Diaphorina citri psyllid: psy8078


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MFLQREKFSETHGASRQNLFRLLDKSDGSTQALSREERRRRRRATQKYRTAHATRERVRVEAFNSAFGELRKLLPTLPPDKKLSKIEILRLAICYIAYLNNVLET
cccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHc
********************************************************RVRVEAFNSAFGELRKLLPTLPPDKKLSKIEILRLAICYIAYLNNVLE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLQREKFSETHGASRQNLFRLLDKSDGSTQALSREERRRRRRATQKYRTAHATRERVRVEAFNSAFGELRKLLPTLPPDKKLSKIEILRLAICYIAYLNNVLET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Helix-loop-helix protein 1 May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.confidentQ02576
Helix-loop-helix protein 1 May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.confidentQ02575

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0001085 [MF]RNA polymerase II transcription factor bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0032501 [BP]multicellular organismal processprobableGO:0008150
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QL2, chain B
Confidence level:very confident
Coverage over the Query: 48-105
View the alignment between query and template
View the model in PyMOL