Query         psy8042
Match_columns 90
No_of_seqs    102 out of 155
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 16:56:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy8042.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/8042hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3159|consensus               99.4 9.1E-14   2E-18  112.3   3.3   50    1-50    142-198 (336)
  2 PRK03822 lplA lipoate-protein   99.3 7.6E-13 1.6E-17  104.7   4.5   56    1-56    135-208 (338)
  3 PRK14061 unknown domain/lipoat  99.3 2.3E-12 4.9E-17  109.1   4.5   56    1-56    359-432 (562)
  4 TIGR00545 lipoyltrans lipoyltr  99.2 1.3E-11 2.9E-16   96.8   4.6   58    1-58    133-208 (324)
  5 COG0095 LplA Lipoate-protein l  98.9 1.3E-09 2.8E-14   82.2   4.1   34    1-34    138-171 (248)
  6 PF13124 DUF3963:  Protein of u  87.2    0.42 9.2E-06   28.8   1.6   12   60-71     10-21  (40)
  7 PRK12557 H(2)-dependent methyl  55.0     6.7 0.00014   31.4   1.3   56   19-74    247-303 (342)
  8 KOG2040|consensus               51.4      15 0.00033   34.1   3.0   34   37-71    555-592 (1001)
  9 PF07145 PAM2:  Ataxin-2 C-term  42.6      13 0.00028   18.9   0.7   14   29-42      3-16  (18)
 10 PF15342 FAM212:  FAM212 family  40.5      16 0.00034   24.0   1.0   14   61-74     46-60  (62)
 11 PF11585 Stomoxyn:  Insect anti  36.2      29 0.00063   21.0   1.7   24   58-85      2-25  (42)
 12 KOG1234|consensus               33.2      41 0.00089   28.4   2.7   48   21-68     89-144 (363)
 13 PF04383 KilA-N:  KilA-N domain  33.1      10 0.00022   25.0  -0.7   15   72-86     87-101 (111)
 14 PF05372 Delta_lysin:  Delta ly  32.9      23  0.0005   19.5   0.8    9   63-71      9-17  (25)
 15 PF03135 CagE_TrbE_VirB:  CagE,  26.9      54  0.0012   23.5   2.1   22   12-33    146-168 (205)
 16 COG1003 GcvP Glycine cleavage   25.1      80  0.0017   27.8   3.1   19   53-71    101-119 (496)
 17 PF07055 Eno-Rase_FAD_bd:  Enoy  25.0      41 0.00089   21.8   1.1   24   42-67     29-52  (65)
 18 PRK14752 delta-hemolysin; Prov  21.9      46 0.00099   20.4   0.8   17   52-71     19-35  (44)
 19 PF10593 Z1:  Z1 domain;  Inter  21.1      25 0.00055   26.8  -0.6   23    3-25     13-35  (239)

No 1  
>KOG3159|consensus
Probab=99.42  E-value=9.1e-14  Score=112.27  Aligned_cols=50  Identities=44%  Similarity=0.642  Sum_probs=43.1

Q ss_pred             CcccceeccCCeeeEeeeeeeecChHHHhhhccC-------CccCcCCcchHHHHHH
Q psy8042           1 ISGTAAKLGRPSSYHHCTLLVNVNKSRLSQSLHH-------HAINSCPEDLVKTLSK   50 (90)
Q Consensus         1 ISGSA~ki~~~~aYHHgTLLv~~Dl~~L~~~L~~-------N~~~svp~~tVenL~e   50 (90)
                      ||||||||+|++||||||||+|+|++.|+.+|+|       +.+.++|+-.|+++.+
T Consensus       142 iSGtA~kI~r~raYHH~T~L~~aDl~~ls~lL~sp~~~~~s~at~sv~sp~vk~lie  198 (336)
T KOG3159|consen  142 ISGTAYKIARNRAYHHCTMLLNADLENLSELLKSPRVNIRSKATSSVRSPRVKNLIE  198 (336)
T ss_pred             eccchhhhcCCceeeeEEeEeccchHHHHhhccCCCCCccccccccccchhhhhhhh
Confidence            7999999999999999999999999999999998       5667777545666643


No 2  
>PRK03822 lplA lipoate-protein ligase A; Provisional
Probab=99.35  E-value=7.6e-13  Score=104.72  Aligned_cols=56  Identities=25%  Similarity=0.370  Sum_probs=47.9

Q ss_pred             CcccceeccCCeeeEeeeeeeecChHHHhhhccC------------------CccCcCCcchHHHHHHHHHHHH
Q psy8042           1 ISGTAAKLGRPSSYHHCTLLVNVNKSRLSQSLHH------------------HAINSCPEDLVKTLSKSFILDL   56 (90)
Q Consensus         1 ISGSA~ki~~~~aYHHgTLLv~~Dl~~L~~~L~~------------------N~~~svp~~tVenL~e~l~~df   56 (90)
                      ||||||+..+++.|||||||+|+|++.|.++|++                  |+++.+|+++++++++.+.+.|
T Consensus       135 isGsAq~~~~~~~l~HGTlL~~~d~~~l~~~L~~~~~k~~skgv~Sv~srVtnl~~~~~~~~~e~~~~~l~~~f  208 (338)
T PRK03822        135 VSGSAYRETKDRGFHHGTLLLNADLSRLANYLNPDKKKLQAKGITSVRSRVTNLTELLPGITHEQVCEAITEAF  208 (338)
T ss_pred             EEEEeeeeeCCeEEEEEEEEecCCHHHHHHHhCCChhhhhhccccchHhhhccHHHhCCCCCHHHHHHHHHHHH
Confidence            7999999999999999999999999999999997                  4455556677777777777766


No 3  
>PRK14061 unknown domain/lipoate-protein ligase A fusion protein; Provisional
Probab=99.29  E-value=2.3e-12  Score=109.05  Aligned_cols=56  Identities=25%  Similarity=0.364  Sum_probs=49.7

Q ss_pred             CcccceeccCCeeeEeeeeeeecChHHHhhhccC------------------CccCcCCcchHHHHHHHHHHHH
Q psy8042           1 ISGTAAKLGRPSSYHHCTLLVNVNKSRLSQSLHH------------------HAINSCPEDLVKTLSKSFILDL   56 (90)
Q Consensus         1 ISGSA~ki~~~~aYHHgTLLv~~Dl~~L~~~L~~------------------N~~~svp~~tVenL~e~l~~df   56 (90)
                      |||||+++.++++|||||||+|+|++.|.++|+|                  |++++.|+++++++++.+.+.|
T Consensus       359 ISGsAq~~~~~~~lhHGTLL~d~dl~~L~~~L~~~~~Kl~sKgvkSVrsRVtNL~e~l~~it~e~f~~~L~~~f  432 (562)
T PRK14061        359 VSGSAYRETKDRGFHHGTLLLNADLSRLANYLNPDKKKLAAKGITSVRSRVTNLTELLPGIPHEQVCEAITEAF  432 (562)
T ss_pred             EEEEeEEEeCCeEEEEEEEEecCCHHHHHHHhCCCchhhhhhhhhhHHhhceeHHHhCCCCCHHHHHHHHHHHH
Confidence            7999999999999999999999999999999998                  4566666677888888887777


No 4  
>TIGR00545 lipoyltrans lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus.
Probab=99.21  E-value=1.3e-11  Score=96.80  Aligned_cols=58  Identities=22%  Similarity=0.351  Sum_probs=49.4

Q ss_pred             CcccceeccCCeeeEeeeeeeecChHHHhhhccC------------------CccCcCCcchHHHHHHHHHHHHHH
Q psy8042           1 ISGTAAKLGRPSSYHHCTLLVNVNKSRLSQSLHH------------------HAINSCPEDLVKTLSKSFILDLIG   58 (90)
Q Consensus         1 ISGSA~ki~~~~aYHHgTLLv~~Dl~~L~~~L~~------------------N~~~svp~~tVenL~e~l~~df~~   58 (90)
                      |||||++..+++.+||||||+|+|++.|.++|++                  |+++..|+++++++.+.+++.|..
T Consensus       133 isGsAq~~~~~~~l~HGtlL~~~d~~~l~~~L~~~~~k~~skgv~sv~~rv~nl~~~l~~~~~e~~~~~l~~~f~~  208 (324)
T TIGR00545       133 ISGSAYYITKDRGFHHGTLLFDADLSKLAKYLNVDKTKIESKGITSVRSRVVNVKEYLPNITTEQFLEEMTQAFFT  208 (324)
T ss_pred             EEEEeeeeeCCEEEEEEEEEccCCHHHHHHhcCCChhhhHhhcccchhhhcccHHHhCCCCCHHHHHHHHHHHHHh
Confidence            6999999999999999999999999999999997                  455556666788888887776643


No 5  
>COG0095 LplA Lipoate-protein ligase A [Coenzyme metabolism]
Probab=98.90  E-value=1.3e-09  Score=82.15  Aligned_cols=34  Identities=32%  Similarity=0.480  Sum_probs=33.2

Q ss_pred             CcccceeccCCeeeEeeeeeeecChHHHhhhccC
Q psy8042           1 ISGTAAKLGRPSSYHHCTLLVNVNKSRLSQSLHH   34 (90)
Q Consensus         1 ISGSA~ki~~~~aYHHgTLLv~~Dl~~L~~~L~~   34 (90)
                      |||+||+..+++.+||||||++.|++.|.++|++
T Consensus       138 isG~Aq~~~~~~~l~hgtll~~~d~~~l~~~l~~  171 (248)
T COG0095         138 ISGSAQRRTKGRILHHGTLLLDIDLELLARVLRV  171 (248)
T ss_pred             EeeHHHHhhCCcEEEEEEEEEeCCHHHHHHHhCC
Confidence            7999999999999999999999999999999997


No 6  
>PF13124 DUF3963:  Protein of unknown function (DUF3963)
Probab=87.24  E-value=0.42  Score=28.80  Aligned_cols=12  Identities=58%  Similarity=1.223  Sum_probs=11.0

Q ss_pred             HHhHHHHHHhhh
Q psy8042          60 QRSFSDLVKWIR   71 (90)
Q Consensus        60 ~~~f~d~~~~~~   71 (90)
                      .+.|+|+-||||
T Consensus        10 eryfddiqkwir   21 (40)
T PF13124_consen   10 ERYFDDIQKWIR   21 (40)
T ss_pred             HHHHHHHHHHHH
Confidence            578999999998


No 7  
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional
Probab=55.04  E-value=6.7  Score=31.41  Aligned_cols=56  Identities=18%  Similarity=0.062  Sum_probs=40.4

Q ss_pred             eeeecChHHHhhhccCC-ccCcCCcchHHHHHHHHHHHHHHHHHhHHHHHHhhhhcc
Q psy8042          19 LLVNVNKSRLSQSLHHH-AINSCPEDLVKTLSKSFILDLIGWQRSFSDLVKWIRLPM   74 (90)
Q Consensus        19 LLv~~Dl~~L~~~L~~N-~~~svp~~tVenL~e~l~~df~~~~~~f~d~~~~~~~~~   74 (90)
                      |+-.++++.|.+.|+|. +..+..++..-+..+.+-.++.-+.+.+.|++||++=-+
T Consensus       247 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  303 (342)
T PRK12557        247 LVETSGVDGLLKALNPELLLRSASSMHLLEKQKDLDAALEILENLDEDLLKEIEEAE  303 (342)
T ss_pred             HHHHhChHHHHHhcCHHHHhhhHhhCCcchhhhhHHHHHHHHHHHHHHHhhccccCc
Confidence            45678899999999995 344444454555556666666778888999999998544


No 8  
>KOG2040|consensus
Probab=51.41  E-value=15  Score=34.10  Aligned_cols=34  Identities=18%  Similarity=0.210  Sum_probs=23.2

Q ss_pred             cCcCCcchHHHHHH----HHHHHHHHHHHhHHHHHHhhh
Q psy8042          37 INSCPEDLVKTLSK----SFILDLIGWQRSFSDLVKWIR   71 (90)
Q Consensus        37 ~~svp~~tVenL~e----~l~~df~~~~~~f~d~~~~~~   71 (90)
                      +|..| +|-.+|..    +-.++.-|||++|.||-||+-
T Consensus       555 tEmmP-iTwp~fanIHPF~P~eQaqGY~~lf~~Le~~Lc  592 (1001)
T KOG2040|consen  555 TEMMP-ITWPEFANIHPFAPVEQAQGYQQLFTELEKDLC  592 (1001)
T ss_pred             ceecc-ccchhhccCCCCCchHHHhhHHHHHHHHHHHhh
Confidence            34445 55555432    126777899999999999973


No 9  
>PF07145 PAM2:  Ataxin-2 C-terminal region;  InterPro: IPR009818 This entry represents a conserved region approximately 250 residues long located towards the C terminus of eukaryotic ataxin-2. Ataxin-2 is a protein of unknown function, within which expansion of a polyglutamine tract (due to expansion of unstable CAG repeats in the coding region of the SCA2 gene) causes spinocerebellar ataxia type 2 (SCA2), a late-onset neurodegenerative disorder []. The expanded polyglutamine repeat in ataxin-2 causes disruption of the normal morphology of the Golgi complex and increased incidence of cell death []. Ataxin-2 is predicted to consist of mostly non-globular domains [].; PDB: 3NTW_B 1JH4_B 3KTR_B 3KUJ_B 3KUT_D 3KUS_D 1JGN_B 2RQG_A 2RQH_A.
Probab=42.65  E-value=13  Score=18.94  Aligned_cols=14  Identities=29%  Similarity=0.323  Sum_probs=10.9

Q ss_pred             hhhccCCccCcCCc
Q psy8042          29 SQSLHHHAINSCPE   42 (90)
Q Consensus        29 ~~~L~~N~~~svp~   42 (90)
                      ..-||||+.+++|.
T Consensus         3 ~s~LNp~A~eFvP~   16 (18)
T PF07145_consen    3 SSKLNPNAPEFVPS   16 (18)
T ss_dssp             SSSSSTTSSSS-TT
T ss_pred             ccccCCCCccccCC
Confidence            45799999999994


No 10 
>PF15342 FAM212:  FAM212 family
Probab=40.54  E-value=16  Score=23.97  Aligned_cols=14  Identities=50%  Similarity=1.063  Sum_probs=10.7

Q ss_pred             HhHHHHHH-hhhhcc
Q psy8042          61 RSFSDLVK-WIRLPM   74 (90)
Q Consensus        61 ~~f~d~~~-~~~~~~   74 (90)
                      +.|.|||+ |+.||-
T Consensus        46 N~FADLV~NWlDLPE   60 (62)
T PF15342_consen   46 NVFADLVGNWLDLPE   60 (62)
T ss_pred             cHHHHHHHhhhcCcc
Confidence            56889985 888874


No 11 
>PF11585 Stomoxyn:  Insect antimicrobial peptide, stomoxyn;  InterPro: IPR021037  Stomoxyn is an insect antimicrobial peptide localised in the gut epithelium, which functions in killing a range of microorganisms, parasites and some viruses. In water, stomoxyn has a flexible random coil in structure, while in trifluoroethanol it adopts a stable helical structure. Structural similarities to the antimicrobial peptide cecropin A from Hyalophora cecropia suggest that it may function in a similar manner by disrupting the bacterial membrane []. ; PDB: 1ZRX_A.
Probab=36.21  E-value=29  Score=21.00  Aligned_cols=24  Identities=33%  Similarity=0.519  Sum_probs=16.5

Q ss_pred             HHHHhHHHHHHhhhhcccccCCcccccc
Q psy8042          58 GWQRSFSDLVKWIRLPMTNWISPTFHVP   85 (90)
Q Consensus        58 ~~~~~f~d~~~~~~~~~~~~~~~~~~~~   85 (90)
                      |||++|..++|=|.-    -||.|-||.
T Consensus         2 ~frk~fn~~ikkikh----tisetahva   25 (42)
T PF11585_consen    2 SFRKHFNRFIKKIKH----TISETAHVA   25 (42)
T ss_dssp             --HHHHHHHHHHHHH----HHHHHHTHH
T ss_pred             cHHHHHHHHHHHHHh----hhHHHHHhh
Confidence            799999999998764    356666653


No 12 
>KOG1234|consensus
Probab=33.25  E-value=41  Score=28.38  Aligned_cols=48  Identities=17%  Similarity=0.191  Sum_probs=30.8

Q ss_pred             eecChHHHhhhccC-Cc--cCcCCcchHHHHHHHH--HHHH---HHHHHhHHHHHH
Q psy8042          21 VNVNKSRLSQSLHH-HA--INSCPEDLVKTLSKSF--ILDL---IGWQRSFSDLVK   68 (90)
Q Consensus        21 v~~Dl~~L~~~L~~-N~--~~svp~~tVenL~e~l--~~df---~~~~~~f~d~~~   68 (90)
                      +++|+++|.++||- ++  ++.-.+-.++..+..|  -+|.   -+..+.|++|.+
T Consensus        89 I~SD~~nl~~lLn~s~llPkGLFLd~~i~~ArkEL~~ECDYqrEA~~~~kFr~LLs  144 (363)
T KOG1234|consen   89 IDSDANNLSRLLNFSGLLPKGLFLDVLIEVARKELKWECDYQREAASALKFRPLLS  144 (363)
T ss_pred             ccCcHHHHHHHHhhcccccccccHHHHHHHHHHhcccccchHHHHHHHhhhHHHhc
Confidence            68999999999985 21  2333344455554444  2223   478888999987


No 13 
>PF04383 KilA-N:  KilA-N domain;  InterPro: IPR018004 The amino-terminal module of the poxvirus D6R/NIR proteins defines a novel conserved DNA-binding domain (the KilA-N domain) that is found in a wide range of proteins of large bacterial and eukaryotic DNA viruses []. Putative proteins with homology to the KilA-N domain have also been identified in Maverick transposable elements of the parabasalid protozoa Trichomonas vaginalis []. The KilA-N domain has been suggested to be homologous to the fungal DNA-binding APSES domain (see PDOC51299 from PROSITEDOC). In all proteins shown to contain the KilA-N domain, it occurs at the extreme amino terminus accompanied by a wide range of distinct carboxy-terminal domains. These carboxy-terminal modules may be enzymes, such as the nuclease domains, or might mediate additional, specific interactions with nucleic acids or proteins, like the RING (see PDOC00449 from PROSITEDOC) or CCCH fingers in the poxviruses []. The KilA-N domain is predicted to adopt an alpha-beta fold with four conserved strands and at least two conserved helices []. Some proteins known to contain a KilA-N domain are listed below:    Bacteriophage P1 protein kilA (P19653 from SWISSPROT).  Fowlpox virus (FPV) protein FPV236 (P14365 from SWISSPROT).   Trichomonas vaginalis G3 Putative uncharacterised protein (A2D8C0 from SWISSPROT).  Vaccinia virus hypothetical 21.7 kDa HindIII-C protein (P17366 from SWISSPROT).   ; PDB: 1MB1_A 1L3G_A 1BM8_A.
Probab=33.06  E-value=10  Score=24.96  Aligned_cols=15  Identities=33%  Similarity=0.855  Sum_probs=2.7

Q ss_pred             hcccccCCccccccc
Q psy8042          72 LPMTNWISPTFHVPI   86 (90)
Q Consensus        72 ~~~~~~~~~~~~~~~   86 (90)
                      +....||||.|++-+
T Consensus        87 ~~~a~WiSp~f~~~v  101 (111)
T PF04383_consen   87 IHYAMWISPKFALKV  101 (111)
T ss_dssp             HHHHH----------
T ss_pred             HHHHHhccccccccc
Confidence            345579999998643


No 14 
>PF05372 Delta_lysin:  Delta lysin family;  InterPro: IPR008034 Delta-lysin is a 26 amino acid, hemolytic peptide toxin secreted by Staphylococcus aureus. It is thought that delta-toxin forms an amphipathic helix upon binding to lipid bilayers []. The precise mode of action of delta-lysis is unclear.; GO: 0019836 hemolysis by symbiont of host erythrocytes, 0005576 extracellular region; PDB: 2KAM_A 2DTB_A 1DTC_A.
Probab=32.86  E-value=23  Score=19.48  Aligned_cols=9  Identities=44%  Similarity=0.578  Sum_probs=6.8

Q ss_pred             HHHHHHhhh
Q psy8042          63 FSDLVKWIR   71 (90)
Q Consensus        63 f~d~~~~~~   71 (90)
                      .-|+||||-
T Consensus         9 IgdfvKlI~   17 (25)
T PF05372_consen    9 IGDFVKLII   17 (25)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            358899984


No 15 
>PF03135 CagE_TrbE_VirB:  CagE, TrbE, VirB family, component of type IV transporter system;  InterPro: IPR018145 This domain is found in (amongst others): the Helicobacter pylori protein CagE (see examples), which together with other proteins from the cag pathogenicity island (PAI), encodes a type IV transporter secretion system. The precise role of CagE is not known, but studies in animal models have shown that it is essential for pathogenesis in Helicobacter pylori induced gastritis and peptic ulceration []. Indeed, the expression of the cag PAI has been shown to be essential for stimulating human gastric epithelial cell apoptosis in vitro [].  Similar type IV transport systems are also found in other bacteria. This domain is also found in proteins from the trb and Vir conjugal transfer systems in Agrobacterium tumefaciens and homologues of VirB proteins from other species.; GO: 0005524 ATP binding
Probab=26.90  E-value=54  Score=23.50  Aligned_cols=22  Identities=23%  Similarity=0.374  Sum_probs=16.6

Q ss_pred             eeeEeeeeeeecC-hHHHhhhcc
Q psy8042          12 SSYHHCTLLVNVN-KSRLSQSLH   33 (90)
Q Consensus        12 ~aYHHgTLLv~~D-l~~L~~~L~   33 (90)
                      -+|||+|++|-.| ++.|.+..+
T Consensus       146 ~G~~~~~i~v~~~~~~~l~~~~~  168 (205)
T PF03135_consen  146 FGYYHFTIVVFADDPEELDDKVA  168 (205)
T ss_pred             eeeeEEEEEEEcCCHHHHHHHHH
Confidence            5899999999875 666665544


No 16 
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism]
Probab=25.12  E-value=80  Score=27.76  Aligned_cols=19  Identities=16%  Similarity=0.490  Sum_probs=16.2

Q ss_pred             HHHHHHHHHhHHHHHHhhh
Q psy8042          53 ILDLIGWQRSFSDLVKWIR   71 (90)
Q Consensus        53 ~~df~~~~~~f~d~~~~~~   71 (90)
                      .++.-||++++.||-+|+.
T Consensus       101 e~~vqG~l~li~~Lq~~L~  119 (496)
T COG1003         101 EEQVQGYLELIYELQEWLK  119 (496)
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            4566799999999999986


No 17 
>PF07055 Eno-Rase_FAD_bd:  Enoyl reductase FAD binding domain;  InterPro: IPR010758 This family contains a number of bacterial putative reductases. ; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3S8M_A 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A.
Probab=24.99  E-value=41  Score=21.83  Aligned_cols=24  Identities=17%  Similarity=0.344  Sum_probs=15.5

Q ss_pred             cchHHHHHHHHHHHHHHHHHhHHHHH
Q psy8042          42 EDLVKTLSKSFILDLIGWQRSFSDLV   67 (90)
Q Consensus        42 ~~tVenL~e~l~~df~~~~~~f~d~~   67 (90)
                      .++-+|+++  +.++.||++.|-.|-
T Consensus        29 ~it~en~~e--l~D~~gy~~eFl~L~   52 (65)
T PF07055_consen   29 QITTENFKE--LGDYDGYRQEFLQLF   52 (65)
T ss_dssp             CT-CCCHHH--HS-HHHHHHHHHHHT
T ss_pred             HhccccHHH--HHhHHHHHHHHHHHc
Confidence            355556655  677789999997663


No 18 
>PRK14752 delta-hemolysin; Provisional
Probab=21.86  E-value=46  Score=20.36  Aligned_cols=17  Identities=47%  Similarity=0.884  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHhHHHHHHhhh
Q psy8042          52 FILDLIGWQRSFSDLVKWIR   71 (90)
Q Consensus        52 l~~df~~~~~~f~d~~~~~~   71 (90)
                      +..|++|   -.-|+||||-
T Consensus        19 ma~dii~---tig~~vk~ii   35 (44)
T PRK14752         19 MAQDIIS---TIGDLVKWII   35 (44)
T ss_pred             HHHHHHH---HHHHHHHHHH
Confidence            3445543   3458999984


No 19 
>PF10593 Z1:  Z1 domain;  InterPro: IPR018310  This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases. This domain is found associated with a helicase domain of superfamily type II [].
Probab=21.09  E-value=25  Score=26.83  Aligned_cols=23  Identities=17%  Similarity=0.306  Sum_probs=19.4

Q ss_pred             ccceeccCCeeeEeeeeeeecCh
Q psy8042           3 GTAAKLGRPSSYHHCTLLVNVNK   25 (90)
Q Consensus         3 GSA~ki~~~~aYHHgTLLv~~Dl   25 (90)
                      ++|.+..++...-|++|||++..
T Consensus        13 ~~Air~~rg~~~~~~SMLIH~S~   35 (239)
T PF10593_consen   13 ACAIRRLRGQGNKHNSMLIHTSR   35 (239)
T ss_pred             HHHHHHHhCCCCCCceeEEECcc
Confidence            56778888888899999999875


Done!