) p38 and MAPK kinase 6 (MKK6) pathway. PAK6
           is highly expressed in the brain. It is not required for
           viability, but together with PAK5, it is required for
           normal levels of locomotion and activity, and for
           learning and memory. Increased expression of PAK6 is
           found in primary and metastatic prostate cancer. PAK6
           may play a role in the regulation of motility.
          Length = 297

 Score = 28.1 bits (62), Expect = 0.54
 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 55  DCDVKLCDFGISRHLSRDVDVREIL-GTP 82
           D  VKL DFG    +S+DV  R+ L GTP
Sbjct: 153 DGRVKLSDFGFCAQISKDVPKRKSLVGTP 181


>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein
           Serine/Threonine Kinases, Oxidative stress response
           kinase and Ste20-related proline alanine-rich kinase.
           Serine/threonine kinases (STKs), oxidative stress
           response kinase (OSR1) and Ste20-related proline
           alanine-rich kinase (SPAK) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The OSR1 and SPAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. SPAK is also referred to as STK39 or PASK
           (proline-alanine-rich STE20-related kinase). OSR1 and
           SPAK regulate the activity of cation-chloride
           cotransporters through direct interaction and
           phosphorylation. They are also implicated in
           cytoskeletal rearrangement, cell differentiation,
           transformation and proliferation. OSR1 and SPAK contain
           a conserved C-terminal (CCT) domain, which recognizes a
           unique motif ([RK]FX[VI]) present in their activating
           kinases (WNK1/WNK4) and their substrates.
          Length = 267

 Score = 27.7 bits (62), Expect = 0.59
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 7/40 (17%)

Query: 48  VLTGEYPDCDVKLCDFGISRHLSRDVDVRE-----ILGTP 82
           +L GE  D  VK+ DFG+S  L+   D         +GTP
Sbjct: 133 ILLGE--DGSVKIADFGVSASLADGGDRTRKVRKTFVGTP 170


>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 9.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek9 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek9, also called
           Nercc1, is primarily a cytoplasmic protein but can also
           localize in the nucleus. It is involved in modulating
           chromosome alignment and splitting during mitosis. It
           interacts with the gamma-tubulin ring complex and the
           Ran GTPase, and is implicated in microtubule
           organization. Nek9 associates with FACT (FAcilitates
           Chromatin Transcription) and modulates interphase
           progression. It also interacts with Nek6, and Nek7,
           during mitosis, resulting in their activation.
          Length = 256

 Score = 27.8 bits (62), Expect = 0.63
 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 58  VKLCDFGISRHLSRDVDVRE-ILGTPDYV 85
           +KL DFGIS+ L  +  + E ++GTP Y+
Sbjct: 140 IKLGDFGISKILGSEYSMAETVVGTPYYM 168


>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein
           Kinase, MAP kinase kinase 5.  Protein kinases (PKs), MAP
           kinase kinase 5 (MKK5) subfamily, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The MKK5 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein serine/threonine kinases, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The mitogen-activated protein (MAP) kinase
           signaling pathways are important mediators of cellular
           responses to extracellular signals. The pathways involve
           a triple kinase core cascade comprising of the MAP
           kinase (MAPK), which is phosphorylated and activated by
           a MAPK kinase (MAPKK or MKK), which itself is
           phosphorylated and activated by a MAPK kinase kinase
           (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a
           dual-specificity PK that phosphorylates its downstream
           target, extracellular signal-regulated kinase 5 (ERK5),
           on specific threonine and tyrosine residues. MKK5 is
           activated by MEKK2 and MEKK3 in response to mitogenic
           and stress stimuli. The ERK5 cascade promotes cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. This cascade plays an essential role in
           heart development. Mice deficient in either ERK5 or MKK5
           die around embryonic day 10 due to cardiovascular
           defects including underdevelopment of the myocardium. In
           addition, MKK5 is associated with metastasis and
           unfavorable prognosis in prostate cancer.
          Length = 279

 Score = 27.5 bits (61), Expect = 0.81
 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 7/29 (24%)

Query: 58  VKLCDFGISRHLSRDVDVREILGTPDYVG 86
           VKLCDFG+S  L     V  I  T  YVG
Sbjct: 134 VKLCDFGVSTQL-----VNSIAKT--YVG 155


>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein
           Serine/Threonine Kinase, Group II p21-activated kinase. 
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) subfamily, Group II, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PAK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group II PAKs, also called non-conventional PAKs,
           include PAK4, PAK5, and PAK6. Group II PAKs contain PBD
           (p21-binding domain) and catalytic domains, but lack
           other motifs found in group I PAKs, such as an AID
           (autoinhibitory domain) and SH3 binding sites. Since
           group II PAKs do not contain an obvious AID, they may be
           regulated differently from group I PAKs. While group I
           PAKs interact with the SH3 containing proteins Nck, Grb2
           and PIX, no such binding has been demonstrated for group
           II PAKs. Some known substrates of group II PAKs are also
           substrates of group I PAKs such as Raf, BAD, LIMK and
           GEFH1. Unique group II substrates include MARK/Par-1 and
           PDZ-RhoGEF. Group II PAKs play important roles in
           filopodia formation, neuron extension, cytoskeletal
           organization, and cell survival.
          Length = 285

 Score = 27.4 bits (61), Expect = 0.87
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 55  DCDVKLCDFGISRHLSRDVDVREIL-GTP 82
           D  VKL DFG    +S++V  R+ L GTP
Sbjct: 151 DGRVKLSDFGFCAQVSKEVPRRKSLVGTP 179


>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the
           Serine/Threonine Kinase, p38gamma Mitogen-Activated
           Protein Kinase.  Serine/Threonine Kinases (STKs),
           p38gamma subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           p38gamma subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. p38 kinases are mitogen-activated protein
           kinases (MAPKs), serving as important mediators of
           cellular responses to extracellular signals. They are
           activated by the MAPK kinases MKK3 and MKK6, which in
           turn are activated by upstream MAPK kinase kinases
           including TAK1, ASK1, and MLK3, in response to cellular
           stresses or inflammatory cytokines. Vertebrates contain
           four isoforms of p38, named alpha, beta, gamma, and
           delta. p38gamma, also called MAPK12, is predominantly
           expressed in skeletal muscle. Unlike p38alpha and
           p38beta, p38gamma is insensitive to pyridinylimidazoles.
           It displays an antagonizing function compared to
           p38alpha. p38gamma inhibits, while p38alpha stimulates,
           c-Jun phosphorylation and AP-1 mediated transcription.
           p38gamma also plays a role in the signaling between Ras
           and the estrogen receptor and has been implicated to
           increase cell invasion and breast cancer progression. In
           Xenopus, p38gamma is critical in the meiotic maturation
           of oocytes.
          Length = 343

 Score = 27.2 bits (60), Expect = 0.90
 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 3/26 (11%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRH 68
           +P NL +     DC++K+ DFG++R 
Sbjct: 145 KPGNLAVN---EDCELKILDFGLARQ 167


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
           Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. 
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
           kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The plant MEKK1 subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily is
           composed of plant mitogen-activated protein kinase
           (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
           including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
           is a MAPKKK that phosphorylates and activates MAPK
           kinases (MAPKKs or MKKs or MAP2Ks), which in turn
           phosphorylate and activate MAPKs during signaling
           cascades that are important in mediating cellular
           responses to extracellular signals. Arabidopsis thaliana
           MEKK1 activates MPK4, a MAPK that regulates systemic
           acquired resistance. MEKK1 also participates in the
           regulation of temperature-sensitive and tissue-specific
           cell death.
          Length = 258

 Score = 27.0 bits (60), Expect = 1.1
 Identities = 8/25 (32%), Positives = 14/25 (56%)

Query: 58  VKLCDFGISRHLSRDVDVREILGTP 82
           VKL DFG+++ +      +   G+P
Sbjct: 141 VKLADFGMAKQVVEFSFAKSFKGSP 165


>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Ste20-like kinase (SLK)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SLK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of the subfamily include SLK, STK10
           (also called LOK for lymphocyte-oriented kinase), SmSLK
           (Schistosoma mansoni SLK), and related proteins. SLK
           promotes apoptosis through apoptosis signal-regulating
           kinase 1 (ASK1) and the mitogen-activated protein kinase
           (MAPK) p38. It also plays a role in mediating actin
           reorganization. STK10 is responsible in regulating the
           CD28 responsive element in T cells, as well as leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. SmSLK is capable of activating the MAPK Jun
           N-terminal kinase (JNK) pathway in human embryonic
           kidney (HEK) cells as well as in Xenopus oocytes. It may
           participate in regulating MAPK cascades during
           host-parasite interactions.
          Length = 280

 Score = 27.0 bits (60), Expect = 1.1
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 4/38 (10%)

Query: 46  NLVLTGEYPDCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           N++LT    D DVKL DFG+S      +  R+  +GTP
Sbjct: 133 NILLT---LDGDVKLADFGVSAKNKSTLQKRDTFIGTP 167


>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine
           Kinase, Platelet Derived Growth Factor Receptor beta.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) beta; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. PDGFR
           beta is a receptor tyr kinase (RTK) containing an
           extracellular ligand-binding region with five
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding to
           its ligands, the PDGFs, leads to receptor dimerization,
           trans phosphorylation and activation, and intracellular
           signaling. PDGFR beta forms homodimers or heterodimers
           with PDGFR alpha, depending on the nature of the PDGF
           ligand. PDGF-BB and PDGF-DD induce PDGFR beta
           homodimerization. PDGFR signaling plays many roles in
           normal embryonic development and adult physiology. PDGFR
           beta signaling leads to a variety of cellular effects
           including the stimulation of cell growth and chemotaxis,
           as well as the inhibition of apoptosis and GAP
           junctional communication. It is critical in normal
           angiogenesis as it is involved in the recruitment of
           pericytes and smooth muscle cells essential for vessel
           stability. Aberrant PDGFR beta expression is associated
           with some human cancers. The continuously-active fusion
           proteins of PDGFR beta with COL1A1 and TEL are
           associated with dermatofibrosarcoma protuberans (DFSP)
           and a subset of chronic myelomonocytic leukemia (CMML),
           respectively.
          Length = 401

 Score = 27.3 bits (60), Expect = 1.1
 Identities = 9/15 (60%), Positives = 13/15 (86%)

Query: 58  VKLCDFGISRHLSRD 72
           VK+CDFG++R + RD
Sbjct: 278 VKICDFGLARDIMRD 292


>gnl|CDD|224774 COG1861, SpsF, Spore coat polysaccharide biosynthesis protein F,
           CMP-KDO synthetase homolog [Cell envelope biogenesis,
           outer membrane].
          Length = 241

 Score = 27.0 bits (60), Expect = 1.2
 Identities = 12/34 (35%), Positives = 17/34 (50%)

Query: 49  LTGEYPDCDVKLCDFGISRHLSRDVDVREILGTP 82
           +TG+ P  D +L D  + RHL +  D     G P
Sbjct: 98  VTGDNPFLDPELVDAAVDRHLEKGADYVSNTGAP 131


>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 3.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek3 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Nek3 is primarily
           localized in the cytoplasm and shows no cell
           cycle-dependent changes in its activity. It is present
           in the axons of neurons and affects morphogenesis and
           polarity through its regulation of microtubule
           acetylation. Nek3 modulates the signaling of the
           prolactin receptor through its activation of Vav2 and
           contributes to prolactin-mediated motility of breast
           cancer cells.
          Length = 255

 Score = 26.9 bits (59), Expect = 1.2
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 30  HFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHLSRDVDVR-EILGTPDYV 85
           H      L+R   + +N+ LT    +  VKL DFG +R L+         +GTP YV
Sbjct: 115 HIHEKRVLHRDI-KSKNIFLT---QNGKVKLGDFGSARLLTSPGAYACTYVGTPYYV 167


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mammalian Ste20-like protein
           kinase 1 and 2.  Serine/threonine kinases (STKs),
           mammalian Ste20-like protein kinase 1 (MST1) and MST2
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MST1/2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST1, MST2, and
           related proteins including Drosophila Hippo and
           Dictyostelium discoideum Krs1 (kinase responsive to
           stress 1). MST1/2 and Hippo are involved in a conserved
           pathway that governs cell contact inhibition, organ size
           control, and tumor development. MST1 activates the
           mitogen-activated protein kinases (MAPKs) p38 and c-Jun
           N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
           MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
           kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
           to caspase activation and apoptosis. MST1 has also been
           implicated in cell proliferation and differentiation.
           Krs1 may regulate cell growth arrest and apoptosis in
           response to cellular stress.
          Length = 256

 Score = 26.8 bits (60), Expect = 1.2
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 55  DCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           +   KL DFG+S  L+  +  R  ++GTP
Sbjct: 135 EGQAKLADFGVSGQLTDTMAKRNTVIGTP 163


>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase,
           Nemo-Like Kinase.  Serine/Threonine Kinases (STKs),
           Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The NLK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mitogen-activated protein
           kinases (MAPKs) are important mediators of cellular
           responses to extracellular signals. NLK is an atypical
           MAPK that is not regulated by a MAPK kinase. It
           functions downstream of the MAPK kinase kinase Tak1,
           which also plays a role in activating the JNK and p38
           MAPKs. The Tak1/NLK pathways are regulated by Wnts, a
           family of secreted proteins that is critical in the
           control of asymmetric division and cell polarity. NLK
           can phosphorylate transcription factors from the TCF/LEF
           family, inhibiting their ability to activate the
           transcription of target genes. In prostate cancer cells,
           NLK is involved in regulating androgen receptor-mediated
           transcription and its expression is altered during
           cancer progression.
          Length = 372

 Score = 27.0 bits (60), Expect = 1.2
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 4/35 (11%)

Query: 33  STHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR 67
           S   L+R   +P NL++     +C +K+CDFG++R
Sbjct: 121 SAGILHRDI-KPGNLLVNS---NCVLKICDFGLAR 151


>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
           and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii FA2-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii FA2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes FA2 and CNK4.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii FA2 was discovered
           in a genetic screen for deflagellation-defective
           mutants. It is essential for
           basal-body/centriole-associated microtubule severing,
           and plays a role in cell cycle progression. No cellular
           function has yet been ascribed to CNK4.
          Length = 256

 Score = 26.7 bits (59), Expect = 1.3
 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 57  DVKLCDFGISRHLS-RDVDVREILGTPDYV 85
           +VK+ D G+++ LS        I+GTP Y+
Sbjct: 139 NVKIGDLGVAKLLSDNTNFANTIVGTPYYL 168


>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein
           Serine/Threonine Kinase, Microtubule-associated
           serine/threonine kinase.  Serine/Threonine Kinases
           (STKs), Microtubule-associated serine/threonine (MAST)
           kinase subfamily, MAST, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. MAST kinases contain an
           N-terminal domain of unknown function, a central
           catalytic domain, and a C-terminal PDZ domain that
           mediates protein-protein interactions. There are four
           mammalian MAST kinases, named MAST1-MAST4. MAST1 is also
           referred to as syntrophin-associated STK (SAST), while
           MAST2 is also called MAST205. MAST kinases are
           cytoskeletal associated kinases of unknown function that
           are also expressed at neuromuscular junctions and
           postsynaptic densities. MAST1, MAST2, and MAST3 bind and
           phosphorylate the tumor suppressor PTEN, and may
           contribute to the regulation and stabilization of PTEN.
           MAST2 is involved in the regulation of the Fc-gamma
           receptor of the innate immune response in macrophages,
           and may also be involved in the regulation of the Na+/H+
           exchanger NHE3.
          Length = 305

 Score = 26.7 bits (59), Expect = 1.7
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 21/60 (35%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISR-------------HLSRD----VDVREILGTPDYV 85
           +P NL++T       +KL DFG+S+             H+ +D    +D +++ GTP+Y+
Sbjct: 128 KPDNLLITSM---GHIKLTDFGLSKIGLMSLTTNLYEGHIEKDTREFLD-KQVCGTPEYI 183


>gnl|CDD|214733 smart00584, TLDc, domain in TBC and LysM domain containing
          proteins. 
          Length = 165

 Score = 26.1 bits (58), Expect = 1.9
 Identities = 10/31 (32%), Positives = 13/31 (41%)

Query: 13 PRLVAKVTVTLLGSLNHHFTSTHSLYRSCSQ 43
          P        TLL S + H  S ++LYR    
Sbjct: 17 PTRAEGYPWTLLYSSSQHGYSLNTLYRKVEG 47


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 26.3 bits (59), Expect = 2.0
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 58  VKLCDFGISRHLSRD 72
           VK+ DFG+SR +  D
Sbjct: 141 VKISDFGLSRDIYED 155


>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 1.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
           JNK2, is expressed in every cell and tissue type.
           Initially it was thought that JNK1 and JNK2 were
           functionally redundant as mice deficient in either genes
           (Jnk1 or Jnk2) could survive but disruption of both
           genes resulted in lethality. However, recent studies
           have shown that JNK1 and JNK2 perform distinct functions
           through specific binding partners and substrates. JNK1
           specifically binds with JAMP (JNK1-associated membrane
           protein), which regulates the duration of JNK1 activity
           in response to stimuli. Specific JNK1 substrates include
           Itch and SG10, which are implicated in Th2 responses and
           airway inflammation, and microtubule dynamics and
           axodendritic length, respectively. Mice deficient in
           Jnk1 are protected against arthritis, obesity, type 2
           diabetes, cardiac cell death, and non-alcoholic liver
           disease, suggesting that JNK1 may play roles in the
           pathogenesis of these diseases.
          Length = 364

 Score = 26.5 bits (58), Expect = 2.1
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 4/38 (10%)

Query: 30  HFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR 67
           H  S   ++R   +P N+V+     DC +K+ DFG++R
Sbjct: 141 HLHSAGIIHRDL-KPSNIVVKS---DCTLKILDFGLAR 174


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
           Phosphotransferases. Tyrosine-specific kinase subfamily.
          Length = 257

 Score = 26.3 bits (59), Expect = 2.1
 Identities = 9/15 (60%), Positives = 11/15 (73%)

Query: 58  VKLCDFGISRHLSRD 72
           VK+ DFG+SR L  D
Sbjct: 141 VKISDFGLSRDLYDD 155


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
           Phosphotransferases. The specificity of this class of
           kinases can not be predicted. Possible dual-specificity
           Ser/Thr/Tyr kinase.
          Length = 258

 Score = 26.0 bits (58), Expect = 2.3
 Identities = 10/23 (43%), Positives = 13/23 (56%)

Query: 58  VKLCDFGISRHLSRDVDVREILG 80
           VK+ DFG+SR L  D   +   G
Sbjct: 142 VKISDFGLSRDLYDDDYYKVKGG 164


>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 3.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK3 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is
           expressed primarily in the brain, and to a lesser extent
           in the heart and testis. Mice deficient in Jnk3 are
           protected against kainic acid-induced seizures, stroke,
           sciatic axotomy neural death, and neuronal death due to
           NGF deprivation, oxidative stress, or exposure to
           beta-amyloid peptide. This suggests that JNK3 may play
           roles in the pathogenesis of these diseases.
          Length = 355

 Score = 26.2 bits (57), Expect = 2.4
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 4/38 (10%)

Query: 30  HFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR 67
           H  S   ++R   +P N+V+     DC +K+ DFG++R
Sbjct: 134 HLHSAGIIHRDL-KPSNIVVKS---DCTLKILDFGLAR 167


>gnl|CDD|177179 MTH00118, COX3, cytochrome c oxidase subunit III; Provisional.
          Length = 261

 Score = 26.1 bits (58), Expect = 2.4
 Identities = 7/16 (43%), Positives = 9/16 (56%)

Query: 20  TVTLLGSLNHHFTSTH 35
            V LL  +  HFT+ H
Sbjct: 216 IVCLLRLIKFHFTTNH 231


>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine
           Kinase, c-Jun N-terminal Kinase 2.  Serine/Threonine
           Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           JNK2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. JNKs are mitogen-activated protein kinases
           (MAPKs) that are involved in many stress-activated
           responses including those during inflammation,
           neurodegeneration, apoptosis, and persistent pain
           sensitization, among others. Vetebrates harbor three
           different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like
           JNK2, is expressed in every cell and tissue type.
           Initially it was thought that JNK1 and JNK2 were
           functionally redundant as mice deficient in either genes
           (Jnk1 or Jnk2) could survive but disruption of both
           genes resulted in lethality. However, recent studies
           have shown that JNK1 and JNK2 perform distinct functions
           through specific binding partners and substrates.  JNK2
           is specifically translocated to the mitochondria during
           dopaminergic cell death. Specific substrates include the
           microtubule-associated proteins DCX and Tau, as well as
           TIF-IA which is involved in ribosomal RNA synthesis
           regulation. Mice deficient in Jnk2 show protection
           against arthritis, type 1 diabetes, atherosclerosis,
           abdominal aortic aneurysm, cardiac cell death,
           TNF-induced liver damage, and tumor growth, indicating
           that JNK2 may play roles in the pathogenesis of these
           diseases.
          Length = 359

 Score = 26.1 bits (57), Expect = 2.6
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 4/38 (10%)

Query: 30  HFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR 67
           H  S   ++R   +P N+V+     DC +K+ DFG++R
Sbjct: 138 HLHSAGIIHRDL-KPSNIVVKS---DCTLKILDFGLAR 171


>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like
           dual-specificity MAP kinase kinases.  Protein kinases
           (PKs), MAP kinase kinase (MAPKK) subfamily, fungal
           PBS2-like proteins, catalytic (c) domain. PKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The MAPKK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases, protein tyrosine
           kinases, RIO kinases, aminoglycoside phosphotransferase,
           choline kinase, and phosphoinositide 3-kinase. The
           mitogen-activated protein (MAP) kinase signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAP kinase (MAPK),
           which is phosphorylated and activated by a MAPK kinase
           (MAPKK or MKK), which itself is phosphorylated and
           activated by a MAPK kinase kinase (MAPKKK or MKKK).
           Members of this group include the MAPKKs Polymyxin B
           resistance protein 2 (PBS2) from Saccharomyces
           cerevisiae, Wis1 from Schizosaccharomyces pombe, and
           related proteins. PBS2 and Wis1 are components of
           stress-activated MAPK cascades in budding and fission
           yeast, respectively. PBS2 is the specific activator of
           the MAPK Hog1, which plays a central role in the
           response of budding yeast to stress including exposure
           to arsenite and hyperosmotic environments. Wis1
           phosphorylates and activates the MAPK Sty1 (also called
           Spc1 or Phh1), which stimulates a transcriptional
           response to a wide range of cellular insults through the
           bZip transcription factors Atf1, Pcr1, and Pap1.
          Length = 286

 Score = 26.0 bits (57), Expect = 2.6
 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 3/27 (11%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRHL 69
           +P N+++ G      VKLCDFG+S +L
Sbjct: 130 KPTNVLVNGN---GQVKLCDFGVSGNL 153


>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein
           Serine/Threonine Kinase, STK10 or Lymphocyte-oriented
           kinase.  Serine/threonine kinases (STKs), STK10
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           STK10 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Other names for STK10 include
           lymphocyte-oriented kinase (LOK) and Xenopus polo-like
           kinase kinase 1 (xPlkk1). STK10 is highly expressed in
           lymphocytes and is responsible in regulating leukocyte
           function associated antigen (LFA-1)-mediated lymphocyte
           adhesion. It plays a role in regulating the CD28
           responsive element in T cells, and may also function as
           a regulator of polo-like kinase 1 (Plk1), a protein
           which is overexpressed in multiple tumor types.
          Length = 292

 Score = 25.8 bits (56), Expect = 2.8
 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 46  NLVLTGEYPDCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           N++LT    D D+KL DFG+S    + +  R+  +GTP
Sbjct: 140 NVLLT---LDGDIKLADFGVSAKNVKTLQRRDSFIGTP 174


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
           Protein Tyrosine Kinase (PTK) family, catalytic domain.
           This PTKc family is part of a larger superfamily that
           includes the catalytic domains of protein
           serine/threonine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. They can be classified
           into receptor and non-receptor tyr kinases. PTKs play
           important roles in many cellular processes including,
           lymphocyte activation, epithelium growth and
           maintenance, metabolism control, organogenesis
           regulation, survival, proliferation, differentiation,
           migration, adhesion, motility, and morphogenesis.
           Receptor tyr kinases (RTKs) are integral membrane
           proteins which contain an extracellular ligand-binding
           region, a transmembrane segment, and an intracellular
           tyr kinase domain. RTKs are usually activated through
           ligand binding, which causes dimerization and
           autophosphorylation of the intracellular tyr kinase
           catalytic domain, leading to intracellular signaling.
           Some RTKs are orphan receptors with no known ligands.
           Non-receptor (or cytoplasmic) tyr kinases are
           distributed in different intracellular compartments and
           are usually multi-domain proteins containing a catalytic
           tyr kinase domain as well as various regulatory domains
           such as SH3 and SH2. PTKs are usually autoinhibited and
           require a mechanism for activation. In many PTKs, the
           phosphorylation of tyr residues in the activation loop
           is essential for optimal activity. Aberrant expression
           of PTKs is associated with many development
           abnormalities and cancers.
          Length = 262

 Score = 26.0 bits (58), Expect = 2.8
 Identities = 9/20 (45%), Positives = 13/20 (65%)

Query: 58  VKLCDFGISRHLSRDVDVRE 77
           VK+ DFG+SR +  D   R+
Sbjct: 144 VKISDFGLSRDVYDDDYYRK 163


>gnl|CDD|177161 MTH00099, COX3, cytochrome c oxidase subunit III; Validated.
          Length = 261

 Score = 25.8 bits (57), Expect = 3.0
 Identities = 8/17 (47%), Positives = 9/17 (52%)

Query: 19  VTVTLLGSLNHHFTSTH 35
           + V  L  L  HFTS H
Sbjct: 215 LIVCFLRQLKFHFTSNH 231


>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase Like 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase like 2 (CDKL2) and CDKL3 subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDKL2 and CDKL3
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKL2, also called
           p56 KKIAMRE, is expressed in testis, kidney, lung, and
           brain. It functions mainly in mature neurons and plays
           an important role in learning and memory. Inactivation
           of CDKL3, also called NKIAMRE (NKIATRE in rat), by
           translocation is associated with mild mental
           retardation. It has been reported that CDKL3 is lost in
           leukemic cells having a chromosome arm 5q deletion, and
           may contribute to the transformed phenotype.
          Length = 286

 Score = 25.8 bits (57), Expect = 3.2
 Identities = 9/13 (69%), Positives = 11/13 (84%)

Query: 58  VKLCDFGISRHLS 70
           VKLCDFG +R L+
Sbjct: 139 VKLCDFGFARTLA 151


>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-activated protein
           kinase kinase kinase kinase 5.  Serine/threonine kinases
           (STKs), mitogen-activated protein kinase (MAPK) kinase
           kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAP4K5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily contain an N-terminal catalytic domain and a
           C-terminal citron homology (CNH) regulatory domain,
           similar to MAP4K4/6. MAP4Ks are involved in some MAPK
           signaling pathways that are important in mediating
           cellular responses to extracellular signals by
           activating a MAPK kinase kinase (MAPKKK or MAP3K or
           MKKK). Each MAPK cascade is activated either by a small
           GTP-binding protein or by an adaptor protein, which
           transmits the signal either directly to a MAP3K to start
           the triple kinase core cascade or indirectly through a
           mediator kinase, a MAP4K. MAP4K5, also called germinal
           center kinase-related enzyme (GCKR), has been shown to
           activate the MAPK c-Jun N-terminal kinase (JNK). MAP4K5
           also facilitates Wnt signaling in B cells, and may
           therefore be implicated in the control of cell fate,
           proliferation, and polarity.
          Length = 267

 Score = 25.8 bits (56), Expect = 3.6
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 4/38 (10%)

Query: 46  NLVLTGEYPDCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           N++LT    + DVKL DFG++  ++  +  R+  +GTP
Sbjct: 136 NILLTD---NGDVKLADFGVAAKITATIAKRKSFIGTP 170


>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 4.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 4, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK4 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK4 regulates cell morphology and
           cytoskeletal organization. It is essential for embryonic
           viability and proper neural development. Mice lacking
           PAK4 die due to defects in the fetal heart. In addition,
           their spinal cord motor neurons showed failure to
           differentiate and migrate. PAK4 also plays a role in
           cell survival and tumorigenesis. It is overexpressed in
           many primary tumors including colon, esophageal, and
           mammary tumors. PAK4 has also been implicated in viral
           and bacterial infection pathways.
          Length = 292

 Score = 25.8 bits (56), Expect = 3.7
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 55  DCDVKLCDFGISRHLSRDVDVRE-ILGTP 82
           D  VKL DFG    +S++V  R+ ++GTP
Sbjct: 152 DGRVKLSDFGFCAQVSKEVPRRKSLVGTP 180


>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein
           Serine/Threonine Kinase, p21-activated kinase 5.
           Serine/threonine kinases (STKs), p21-activated kinase
           (PAK) 5, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PAK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PAKs are Rho family GTPase-regulated kinases
           that serve as important mediators in the function of
           Cdc42 (cell division cycle 42) and Rac. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           PAK5 belongs to group II. Group II PAKs contain a PBD
           (p21-binding domain) and a C-terminal catalytic domain,
           but do not harbor an AID (autoinhibitory domain) or SH3
           binding sites. PAK5 is mainly expressed in the brain. It
           is not required for viability, but together with PAK6,
           it is required for normal levels of locomotion and
           activity, and for learning and memory. PAK5 cooperates
           with Inca (induced in neural crest by AP2) in the
           regulation of cell adhesion and cytoskeletal
           organization in the embryo and in neural crest cells
           during craniofacial development. PAK5 may also play a
           role in controlling the signaling of Raf-1, an effector
           of Ras, at the mitochondria.
          Length = 292

 Score = 25.8 bits (56), Expect = 3.8
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 16  VAKVTVTLLGSLNHHFTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISRHLSRDVDV 75
           +A V +++L +L+  +     +     +  +++LT    D  +KL DFG    +S++V  
Sbjct: 120 IATVCLSVLRALS--YLHNQGVIHRDIKSDSILLTS---DGRIKLSDFGFCAQVSKEVPK 174

Query: 76  REIL-GTP 82
           R+ L GTP
Sbjct: 175 RKSLVGTP 182


>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
           Kinase,  Extracellular signal-Regulated Kinase 5.
           Serine/Threonine Kinases (STKs), Extracellular
           signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ERK5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. ERK5, also called Big MAPK1
           (BMK1) or MAPK7, has a unique C-terminal extension,
           making it approximately twice as big as other MAPKs.
           This extension contains transcriptional activation
           capability which is inhibited by the N-terminal half.
           ERK5 is activated in response to growth factors and
           stress by a cascade that leads to its phosphorylation by
           the MAP2K MEK5, which in turn is regulated by the MAP3Ks
           MEKK2 and MEKK3. Activated ERK5 phosphorylates its
           targets including myocyte enhancer factor 2 (MEF2),
           Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
           cell proliferation during the G1/S phase transition.
           Studies on knockout mice revealed that ERK5 is essential
           for cardiovascular development and plays an important
           role in angiogenesis. It is also critical for neural
           differentiation and survival. The ERK5 pathway has been
           implicated in the pathogenesis of many diseases
           including cancer, cardiac hypertrophy, and
           atherosclerosis.
          Length = 334

 Score = 25.4 bits (56), Expect = 3.8
 Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 3/28 (10%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRHLS 70
           +P NL++     DC++++ DFG++R LS
Sbjct: 134 KPSNLLVNE---DCELRIGDFGMARGLS 158


>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like
           Protein Serine/Threonine Kinases.  Serine/threonine
           kinases (STKs), Nak1 subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The Nak1 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae
           Kic1p (kinase that interacts with Cdc31p) and related
           proteins. Nak1 (also known as N-rich kinase 1), is
           required by fission yeast for polarizing the tips of
           actin cytoskeleton and is involved in cell growth, cell
           separation, cell morphology and cell-cycle progression.
           Kic1p is required by budding yeast for cell integrity
           and morphogenesis. Kic1p interacts with Cdc31p, the
           yeast homologue of centrin, and phosphorylates
           substrates in a Cdc31p-dependent manner.
          Length = 277

 Score = 25.5 bits (56), Expect = 3.8
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 46  NLVLTGEYPDCDVKLCDFGISRHLSRDVDVREIL-GTP 82
           N+++T      +VKLCDFG++  L+++   R    GTP
Sbjct: 131 NILVTNTG---NVKLCDFGVAALLNQNSSKRSTFVGTP 165


>gnl|CDD|233898 TIGR02500, type_III_yscD, type III secretion apparatus protein,
          YscD/HrpQ family.  This family represents a conserved
          protein of bacterial type III secretion systems. Gene
          symbols are variable from species to species. Members
          are designated YscD in Yersinia, HrpQ in Pseudomonas
          syringae, and EscD in enteropathogenic Escherichia
          coli. In the Chlamydiae, this model describes the
          C-terminal 400 residues of a longer protein [Protein
          fate, Protein and peptide secretion and trafficking,
          Cellular processes, Pathogenesis].
          Length = 410

 Score = 25.5 bits (56), Expect = 4.0
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 43 QPQNLVLTGEYPDCDVKLCDFGISR-HLSRDVD 74
             NLVL  +  DCD+ L D GI+  H+S  V 
Sbjct: 18 PEGNLVLGTDAADCDIVLSDGGIAAVHVSLHVR 50


>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), PCTAIRE-like subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The PCTAIRE-like subfamily is part of a
           larger superfamily that includes the catalytic domains
           of other protein STKs, protein tyrosine kinases, RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. Members of this
           subfamily share sequence similarity with
           Cyclin-Dependent Kinases (CDKs), which belong to a large
           family of STKs that are regulated by their cognate
           cyclins. Together, CDKs and cyclins are involved in the
           control of cell-cycle progression, transcription, and
           neuronal function. The association of PCTAIRE-like
           proteins with cyclins has not been widely studied,
           although PFTAIRE-1 has been shown to function as a CDK
           which is regulated by cyclin D3 as well as the
           membrane-associated cyclin Y. PCTAIRE-like proteins show
           unusual expression patterns with high levels in
           post-mitotic tissues, suggesting that they may be
           involved in regulating post-mitotic cellular events.
          Length = 291

 Score = 25.4 bits (56), Expect = 4.4
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 7/27 (25%)

Query: 43  QPQNLVLT--GEYPDCDVKLCDFGISR 67
           +PQNL+++  GE     +KL DFG++R
Sbjct: 130 KPQNLLISERGE-----LKLADFGLAR 151


>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 5.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek5 subfamily is
           one of a family of 11 different Neks (Nek1-11). The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Neks are involved in the regulation of
           downstream processes following the activation of Cdc2,
           and many of their functions are cell cycle-related. They
           play critical roles in microtubule dynamics during
           ciliogenesis and mitosis. The specific function of Nek5
           is unknown.
          Length = 257

 Score = 25.3 bits (55), Expect = 4.4
 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 59  KLCDFGISRHLSRDVDV-REILGTPDYV 85
           KL DFGI+R L+  +++    +GTP Y+
Sbjct: 142 KLGDFGIARQLNDSMELAYTCVGTPYYL 169


>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine
           Kinase, PFTAIRE-2 kinase.  Serine/Threonine Kinases
           (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The PFTAIRE-2 subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. PFTAIRE-2 shares sequence
           similarity with Cyclin-Dependent Kinases (CDKs), which
           belong to a large family of STKs that are regulated by
           their cognate cyclins. Together, CDKs and cyclins are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. PFTAIRE-2 is also
           referred to as ALS2CR7 (amyotrophic lateral sclerosis 2
           (juvenile) chromosome region candidate 7). It may be
           associated with amyotrophic lateral sclerosis 2 (ALS2),
           an autosomal recessive form of juvenile ALS. The
           function of PFTAIRE-2 is not yet known.
          Length = 291

 Score = 25.3 bits (55), Expect = 4.6
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 8/38 (21%)

Query: 35  HSLYRSCSQPQNLVLT--GEYPDCDVKLCDFGISRHLS 70
           H L+R   +PQNL+++  GE     +KL DFG++R  S
Sbjct: 123 HILHRDL-KPQNLLISYLGE-----LKLADFGLARAKS 154


>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
           Dbf2p-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), ROCK- and NDR-like
           subfamily, fungal Sid2p- and Dbf2p-like proteins,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sid2p- and
           Dbf2p-like group is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This group contains fungal kinases including
           Schizosaccharomyces pombe Sid2p and Saccharomyces
           cerevisiae Dbf2p. Group members show similarity to NDR
           kinases in that they contain an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Sid2p plays a
           crucial role in the septum initiation network (SIN) and
           in the initiation of cytokinesis. Dbf2p is important in
           regulating the mitotic exit network (MEN) and in
           cytokinesis.
          Length = 333

 Score = 25.1 bits (55), Expect = 5.1
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 15/59 (25%)

Query: 33  STHSL---YRSCSQPQNLVL--TGEYPDCDVKLCDFGISRH-LSRDVDVREILGTPDYV 85
           + H L   +R   +P+N ++  +G      +KL DFG+S+  ++       ++G+PDY+
Sbjct: 116 ALHELGYIHRDL-KPENFLIDASGH-----IKLTDFGLSKGIVTY---ANSVVGSPDYM 165


>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 4 and 6-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 4 (CDK4) and CDK6-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK4/6-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDK4 and CDK6
           partner with D-type cyclins to regulate the early G1
           phase of the cell cycle. They are the first kinase
           activated by mitogenic signals to release cells from the
           G0 arrested state. CDK4 and CDK6 are both expressed
           ubiquitously, associate with all three D cyclins (D1, D2
           and D3), and phosphorylate the retinoblastoma (pRb)
           protein. They are also regulated by the INK4 family of
           inhibitors which associate with either the CDK alone or
           the CDK/cyclin complex. CDK4 and CDK6 show differences
           in subcellular localization, sensitivity to some
           inhibitors, timing in activation, tumor selectivity, and
           possibly substrate profiles. Although CDK4 and CDK6 seem
           to show some redundancy, they also have discrete,
           nonoverlapping functions. CDK6 plays an important role
           in cell differentiation.
          Length = 287

 Score = 25.3 bits (56), Expect = 5.2
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 3/30 (10%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRDV 73
           PQN+++T    D  VK+ DFG++R  S ++
Sbjct: 135 PQNILVTS---DGQVKIADFGLARIYSFEM 161


>gnl|CDD|214354 CHL00074, rps14, ribosomal protein S14.
          Length = 100

 Score = 24.4 bits (54), Expect = 6.1
 Identities = 7/11 (63%), Positives = 10/11 (90%)

Query: 62 DFGISRHLSRD 72
          DFG+SRH+ R+
Sbjct: 75 DFGLSRHVLRE 85


>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine
           Kinase, Activated Cdc42-associated kinase.  Protein
           Tyrosine Kinase (PTK) family; Activated Cdc42-associated
           kinase (Ack) subfamily; catalytic (c) domain. Ack
           subfamily members include Ack1, thirty-eight-negative
           kinase 1 (Tnk1), and similar proteins. The PTKc family
           is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Ack
           subfamily members are cytoplasmic (or nonreceptor) tyr
           kinases containing an N-terminal catalytic domain, an
           SH3 domain, a Cdc42-binding CRIB domain, and a
           proline-rich region. They are mainly expressed in brain
           and skeletal tissues and are involved in the regulation
           of cell adhesion and growth, receptor degradation, and
           axonal guidance. Ack1 is also associated with
           androgen-independent  prostate cancer progression. Tnk1
           regulates TNFalpha signaling and may play an important
           role in cell death.
          Length = 257

 Score = 24.6 bits (54), Expect = 6.8
 Identities = 7/12 (58%), Positives = 9/12 (75%)

Query: 58  VKLCDFGISRHL 69
           VK+ DFG+ R L
Sbjct: 136 VKIGDFGLMRAL 147


>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine
           Kinases, Cyclin-Dependent protein Kinase 2 and 3.
           Serine/Threonine Kinases (STKs), Cyclin-dependent
           protein kinase 2 (CDK2) and CDK3 subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK2/3 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. CDKs belong to a
           large family of STKs that are regulated by their cognate
           cyclins. Together, they are involved in the control of
           cell-cycle progression, transcription, and neuronal
           function. CDK2 is regulated by cyclin E or cyclin A.
           Upon activation by cyclin E, it phosphorylates the
           retinoblastoma (pRb) protein which activates E2F
           mediated transcription and allows cells to move into S
           phase. The CDK2/cyclin A complex plays a role in
           regulating DNA replication. CDK2, together with CDK4,
           also regulates embryonic cell proliferation. Despite
           these important roles, mice deleted for the cdk2 gene
           are viable and normal except for being sterile. This may
           be due to compensation provided by CDK1 (also called
           Cdc2), which can also bind cyclin E and drive the G1 to
           S phase transition. CDK3 is regulated by cyclin C and it
           phosphorylates pRB specifically during the G0/G1
           transition. This phosphorylation is required for cells
           to exit G0 efficiently and enter the G1 phase.
          Length = 284

 Score = 24.8 bits (54), Expect = 6.9
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 31  FTSTHSLYRSCSQPQNLVLTGEYPDCDVKLCDFGISR 67
           F  +H +     +PQNL++     +  +KL DFG++R
Sbjct: 115 FCHSHRVLHRDLKPQNLLINT---EGAIKLADFGLAR 148


>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine
           Kinase, Platelet Derived Growth Factor Receptor alpha.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) alpha; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. PDGFR
           alpha is a receptor tyr kinase (RTK) containing an
           extracellular ligand-binding region with five
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding to
           its ligands, the PDGFs, leads to receptor dimerization,
           trans phosphorylation and activation, and intracellular
           signaling. PDGFR alpha forms homodimers or heterodimers
           with PDGFR beta, depending on the nature of the PDGF
           ligand. PDGF-AA, PDGF-AB, and PDGF-CC induce PDGFR alpha
           homodimerization. PDGFR signaling plays many roles in
           normal embryonic development and adult physiology. PDGFR
           alpha signaling is important in the formation of lung
           alveoli, intestinal villi, mesenchymal dermis, and hair
           follicles, as well as in the development of
           oligodendrocytes, retinal astrocytes, neural crest
           cells, and testicular cells. Aberrant PDGFR alpha
           expression is associated with some human cancers.
           Mutations in PDGFR alpha have been found within a subset
           of gastrointestinal stromal tumors (GISTs). An active
           fusion protein FIP1L1-PDGFR alpha, derived from
           interstitial deletion, is associated with idiopathic
           hypereosinophilic syndrome (HES) and chronic
           eosinophilic leukemia (CEL).
          Length = 400

 Score = 25.0 bits (54), Expect = 7.0
 Identities = 8/15 (53%), Positives = 12/15 (80%)

Query: 58  VKLCDFGISRHLSRD 72
           VK+CDFG++R +  D
Sbjct: 276 VKICDFGLARDIMHD 290


>gnl|CDD|176118 cd08427, PBP2_LTTR_like_2, The C-terminal substrate binding
          domain of an uncharacterized LysR-type transcriptional
          regulator, contains the type 2 periplasmic binding
          fold.  LysR-transcriptional regulators comprise the
          largest family of prokaryotic transcription factor.
          Homologs of some of LTTRs with similar domain
          organizations are also found in the archaea and
          eukaryotic organisms. The LTTRs are composed of two
          functional domains joined by a linker helix involved in
          oligomerization: an N-terminal HTH (helix-turn-helix)
          domain, which is responsible for the DNA-binding
          specificity, and a C-terminal substrate-binding domain,
          which is structurally homologous to the type 2
          periplasmic binding proteins. As also observed in the
          periplasmic binding proteins, the C-terminal domain of
          the bacterial transcriptional repressor undergoes a
          conformational change upon substrate binding which in
          turn changes the DNA binding affinity of the repressor.
           The genes controlled by the LTTRs have diverse
          functional roles including amino acid biosynthesis, CO2
          fixation, antibiotic resistance, degradation of
          aromatic compounds, nodule formation of nitrogen-fixing
          bacteria, and synthesis of virulence factors, to a name
          a few.  This substrate-binding domain shows significant
          homology to the type 2 periplasmic binding proteins
          (PBP2), which are responsible for the uptake of a
          variety of substrates such as phosphate, sulfate,
          polysaccharides, lysine/arginine/ornithine, and
          histidine. The PBP2 bind their ligand in the cleft
          between these domains in a manner resembling a Venus
          flytrap. After binding their specific ligand with high
          affinity, they can interact with a cognate membrane
          transport complex comprised of two integral membrane
          domains and two cytoplasmically located ATPase domains.
          This interaction triggers the ligand translocation
          across the cytoplasmic membrane energized by ATP
          hydrolysis.
          Length = 195

 Score = 24.5 bits (54), Expect = 7.1
 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 49 LTGEYPDCDVKLCDFGISRHLSRDVDVREI 78
          L   +PD +V +   G+S  L   VD  E+
Sbjct: 22 LRRRHPDLEVHIVP-GLSAELLARVDAGEL 50


>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 11.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 11 (Nek11)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           Nek11 subfamily is one of a family of 11 different Neks
           (Nek1-11) that are involved in cell cycle control. The
           Nek family is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Nek11 is involved, through direct
           phosphorylation, in regulating the degradation of Cdc25A
           (Cell Division Cycle 25 homolog A), which plays a role
           in cell cycle progression and in activating cyclin
           dependent kinases. Nek11 is activated by CHK1
           (CHeckpoint Kinase 1) and may be involved in the G2/M
           checkpoint. Nek11 may also play a role in the S-phase
           checkpoint as well as in DNA replication and genotoxic
           stress responses.
          Length = 260

 Score = 24.5 bits (53), Expect = 7.5
 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%)

Query: 58  VKLCDFGISRHLSRDVDVREIL-GTPDYV 85
           +K+ DFG+SR L    D+     GTP Y+
Sbjct: 144 LKIGDFGVSRLLMGSCDLATTFTGTPYYM 172


>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase
           3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           MEKK3, MEKK2, and related proteins, all containing an
           N-terminal PB1 domain, which mediates oligomerization,
           and a C-terminal catalytic domain. MEKK2 and MEKK3 are
           mitogen-activated protein kinase (MAPK) kinase kinases
           (MAPKKKs or MKKKs or MAP3Ks), proteins that
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           MEKK2 and MEKK3 activate MEK5 (also called MKK5), which
           activates extracellular signal-regulated kinase 5
           (ERK5). The ERK5 cascade plays roles in promoting cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. MEKK3 plays an essential role in
           embryonic angiogenesis and early heart development.
           MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
           N-terminal kinase (JNK) and p38, through their
           respective MAPKKs.
          Length = 263

 Score = 24.8 bits (54), Expect = 7.7
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 4/33 (12%)

Query: 57  DVKLCDFGISRHL----SRDVDVREILGTPDYV 85
           +VKL DFG S+ L    S    ++ + GTP ++
Sbjct: 142 NVKLGDFGASKRLQTICSSGTGMKSVTGTPYWM 174


>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
           Kinase, Cyclin-Dependent protein Kinase 7.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 7 (CDK7) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The CDK7 subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. CDKs belong to a large family
           of STKs that are regulated by their cognate cyclins.
           Together, they are involved in the control of cell-cycle
           progression, transcription, and neuronal function. CDK7
           plays essential roles in the cell cycle and in
           transcription. It associates with cyclin H and MAT1 and
           acts as a CDK-Activating Kinase (CAK) by phosphorylating
           and activating cell cycle CDKs (CDK1/2/4/6). In the
           brain, it activates CDK5. CDK7 is also a component of
           the general transcription factor TFIIH, which
           phosphorylates the C-terminal domain (CTD) of RNA
           polymerase II when it is bound with unphosphorylated
           DNA, as present in the pre-initiation complex. Following
           phosphorylation, the CTD dissociates from the DNA which
           allows transcription initiation.
          Length = 298

 Score = 24.5 bits (54), Expect = 7.7
 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 3/24 (12%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISR 67
           P NL++     D  +KL DFG++R
Sbjct: 130 PNNLLIA---SDGVLKLADFGLAR 150


>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase;
           Provisional.
          Length = 353

 Score = 24.8 bits (54), Expect = 8.3
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 3/32 (9%)

Query: 43  QPQNLVLTGEYPDCDVKLCDFGISRHLSRDVD 74
           +P NL++       +VK+ DFG+SR L++ +D
Sbjct: 195 KPSNLLINSAK---NVKIADFGVSRILAQTMD 223


>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine
           Kinases, Platelet Derived Growth Factor Receptors.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) subfamily; catalytic (c)
           domain. The PDGFR subfamily consists of PDGFR alpha,
           PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           PDGFR subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           five immunoglobulin-like domains, a transmembrane
           segment, and an intracellular catalytic domain. PDGFR
           kinase domains are autoinhibited by their juxtamembrane
           regions containing tyr residues. The binding to their
           ligands leads to receptor dimerization, trans
           phosphorylation and activation, and intracellular
           signaling. PDGFR subfamily receptors are important in
           the development of a variety of cells. PDGFRs are
           expressed in a many cells including fibroblasts,
           neurons, endometrial cells, mammary epithelial cells,
           and vascular smooth muscle cells. PDGFR signaling is
           critical in normal embryonic development, angiogenesis,
           and wound healing. PDGFRs transduce mitogenic signals
           for connective tissue cells and are important for cell
           shape and motility. Kit is important in the development
           of melanocytes, germ cells, mast cells, hematopoietic
           stem cells, the interstitial cells of Cajal, and the
           pacemaker cells of the GI tract. CSF-1R signaling is
           critical in the regulation of macrophages and
           osteoclasts. Mammalian FLT3 plays an important role in
           the survival, proliferation, and differentiation of stem
           cells.
          Length = 302

 Score = 24.8 bits (54), Expect = 8.4
 Identities = 8/15 (53%), Positives = 12/15 (80%)

Query: 58  VKLCDFGISRHLSRD 72
           VK+CDFG++R +  D
Sbjct: 180 VKICDFGLARDIMND 194


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 24.5 bits (54), Expect = 8.9
 Identities = 8/29 (27%), Positives = 17/29 (58%), Gaps = 3/29 (10%)

Query: 44  PQNLVLTGEYPDCDVKLCDFGISRHLSRD 72
           P+N++L  +     +K+ DFG ++ L  +
Sbjct: 130 PENILLDKDM---HIKITDFGTAKVLDPN 155


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.324    0.140    0.423 

Gapped
Lambda     K      H
   0.267   0.0724    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,367,678
Number of extensions: 327124
Number of successful extensions: 535
Number of sequences better than 10.0: 1
Number of HSP's gapped: 533
Number of HSP's successfully gapped: 119
Length of query: 87
Length of database: 10,937,602
Length adjustment: 55
Effective length of query: 32
Effective length of database: 8,498,132
Effective search space: 271940224
Effective search space used: 271940224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 53 (24.2 bits)