Query         psy8034
Match_columns 73
No_of_seqs    44 out of 46
Neff          3.6 
Searched_HMMs 46136
Date          Fri Aug 16 16:44:39 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8034.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8034hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12062 HSNSD:  heparan sulfat 100.0 8.8E-39 1.9E-43  254.7   5.1   71    3-73    373-443 (487)
  2 KOG3703|consensus              100.0 2.1E-38 4.6E-43  260.5   4.1   70    4-73    393-462 (873)
  3 PF13773 DUF4170:  Domain of un  37.5      27 0.00059   22.2   1.8   26   34-59     27-52  (69)
  4 COG4209 LplB ABC-type polysacc  31.1      32  0.0007   27.3   1.7   22   41-68    196-225 (309)
  5 PF13137 DUF3983:  Protein of u  30.0      44 0.00096   18.7   1.6   11   43-53     19-29  (34)
  6 COG3708 Uncharacterized protei  27.8      44 0.00095   23.3   1.7   25   27-55     94-118 (157)
  7 COG0145 HyuA N-methylhydantoin  26.2      46 0.00099   28.4   1.8   48   15-62    142-191 (674)
  8 PF09225 Endonuc-PvuII:  Restri  26.0       9 0.00019   27.6  -2.0   32   17-54     99-130 (155)
  9 COG0108 RibB 3,4-dihydroxy-2-b  25.7      22 0.00048   26.5  -0.1   16   13-28    176-191 (203)
 10 PF06445 GyrI-like:  GyrI-like   25.2      49  0.0011   19.9   1.4   23   28-54     94-116 (155)
 11 cd03521 Link_domain_KIAA0527_l  23.6      53  0.0012   22.1   1.4   10   42-51     33-42  (95)
 12 PHA00456 hypothetical protein   22.3      57  0.0012   18.2   1.2   11   42-52     22-32  (34)
 13 PF05840 Phage_GPA:  Bacterioph  21.4 1.1E+02  0.0023   24.5   2.9   32    6-38    210-248 (371)
 14 PF02061 Lambda_CIII:  Lambda P  20.7      68  0.0015   18.9   1.3   12   44-55     27-38  (45)

No 1  
>PF12062 HSNSD:  heparan sulfate-N-deacetylase;  InterPro: IPR021930  This family of proteins is are heparan sulphate N-deacetylase enzymes. This protein is found in eukaryotes. This enzyme is often found associated with PF00685 from PFAM. ; GO: 0015016 [heparan sulfate]-glucosamine N-sulfotransferase activity, 0016787 hydrolase activity
Probab=100.00  E-value=8.8e-39  Score=254.66  Aligned_cols=71  Identities=59%  Similarity=0.986  Sum_probs=69.2

Q ss_pred             CccchhhHHHHHHHHHHhcCCCCCCCceeeccccceecccHHHHHHHHHHhccccccceecCCCCccccCC
Q psy8034           3 PVSGQPAREDLVAQQVLRSAAPVDSGYSIAPHHSGVYPVHEPLYTAWKHIWRVKVTSTEEYPHLRPARLRR   73 (73)
Q Consensus         3 ~~~~l~~~M~lNk~FA~~h~ip~~~~yaVaphhsGvYpvh~~ly~aWk~vw~i~vTsteeyPhlrpa~~rr   73 (73)
                      -.|.|+++|+|||+||++|+||++++||||||||||||||+|||+|||+||||+||||||||||||||+||
T Consensus       373 n~s~L~~~m~lNk~Fa~~~~ip~~~~yaVaphhsgvypvh~~ly~awk~vw~i~vTstEeYphl~pa~~rr  443 (487)
T PF12062_consen  373 NQSVLAEQMILNKQFAKEHGIPTDMGYAVAPHHSGVYPVHEQLYEAWKKVWNIKVTSTEEYPHLRPARYRR  443 (487)
T ss_pred             cHHHHHHHHHHHHHhhhhccCCCCCcceEecccCceechhHHHHHHHHHHHccccccceeccccccchhhc
Confidence            36899999999999999999999999999999999999999999999999999999999999999999987


No 2  
>KOG3703|consensus
Probab=100.00  E-value=2.1e-38  Score=260.53  Aligned_cols=70  Identities=60%  Similarity=1.044  Sum_probs=68.5

Q ss_pred             ccchhhHHHHHHHHHHhcCCCCCCCceeeccccceecccHHHHHHHHHHhccccccceecCCCCccccCC
Q psy8034           4 VSGQPAREDLVAQQVLRSAAPVDSGYSIAPHHSGVYPVHEPLYTAWKHIWRVKVTSTEEYPHLRPARLRR   73 (73)
Q Consensus         4 ~~~l~~~M~lNk~FA~~h~ip~~~~yaVaphhsGvYpvh~~ly~aWk~vw~i~vTsteeyPhlrpa~~rr   73 (73)
                      .|.|++||.|||+||.+||||+|+|||||||||||||||+|||+|||+||||+||||||||||||||.||
T Consensus       393 ~s~L~~qM~lNk~FA~ehgiPtd~gYavaPhHsGVyPvH~qLy~AWkkVWni~VTsTEEYPHlkPAr~Rr  462 (873)
T KOG3703|consen  393 ESVLAAQMALNKKFALEHGIPTDMGYAVAPHHSGVYPVHEQLYEAWKKVWNIKVTSTEEYPHLKPARYRR  462 (873)
T ss_pred             HHHHHHHHHHhHHHHHhcCCCcCcccccccccCCcchHHHHHHHHHHHHcCeEeeecccCCccChhhhhc
Confidence            4789999999999999999999999999999999999999999999999999999999999999999997


No 3  
>PF13773 DUF4170:  Domain of unknown function (DUF4170)
Probab=37.50  E-value=27  Score=22.22  Aligned_cols=26  Identities=23%  Similarity=0.498  Sum_probs=21.7

Q ss_pred             cccceecccHHHHHHHHHHhcccccc
Q psy8034          34 HHSGVYPVHEPLYTAWKHIWRVKVTS   59 (73)
Q Consensus        34 hhsGvYpvh~~ly~aWk~vw~i~vTs   59 (73)
                      +--|+||-++.-+.|||..=+.+|-+
T Consensus        27 diVG~fp~y~~A~~aWrakAq~TVDn   52 (69)
T PF13773_consen   27 DIVGIFPDYASAYAAWRAKAQRTVDN   52 (69)
T ss_pred             eEEecCCChHHHHHHHHHHHhCchhc
Confidence            45699999999999999887766644


No 4  
>COG4209 LplB ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism]
Probab=31.07  E-value=32  Score=27.27  Aligned_cols=22  Identities=41%  Similarity=1.207  Sum_probs=16.9

Q ss_pred             ccHHHHHH--------HHHHhccccccceecCCCCc
Q psy8034          41 VHEPLYTA--------WKHIWRVKVTSTEEYPHLRP   68 (73)
Q Consensus        41 vh~~ly~a--------Wk~vw~i~vTsteeyPhlrp   68 (73)
                      |..++|||        |+.+|+|++      |.++|
T Consensus       196 Idpt~YEAA~vDGA~rwqqiwhITl------P~i~P  225 (309)
T COG4209         196 IDPTLYEAAMVDGASRWQQIWHITL------PAIRP  225 (309)
T ss_pred             CCHHHHHHHHcccHHHHHHHHhcch------hhhhh
Confidence            56778886        999999865      66665


No 5  
>PF13137 DUF3983:  Protein of unknown function (DUF3983)
Probab=30.02  E-value=44  Score=18.71  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHh
Q psy8034          43 EPLYTAWKHIW   53 (73)
Q Consensus        43 ~~ly~aWk~vw   53 (73)
                      +++..||+++.
T Consensus        19 ~rv~kAWRNiF   29 (34)
T PF13137_consen   19 YRVDKAWRNIF   29 (34)
T ss_pred             HHHHHHHHHHH
Confidence            57889999875


No 6  
>COG3708 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.76  E-value=44  Score=23.28  Aligned_cols=25  Identities=36%  Similarity=1.006  Sum_probs=18.0

Q ss_pred             CCceeeccccceecccHHHHHHHHHHhcc
Q psy8034          27 SGYSIAPHHSGVYPVHEPLYTAWKHIWRV   55 (73)
Q Consensus        27 ~~yaVaphhsGvYpvh~~ly~aWk~vw~i   55 (73)
                      .-|||..|. |  |+.+ +.++|.+||+-
T Consensus        94 ~~YavFt~~-G--~~~~-i~etw~~I~~~  118 (157)
T COG3708          94 STYAVFTHK-G--PIEE-IQETWQEIWKE  118 (157)
T ss_pred             ceEEEEEec-C--CHHH-HHHHHHHHHHh
Confidence            348886533 3  4445 99999999995


No 7  
>COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism]
Probab=26.22  E-value=46  Score=28.42  Aligned_cols=48  Identities=17%  Similarity=0.108  Sum_probs=34.8

Q ss_pred             HHHHHhcCCCCCCCceeeccccceecccHH-HHHHHHHHh-cccccccee
Q psy8034          15 AQQVLRSAAPVDSGYSIAPHHSGVYPVHEP-LYTAWKHIW-RVKVTSTEE   62 (73)
Q Consensus        15 k~FA~~h~ip~~~~yaVaphhsGvYpvh~~-ly~aWk~vw-~i~vTstee   62 (73)
                      ++|+..-.-.=-..+|||--||-.+|.||. .-+.-++++ ++.|++..|
T Consensus       142 ~~~~~~l~~~gv~siAVs~~~S~~NP~HE~~v~eiire~~~~i~V~~she  191 (674)
T COG0145         142 REAAAALKAAGVEAIAVSSLFSYRNPEHELRVAEIIREIGPDIPVSLSHE  191 (674)
T ss_pred             HHHHHHHHhCCCcEEEEEEecccCCcHHHHHHHHHHHHhcCCceEEechh
Confidence            344444332223579999999999999996 567888899 898887543


No 8  
>PF09225 Endonuc-PvuII:  Restriction endonuclease PvuII;  InterPro: IPR015306 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents the type II restriction endonuclease PvuII, which recognise the double-stranded DNA sequence 5'-CAGCTG-3' and cleave after G-3 []. ; PDB: 1H56_B 1EYU_A 3KSK_B 1F0O_A 1PVI_B 1PVU_B 3PVI_A 1K0Z_B 1NI0_A 2PVI_A ....
Probab=26.03  E-value=9  Score=27.63  Aligned_cols=32  Identities=22%  Similarity=0.621  Sum_probs=24.7

Q ss_pred             HHHhcCCCCCCCceeeccccceecccHHHHHHHHHHhc
Q psy8034          17 QVLRSAAPVDSGYSIAPHHSGVYPVHEPLYTAWKHIWR   54 (73)
Q Consensus        17 FA~~h~ip~~~~yaVaphhsGvYpvh~~ly~aWk~vw~   54 (73)
                      ||.=.+|.+...|...|-+-      |.+|..|-+.|.
T Consensus        99 FAiy~~I~l~~iY~l~p~~l------E~~y~~WE~kw~  130 (155)
T PF09225_consen   99 FAIYRNIELQEIYKLTPEDL------EPFYDKWERKWY  130 (155)
T ss_dssp             EEEEETTEEEEEEEE-HHHH------HHHHHHHHHHHH
T ss_pred             eeeecCcchhhhhhcCHHHh------HHHHHHHHHHHH
Confidence            67777788888887777664      778999999996


No 9  
>COG0108 RibB 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coenzyme metabolism]
Probab=25.69  E-value=22  Score=26.50  Aligned_cols=16  Identities=13%  Similarity=-0.002  Sum_probs=12.8

Q ss_pred             HHHHHHHhcCCCCCCC
Q psy8034          13 LVAQQVLRSAAPVDSG   28 (73)
Q Consensus        13 lNk~FA~~h~ip~~~~   28 (73)
                      .-.+||++|++|+-.+
T Consensus       176 ~~~~fa~~h~l~~iti  191 (203)
T COG0108         176 ELEEFAKEHGLPVITI  191 (203)
T ss_pred             HHHHHHHHcCCcEEEH
Confidence            4679999999997544


No 10 
>PF06445 GyrI-like:  GyrI-like small molecule binding domain;  InterPro: IPR010499 This domain is found in the probable effector binding domain of a number of different bacterial transcription activators [] and is also present in some DNA gyrase inhibitors. The absence of a HTH motif in the DNA gyrase inhibitors is thought to indicate the fact that these do not bind DNA.; PDB: 1JYH_A 1D5Y_B 3B49_A 3E0H_A 2KCU_A 3LUR_B 1EXI_A 3Q3D_A 1EXJ_A 3Q5S_A ....
Probab=25.21  E-value=49  Score=19.86  Aligned_cols=23  Identities=26%  Similarity=0.691  Sum_probs=17.7

Q ss_pred             CceeeccccceecccHHHHHHHHHHhc
Q psy8034          28 GYSIAPHHSGVYPVHEPLYTAWKHIWR   54 (73)
Q Consensus        28 ~yaVaphhsGvYpvh~~ly~aWk~vw~   54 (73)
                      .|||. .|-|-|   +.+.++|..+++
T Consensus        94 ~ya~~-~~~G~~---~~l~~~~~~l~~  116 (155)
T PF06445_consen   94 KYAVF-EHKGPY---DDLQEAYQKLYN  116 (155)
T ss_dssp             EEEEE-EEESCG---HGHHHHHHHHHH
T ss_pred             EEEEE-EEEccH---HHHHHHHHHHHh
Confidence            57776 555666   888899998888


No 11 
>cd03521 Link_domain_KIAA0527_like Link_domain_KIAA0527_like; this domain is found in the human protein KIAA0527. Sequence-wise, it is highly similar to the link domain. The link domain is a hyaluronan-binding (HA) domain. KIAA0527 contains a single link module. The KIAA0527 gene was originally cloned from human brain tissue.
Probab=23.55  E-value=53  Score=22.05  Aligned_cols=10  Identities=20%  Similarity=-0.024  Sum_probs=8.7

Q ss_pred             cHHHHHHHHH
Q psy8034          42 HEPLYTAWKH   51 (73)
Q Consensus        42 h~~ly~aWk~   51 (73)
                      -+|||.||+.
T Consensus        33 ~~QL~~AW~~   42 (95)
T cd03521          33 AAELRRAVVE   42 (95)
T ss_pred             HHHHHHHHHH
Confidence            4799999996


No 12 
>PHA00456 hypothetical protein
Probab=22.32  E-value=57  Score=18.21  Aligned_cols=11  Identities=36%  Similarity=0.779  Sum_probs=8.8

Q ss_pred             cHHHHHHHHHH
Q psy8034          42 HEPLYTAWKHI   52 (73)
Q Consensus        42 h~~ly~aWk~v   52 (73)
                      ..+||+.||..
T Consensus        22 Y~ely~lWk~R   32 (34)
T PHA00456         22 YQELYNLWKRR   32 (34)
T ss_pred             HHHHHHHHHHc
Confidence            47899999964


No 13 
>PF05840 Phage_GPA:  Bacteriophage replication gene A protein (GPA);  InterPro: IPR008766 Replication gene A proteins (also known as GpA) are found in bacteriophages and in bacteria as part of a suspected prophage. These proteins function as endonucleases during DNA replication [,,].; GO: 0006260 DNA replication
Probab=21.35  E-value=1.1e+02  Score=24.53  Aligned_cols=32  Identities=28%  Similarity=0.429  Sum_probs=21.0

Q ss_pred             chhhHHHHHHHHH------HhcCCCCCCCceee-ccccce
Q psy8034           6 GQPAREDLVAQQV------LRSAAPVDSGYSIA-PHHSGV   38 (73)
Q Consensus         6 ~l~~~M~lNk~FA------~~h~ip~~~~yaVa-phhsGv   38 (73)
                      .-.+|=-||+.+|      ...+|++ .|..|+ |||+|.
T Consensus       210 P~daq~yL~~~W~~~Ra~l~r~~i~~-yG~RV~EPHhDGT  248 (371)
T PF05840_consen  210 PRDAQRYLNKVWARIRAALKRRGIRF-YGFRVAEPHHDGT  248 (371)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCCCe-eeEEeecccCCCC
Confidence            3355556666663      3567876 566665 999997


No 14 
>PF02061 Lambda_CIII:  Lambda Phage CIII;  InterPro: IPR013056  Bacteriophage lambda regulatory protein CIII is a small protein that plays a role in stabilising the CII transcriptional activator, via a mechanism that is not yet fully understood [, ]. Stabilised CII activates CI, the gene for the repressor protein that prevents transcription of proteins required for lytic development. The central portion of the protein is well conserved and is both necessary and sufficient for the activity of the protein []. Comparative analysis of the CIII sequence in lambda, Bacteriophage HK022 and the lambdoid Enterobacteria phage P22 has led to the suggestion that this central region assumes an amphipathic alpha-helical structure []. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=20.65  E-value=68  Score=18.91  Aligned_cols=12  Identities=33%  Similarity=1.107  Sum_probs=9.6

Q ss_pred             HHHHHHHHHhcc
Q psy8034          44 PLYTAWKHIWRV   55 (73)
Q Consensus        44 ~ly~aWk~vw~i   55 (73)
                      .|-..||++|.|
T Consensus        27 klr~gwKRl~~i   38 (45)
T PF02061_consen   27 KLRDGWKRLWDI   38 (45)
T ss_pred             HHHHHHHHHHHH
Confidence            456689999986


Done!